PSIBLAST alignment of GI: 254780868 and protein with PDB id: 2dxu

>gi|134104169|pdb|2DXU|A Chain A, Crystal Structure Of Biotin Protein Ligase From Pyrococcus Horikoshii Complexed With Biotinyl-5'-Amp, Mutation R48a Length = 235
>gi|134104170|pdb|2DXU|B Chain B, Crystal Structure Of Biotin Protein Ligase From Pyrococcus Horikoshii Complexed With Biotinyl-5'-Amp, Mutation R48a Length = 235
 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 67/238 (28%), Positives = 108/238 (45%), Gaps = 17/238 (7%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
             R  +F  I+STN+      L        IVA  QT G G  + KW S +G L+ S++L
Sbjct: 10  GRRVIYFQEITSTNEFAKTSYLE---EGTVIVADKQTMGHGALNRKWESPEGGLWLSIVL 66

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
              + +  L  + F  AV +   +        D +IKWPND+LV  +KIAG+L+E    K
Sbjct: 67  SPKVPQKDLPKIVFLGAVGVVETLKEF---SIDGRIKWPNDVLVNYKKIAGVLVEGKGDK 123

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
                  + +G+ +           +     G  + L  +F  L  ++ R+   + K+  
Sbjct: 124 -------IVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPM 176

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             +I+NL R     +G  + I L  GS  G    +DDFG L++    G V+++  GD+
Sbjct: 177 --DILNLVRDNMI-LGVRVKI-LGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDV 230