PSIBLAST alignment of GI: 254780868 and protein with PDB id: 3efr

>gi|239781817|pdb|3EFR|A Chain A, Biotin Protein Ligase R40g Mutant From Aquifex Aeolicus In Complex With Biotin Length = 233
>gi|239781818|pdb|3EFR|B Chain B, Biotin Protein Ligase R40g Mutant From Aquifex Aeolicus In Complex With Biotin Length = 233
 Score =  108 bits (269), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 49/235 (20%), Positives = 97/235 (41%), Gaps = 11/235 (4%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLID 74
              +   + ST +   +           +VA  QT GRG    KW+S +G LY S LL  
Sbjct: 4   NLIWLKEVDSTQERLKEW---NVSYGTALVADRQTKGRGGLGRKWLSQEGGLYFSFLLNP 60

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
               ++L  L   + +++   +           +KWPND+   ++K++G+L E    K  
Sbjct: 61  KEF-ENLLQLPLVLGLSVSEALEEITE--IPFSLKWPNDVYFQEKKVSGVLRELSKDKLI 117

Query: 135 LQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGRE 194
           +   +       +          T  +  G   D K++   + + ++  L    K+   +
Sbjct: 118 VGIGINVNQ--REIPEEIKDRATTLYEITGKDWDRKEVLLKVLKRISENLKK-FKEKSFK 174

Query: 195 EIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
           E           +G+ + + L  G I G+ VG+ + G  L+  ++G +++I +G+
Sbjct: 175 EFKGKIESKMLYLGEEVKL-LGEGKITGKLVGLSEKGGALILTEEG-IKEILSGE 227