RPSBLAST alignment for GI: 254780868 and conserved domain: pfam02237

>gnl|CDD|111161 pfam02237, BPL_C, Biotin protein ligase C terminal domain. The function of this structural domain is unknown. It is found to the C terminus of the biotin protein ligase catalytic domain pfam01317. Length = 47
 Score = 41.7 bits (99), Expect = 2e-04
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 206 GIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
            +G  + +    G + G  VG+DD G LLLE   G +R I +GDI 
Sbjct: 1   HLGKEVKVTTGGGKVEGIAVGIDDDGRLLLETDDG-IRIIISGDIS 45