RPSBLAST alignment of GI: 254780868 and MMDB domain: 1vqz_A_1-49_92-251

>1vqz_A (A:1-49,A:92-251) Lipoate-protein ligase, putative; NP_345629.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.99A {Streptococcus pneumoniae TIGR4}Length = 209
 Score = 38.8 bits (90), Expect = 7e-04
 Identities = 25/154 (16%), Positives = 47/154 (30%), Gaps = 27/154 (17%)

Query: 59  WISDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQ 118
           WI+   NL  +++  +  +K       F        VI +   +G   +    ND+ +  
Sbjct: 47  WIN--NNLNYTIISKEDENKA------FDFKSFSTPVINTLAQLGVKAEFTGRNDLEIDG 98

Query: 119 RKIAGILIE----------TLNLKNGLQAVVVGIGLNVKHCPVDT------PYPVTSLQR 162
           +K  G               L     L    +   L V     ++         VT++  
Sbjct: 99  KKFCGNAQAYINGRIXHHGCLLFDVDLSV--LANALKVSKDKFESKGVKSVRARVTNIIN 156

Query: 163 E-GGCIDLKDIFSLLFQDVARVLDLWKKDTGREE 195
           E    I ++    LL +   +      +    EE
Sbjct: 157 ELPKKITVEKFRDLLLEYXKKEYPEXTEYVFSEE 190