RPSBLAST alignment of GI: 254780868 and MMDB domain: 2dxu_A_1-187

>2dxu_A (A:1-187) Biotin--[acetyl-COA-carboxylase] ligase; biotin biosynthesis, dimer, X-RAY diffraction, structural genomics, NPPSFA; HET: BT5; 1.28A {Pyrococcus horikoshii} PDB: 2dzc_A 2ejg_A* 2e3y_A* 2e41_A* 2e64_A 2ejf_A* 2zgw_A* 1wqw_A* 1wpy_A* 1wq7_A 1wnl_A* 1x01_A* 2dkg_A* 2dth_A* 2dti_A* 2dto_A* 2fyk_A* 2djz_A* 2hni_A 2e10_A ...Length = 187
 Score =  118 bits (296), Expect = 8e-28
 Identities = 61/189 (32%), Positives = 92/189 (48%), Gaps = 17/189 (8%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
            R  +F  I+STN+      L        IVA  QT G G  + KW S +G L+ S++L 
Sbjct: 11  RRVIYFQEITSTNEFAKTSYLEEGT---VIVADKQTMGHGALNRKWESPEGGLWLSIVLS 67

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
             + +  L  + F  AV +   +        D +IKWPND+LV  +KIAG+L+E      
Sbjct: 68  PKVPQKDLPKIVFLGAVGVVETLKE---FSIDGRIKWPNDVLVNYKKIAGVLVEGKG--- 121

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDTG 192
               +V+GIGLNV       P   TS++ E G  + L  +F  L  ++ R+   + K+  
Sbjct: 122 --DKIVLGIGLNV---NNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPM 176

Query: 193 REEIMNLWR 201
             +I+NL R
Sbjct: 177 --DILNLVR 183