HHsearch alignment for GI: 254780869 and conserved domain: KOG1138

>KOG1138 consensus.
Probab=98.59  E-value=3e-05  Score=56.81  Aligned_cols=295  Identities=15%  Similarity=0.143  Sum_probs=160.1

Q ss_pred             HCCCEEEEECCCCCCCCCHHHHHHHC--CCCEECCHHHHHHH----HHHHHHC---------CCCCCC------------
Q ss_conf             12468996054301216078889862--99779299999999----9999854---------886556------------
Q gi|254780869|r   66 KNLMAIFITHAHEDHYGALHDLWSFL--HVPVYASPFAIGLL----EAKRVYE---------RVSKKI------------  118 (559)
Q Consensus        66 ~~i~~i~iTH~H~DHiGalp~l~~~~--~~pIY~s~~t~~li----~~~~~~~---------~~~~~~------------  118 (559)
T Consensus        95 stiDvILISNy~--~mlgLPfiTentGF~gkiY~TE~t~qiGrllMEelv~fier~p~~~S~~~Wk~k~~~~~lpsplk~  172 (653)
T KOG1138          95 STIDVILISNYM--GMLGLPFITENTGFFGKIYATEPTAQIGRLLMEELVSFIERFPKASSAPLWKKKLDSELLPSPLKK  172 (653)
T ss_pred             CCEEEEEECCHH--HHCCCCEEECCCCCEEEEEEECHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCHH
T ss_conf             430399971600--200563364178832689982248999899999999999855455664355542156645777610


Q ss_pred             ---------------------CEEEECCCCEEEE-CCEEEEEEECCCCCCCCCEEEEEECCCEEEECCCCEECCCCCCCC
Q ss_conf             ---------------------2255175555776-348999985567777653567987681799833402467766542
Q gi|254780869|r  119 ---------------------PCISFQAGDKVDV-GAFSIESVRVNHSIPETMALVIRSPVGNIVHTGDWKLDDDAILGD  176 (559)
Q Consensus       119 ---------------------~~~~i~~~~~~~~-g~~~v~~~~~~Hsip~a~~~~I~t~~g~i~ytGDfk~d~~p~~g~  176 (559)
T Consensus       173 ~~~~~~Wr~~ysl~Dv~sclsKVq~v~f~ekidlfga~~vtplsSG~-~lGSsnW~I~t~nek~sYvS~Ss~lt------  245 (653)
T KOG1138         173 AVFLGSWRRLYSLDDVESCLSKVQGVGFAEKIDLFGALIVTPLSSGY-DLGSSNWLINTPNEKLSYVSGSSFLT------  245 (653)
T ss_pred             HCCCCCEEEEEEHHHHHHHHHHHEECCCCEEEECCCEEEEEECCCCC-CCCCCCEEEECCCCCEEEEECCCCCC------
T ss_conf             10412103654566788888765241411045102348998624554-03421047745886368874676434------


Q ss_pred             CCCHHHHHHCCCCCCEEEEECCCCCCCCCCCCCH--HHHHHHHHHHHHHCCCCEEEEECHHHH-----HHHHHHHHHHHH
Q ss_conf             3898899860878829999635645788877778--799999999986279839999414778-----999999999987
Q gi|254780869|r  177 VTDKDSLCAIGNEGILALMCDSTNAMREGTCISE--KGIKKNIYDIMKNAKGCVLVTTFSSSV-----SRIRSIIDIAEQ  249 (559)
Q Consensus       177 ~~d~~~l~~~~~~gv~~Li~esT~~~~~~~~~sE--~~v~~~i~~~~~~~~grViv~~fasni-----~Ri~~i~~~a~~  249 (559)
T Consensus       246 -th~r~md~a~Lk~~Dvli~T~ls-ql~tanpd~m~gelc~nvt~~~rn-~GsvL~PcyPsGviydl~Ecls~~idna~l  322 (653)
T KOG1138         246 -THPRPMDQAGLKETDVLIYTGLS-QLPTANPDEMGGELCKNVTLTGRN-HGSVLLPCYPSGVIYDLIECLSQDIDNAGL  322 (653)
T ss_pred             -CCCCCCCCCCCCCCCEEEEECCC-CCCCCCCCCHHHHHHHHHHHHHHC-CCCEEEECCCCCHHHHHHHHHHHCCCCCCC
T ss_conf             -68864332445544589981533-256678421024688789998644-881651026772166778774111123677


Q ss_pred             HCCEEEEEC---HHHHH-------HHHHHHHCC-CCCCCC----CCCCHHHHCCCC---------CCCEEEEEECCCCCH
Q ss_conf             188699844---86999-------999887428-767765----422656622388---------020899996696326
Q gi|254780869|r  250 IGRKIVLLG---SSLKR-------VVSVAIDVG-IIKKDQ----LFLSDESFGLYP---------REQLIVIATGSQGEP  305 (559)
Q Consensus       250 ~~R~v~i~G---rs~~~-------~~~~a~~~g-~l~~~~----~~i~~~~~~~~p---------~~~~~ii~TGsqge~  305 (559)
T Consensus       323 s~~P~yfISpvadSsla~s~ilaEwls~akqnkvylpe~p~~hs~lI~~~rlkiy~sl~g~fSndfrqpcvvf~~H~S--  400 (653)
T KOG1138         323 SDTPIYFISPVADSSLATSDILAEWLSLAKQNKVYLPEAPFPHSTLITINRLKIYLSLLGLFSNDFRQPCVVFMGHPS--  400 (653)
T ss_pred             CCCCCEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCCCCCCCCEEEEECCEEEHHHHHHHHHHHCCCCEEEECCCCC--
T ss_conf             677606855541545667789999997633140435689998755875063232588998876651266057627853--


Q ss_pred             HHHHHHHCCCCCC--CCCCCCCCEEEEEEECCCCHHHHHHHHHHHHHCCCEEEEECCCCCCEECCCCCCHHHHHHHHHHC
Q ss_conf             8898852027776--53026896699996158861778999997651031134303566641315788978999999754
Q gi|254780869|r  306 RSALAQLSRGEMR--NVKLAEKDTVIFSSRAIPGNEVAIGHIKNRLVEQGVRVIAEDAECPVHVSGHPYPNDLKRMYQWI  383 (559)
Q Consensus       306 ~a~l~ria~~~~~--~i~l~~~D~vI~ss~~ipGnE~~~~~~~n~l~~~g~~vi~~~~~~~iH~SGHa~~edl~~li~~i  383 (559)
T Consensus       401 ----lRfgdv~h~~e~~g~sp~NsvI~tdpD~~-~~----~vl~PfrpLamK~i~cp----idtr--lnfqql~kLlkel  465 (653)
T KOG1138         401 ----LRFGDVVHFLECWGLSPKNSVIFTDPDFS-YL----LVLAPFRPLAMKIIYCP----IDTR--LNFQQLPKLLKEL  465 (653)
T ss_pred             ----HHHHHHHHHHHHHCCCCCCCEEEECCCCC-HH----HHHCCCCCCCCEEEECC----CCCC--CCHHHHHHHHHHH
T ss_conf             ----00337899999964798875688579975-35----55257765420368645----3034--3678899999973


Q ss_pred             CCCEEE
Q ss_conf             953999
Q gi|254780869|r  384 RPQVLV  389 (559)
Q Consensus       384 kPk~~I  389 (559)
T Consensus       466 qPk~vl  471 (653)
T KOG1138         466 QPKIVL  471 (653)
T ss_pred             CCCEEE
T ss_conf             887898