BLAST/PSIBLAST alignment of GI: 254780869 and GI: 222085592 at iteration 1
>gi|222085592|ref|YP_002544122.1| metallo-beta-lactamase family protein [Agrobacterium radiobacter K84] Length = 557
>gi|221723040|gb|ACM26196.1| metallo-beta-lactamase family protein [Agrobacterium radiobacter K84] Length = 557
 Score =  676 bits (1745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/555 (58%), Positives = 428/555 (77%), Gaps = 1/555 (0%)

Query: 2   KNEELVFLPLGGVGEIGMNMALYGYGSPSSRKWIMIDCGVSFPKDDLPGVDLVFPDITFI 61
           K +ELVFLPLGGVGEIGMN+ALYGYG+P  R+WIM+DCGV+FP  DLPGVDLV PDI F+
Sbjct: 3   KQDELVFLPLGGVGEIGMNLALYGYGTPEHRQWIMVDCGVTFPGPDLPGVDLVLPDIRFL 62

Query: 62  MKERKNLMAIFITHAHEDHYGALHDLWSFLHVPVYASPFAIGLLEAKRVYERVSKKIPCI 121
            KERKNL  I ITHAHEDHYGAL DLW  L+VPVYAS F  GLLEAKR YE+   +IP  
Sbjct: 63  AKERKNLKGIIITHAHEDHYGALSDLWPGLNVPVYASGFTAGLLEAKRDYEKTMGQIPIT 122

Query: 122 SFQAGDKVDVGAFSIESVRVNHSIPETMALVIRSPVGNIVHTGDWKLDDDAILGDVTDKD 181
            F+AGD+++VG FSIE V VNHSIPE M+L+IR+PVGN++HTGDWK+D +  LG +TD+ 
Sbjct: 123 PFKAGDRINVGPFSIEGVAVNHSIPEPMSLMIRTPVGNVIHTGDWKIDHEPSLGPLTDEA 182

Query: 182 SLCAIGNEGILALMCDSTNAMREGTCISEKGIKKNIYDIMKNAKGCVLVTTFSSSVSRIR 241
               +G+EG+LALMCDSTNA+R+G   SEK +  ++  I++NA+G V +TTFSS+V RIR
Sbjct: 183 RFRQLGDEGVLALMCDSTNALRDGVSPSEKDVSASLRKIIENAEGRVAITTFSSNVGRIR 242

Query: 242 SIIDIAEQIGRKIVLLGSSLKRVVSVAIDVGIIKKDQLFLSDESFGLYPREQLIVIATGS 301
           +I + AE  GR+I+LLGSSLKRVV V+ D+GI++  + F++++ +G  PR+++++I TGS
Sbjct: 243 TIAEAAEAAGREILLLGSSLKRVVDVSRDIGIMEGLKPFIAEDEYGYIPRDKVVIILTGS 302

Query: 302 QGEPRSALAQLSRGEMRNVKLAEKDTVIFSSRAIPGNEVAIGHIKNRLVEQGVRVIAEDA 361
           QGEPR+ALA+LSR EMR+V LA  D V+FSSRAIPGNE AI  IKN L EQGV V+  DA
Sbjct: 303 QGEPRAALAKLSRDEMRHVALAAGDIVVFSSRAIPGNEKAIQDIKNGLTEQGVHVVT-DA 361

Query: 362 ECPVHVSGHPYPNDLKRMYQWIRPQVLVAIHGEPLHLVAHKELALQEGIACVPPVRNGKM 421
           E  VHVSGHP  N+L++MY+W RP+V+V +HGEP HL AHKELA Q GIA VP VRNG +
Sbjct: 362 EALVHVSGHPRRNELQKMYEWTRPKVVVPVHGEPTHLAAHKELAEQSGIAIVPKVRNGDI 421

Query: 422 LRLFPDPIEIIDEVVHGLFLKDGFLIGKFADLGIAKRRQLSFVGHLSVNVLLDNHYNIFG 481
           LRL P  +E+I +  HG   KDG LIG F ++GI +R++LS+VGH++VNV+LD  Y+I G
Sbjct: 422 LRLAPGSVEVIGQAPHGRIFKDGILIGDFDEMGIGERKKLSYVGHVAVNVVLDARYDIVG 481

Query: 482 VPEIVDIGIPAYDGDGGKIHKLLLKTVITTVVDLPQFRRKDLKLLRESISSALRSLLKKV 541
            P+IV IG+PAYD +G ++   L   V++ +  +P+ RRKD+ +L+E+   A+R+     
Sbjct: 482 DPDIVAIGLPAYDDEGEEMEDTLFDAVVSAIESIPRARRKDIDMLQEAARRAVRAAANHG 541

Query: 542 WGKKPLVTVFINKIS 556
           WGKKP+VTVF+ +++
Sbjct: 542 WGKKPVVTVFVTRMA 556