RPSBLAST alignment of GI: 254780869 and protein with PDBid: 1jjt

>1jjt_A IMP-1 metallo beta-lactamase; metallo-beta-lactamase inhibitor, succinic acid inhibitor, hydrolase; HET: BDS; 1.80A {Pseudomonas aeruginosa} SCOP: d.157.1.1 PDB: 1dd6_A* 1vgn_A* 2doo_A* 1wup_A 1wuo_A 1jje_A* 1ddk_A Length = 228
 Score = 49.4 bits (117), Expect = 2e-06
 Identities = 25/159 (15%), Positives = 48/159 (30%), Gaps = 21/159 (13%)

Query: 8   FLPLGGVGEIGMNMALYGYGSPSSRKWIMIDCGVSFPKDDLPGVDLVFPDITFIMKERKN 67
           F  + G G +  +  +       + +  +ID   +               +T+ ++    
Sbjct: 22  FEEVNGWGVVPKHGLVVL----VNAEAYLIDTPFT--------AKDTEKLVTWFVERGYK 69

Query: 68  LMAIFITHAHEDHYGALHDLWSFLHVPVYASPFAIGLLEAKRVYERVSKKIPCISFQAGD 127
           +     +H H D  G +  L S   +P YAS     LL+               +  +G 
Sbjct: 70  IKGSISSHFHSDSTGGIEWLNSR-SIPTYASELTNELLKKDGKV-------QATNSFSGV 121

Query: 128 KVDVGAFSIESVRVNHSIPETMALVIRSPVGNIVHTGDW 166
              +    IE              V+  P   I+  G +
Sbjct: 122 NYWLVKNKIEVFYPGPGHTPDNV-VVWLPERKILFGGCF 159