RPSBLAST alignment of GI: 254780869 and protein with PDBid: 2xf4

>2xf4_A Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A {Salmonella enterica} Length = 210
 Score = 51.5 bits (123), Expect = 5e-07
 Identities = 28/162 (17%), Positives = 44/162 (27%), Gaps = 20/162 (12%)

Query: 27  GSPSSRKWIMIDCGVSFPKDDLPGVDLVFPDITFIMKERKNLMAIFITHAHEDHYGALHD 86
               +R   ++D G                    +      LM I +TH H DH GA  +
Sbjct: 19  WCEQTRLAALVDPGGDAE-----------KIKQEVDASGVTLMQILLTHGHLDHVGAASE 67

Query: 87  LWSFLHVPVYASPFAIGLLEAKRV-------YERVSKKIPCISFQAGDKVDVGAFSIESV 139
           L     VPV                       +      P      GD+V VG  +++ +
Sbjct: 68  LAQHYGVPVIGPEKEDEFWLQGLPAQSRMFGLDECQPLTPDRWLNDGDRVSVGNVTLQVL 127

Query: 140 RVNHSIPETMALVIRSPVGNIVHTGDWKLDDDAILGDVTDKD 181
                 P  +          ++ +GD          D    D
Sbjct: 128 HCPGHTPGHVVFFD--EQSQLLISGDVIFKGGVGRSDFPRGD 167