>TIGR00415 serS_MJ seryl-tRNA synthetase; InterPro: IPR004503 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology . The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric . Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices , and are mostly dimeric or multimeric, containing at least three conserved regions , , . However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases; these synthetases are further divided into three subclasses, a, b and c, according to sequence homology. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases . Seryl-tRNA synthetase (6.1.1.11 from EC) exists as monomer and belongs to class IIa . The seryl-tRNA synthetases from a few of the archaea that belong to this group are different from the set of mutually more closely related seryl-tRNA synthetases from eubacteria, eukaryotes, and other archaea (IPR002317 from INTERPRO).; GO: 0000166 nucleotide binding, 0004828 serine-tRNA ligase activity, 0005524 ATP binding, 0006412 translation, 0006434 seryl-tRNA aminoacylation, 0005737 cytoplasm.

Probab=98.33 E-value=2.1e-06 Score=59.84 Aligned_cols=167 Identities=16% Similarity=0.218 Sum_probs=120.4 Q ss_pred HHHHHCCCEE-CCCCCHHCCCCHHHHHHHHHHHHHHHH-HHCCCEEEECCCCCCHHHHHHCCCCHHHHHHHCCHHH---- Q ss_conf 2135303200-038811104316999999999999999-8669889735751246898771973112222104021---- Q gi|254780870|r 25 LMLRTGMIHQ-HSKGIYSWLPLGQKALDNVNAIIREEQ-NRTGAIEMSVPTLQSADLWVESGRYDSYGKEMLRLAD---- 98 (449) Q Consensus 25 ll~~~g~i~~-~~~G~~~~lP~G~~i~~~le~~~r~~~-~~~G~~ei~tP~l~~~eL~~~SGh~d~~~~em~~~~d---- 98 (449) T Consensus 200 ~~~~~gw~~~~pg~g~w~~~p~~~~~~~~~~~~~~~~~~~~~g~~~c~~p~~~p~~~~~~~~~~~g~p~g~~~~~~p~~~ 279 (520) T TIGR00415 200 EAEKLGWVKKFPGRGQWFYGPPITALFRALEELFVEEVVKPLGFVECLFPKLIPLDILYKLRYLEGLPEGLYYCCPPKRD 279 (520) T ss_pred HHHHHCCHHCCCCCCCEECCCCHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEECCCCCC T ss_conf 67661101126887620016506788888998889887654011345310010267777767641365452552277556 Q ss_pred -------------------------CCCCCCEECCCCCCCCCCCHHHCCCCCCCCCEEEEE-CCCCCCCCCCCCCCCCCC Q ss_conf -------------------------378620003455543101100001342013402641-465334566767543453 Q gi|254780870|r 99 -------------------------RNDKAMIYGPTHEEVMTDIFRSHIKSYRNLPFTFYQ-IQLKFRDELRPRFGVMRS 152 (449) Q Consensus 99 -------------------------~~~~~~~LrP~~~e~~~~i~~~~~~SYr~LPlr~y~-ig~~fR~E~rp~~GL~R~ 152 (449) T Consensus 280 p~~~~~~~~~~~~~~~~p~~~~~~~~~dpg~~~~p~~c~p~~~~~~~~~~~~~d~p~~~~d~~gw~~~w~~gg~~g~d~~ 359 (520) T TIGR00415 280 PELFEEFKNELLINKEVPLDLLKNGLKDPGYVLAPAQCEPFYQFLEGEVVDAEDLPVKFFDRSGWTYRWEGGGAKGLDRV 359 (520) T ss_pred HHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCEECCCCCCHHHHHHCCCCCCCCCCCEEEECCCCCEEEECCCCCCCHHHH T ss_conf 35789876655420035578987530487704303110035675412110000143112205774244237663212455 Q ss_pred EEEEEEECCEECCCHHHHHHHHHHHHHHHHHHHHHCCCHH Q ss_conf 1668740422118868879999999998741111006201 Q gi|254780870|r 153 REFLMKDAYSFDLTPEGSKHSYNKMFVSYLRIFHRLGLKS 192 (449) Q Consensus 153 ReF~q~D~~~F~~~~e~~~~e~~~~~~~~~~i~~~lgl~~ 192 (449) T Consensus 360 ~~~~~~~~~w~-~~p~~~~~~~d~~~~~~~~~~~~~~~~~ 398 (520) T TIGR00415 360 NEFLRVELVWL-GEPGFTEETRDKTLELAEDLADELDLEW 398 (520) T ss_pred HHHHHEEEEEE-CCCCHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 45331113551-4752012333445665555555410011

HHsearch alignment for GI: 254780870 and conserved domain: TIGR00415