BLAST/PSIBLAST alignment of GI: 254780871 and GI: 23501711 at iteration 1
>gi|23501711|ref|NP_697838.1| lipoprotein releasing system ATP-binding protein LolD [Brucella suis 1330] Length = 227
>gi|62289773|ref|YP_221566.1| lipoprotein releasing system ATP-binding protein [Brucella abortus bv. 1 str. 9-941] Length = 227
>gi|82699701|ref|YP_414275.1| ABC transporter ATPase [Brucella melitensis biovar Abortus 2308] Length = 227
>gi|161618788|ref|YP_001592675.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella canis ATCC 23365] Length = 227
>gi|189024016|ref|YP_001934784.1| ATP/GTP-binding site motif A (P-loop) [Brucella abortus S19] Length = 227
>gi|225627319|ref|ZP_03785356.1| Lipoprotein-releasing system ATP-binding protein lolD [Brucella ceti str. Cudo] Length = 227
>gi|225852338|ref|YP_002732571.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella melitensis ATCC 23457] Length = 227
>gi|237815259|ref|ZP_04594257.1| Lipoprotein-releasing system ATP-binding protein lolD [Brucella abortus str. 2308 A] Length = 227
>gi|254689078|ref|ZP_05152332.1| Lipoprotein-releasing system ATP-binding protein lolD [Brucella abortus bv. 6 str. 870] Length = 227
>gi|254693561|ref|ZP_05155389.1| Lipoprotein-releasing system ATP-binding protein lolD [Brucella abortus bv. 3 str. Tulya] Length = 227
>gi|254697212|ref|ZP_05159040.1| Lipoprotein-releasing system ATP-binding protein lolD [Brucella abortus bv. 2 str. 86/8/59] Length = 227
>gi|254701590|ref|ZP_05163418.1| Lipoprotein-releasing system ATP-binding protein lolD [Brucella suis bv. 5 str. 513] Length = 227
>gi|254704137|ref|ZP_05165965.1| Lipoprotein-releasing system ATP-binding protein lolD [Brucella suis bv. 3 str. 686] Length = 227
>gi|254706962|ref|ZP_05168790.1| Lipoprotein-releasing system ATP-binding protein lolD [Brucella pinnipedialis M163/99/10] Length = 227
>gi|254709930|ref|ZP_05171741.1| Lipoprotein-releasing system ATP-binding protein lolD [Brucella pinnipedialis B2/94] Length = 227
>gi|254713931|ref|ZP_05175742.1| Lipoprotein-releasing system ATP-binding protein lolD [Brucella ceti M644/93/1] Length = 227
>gi|254717011|ref|ZP_05178822.1| Lipoprotein-releasing system ATP-binding protein lolD [Brucella ceti M13/05/1] Length = 227
>gi|254730109|ref|ZP_05188687.1| Lipoprotein-releasing system ATP-binding protein lolD [Brucella abortus bv. 4 str. 292] Length = 227
>gi|256031423|ref|ZP_05445037.1| Lipoprotein-releasing system ATP-binding protein lolD [Brucella pinnipedialis M292/94/1] Length = 227
>gi|256044501|ref|ZP_05447405.1| Lipoprotein-releasing system ATP-binding protein lolD [Brucella melitensis bv. 1 str. Rev.1] Length = 227
>gi|256113357|ref|ZP_05454215.1| Lipoprotein-releasing system ATP-binding protein lolD [Brucella melitensis bv. 3 str. Ether] Length = 227
>gi|256159544|ref|ZP_05457312.1| Lipoprotein-releasing system ATP-binding protein lolD [Brucella ceti M490/95/1] Length = 227
>gi|256254831|ref|ZP_05460367.1| Lipoprotein-releasing system ATP-binding protein lolD [Brucella ceti B1/94] Length = 227
>gi|256257327|ref|ZP_05462863.1| Lipoprotein-releasing system ATP-binding protein lolD [Brucella abortus bv. 9 str. C68] Length = 227
>gi|256264163|ref|ZP_05466695.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella melitensis bv. 2 str. 63/9] Length = 227
>gi|256369255|ref|YP_003106763.1| lipoprotein releasing system ATP-binding protein LolD [Brucella microti CCM 4915] Length = 227
>gi|260168557|ref|ZP_05755368.1| lipoprotein releasing system ATP-binding protein LolD [Brucella sp. F5/99] Length = 227
>gi|260545479|ref|ZP_05821220.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella abortus NCTC 8038] Length = 227
>gi|260563855|ref|ZP_05834341.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella melitensis bv. 1 str. 16M] Length = 227
>gi|260754576|ref|ZP_05866924.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella abortus bv. 6 str. 870] Length = 227
>gi|260757799|ref|ZP_05870147.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella abortus bv. 4 str. 292] Length = 227
>gi|260761622|ref|ZP_05873965.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella abortus bv. 2 str. 86/8/59] Length = 227
>gi|260883603|ref|ZP_05895217.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella abortus bv. 9 str. C68] Length = 227
>gi|261213826|ref|ZP_05928107.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella abortus bv. 3 str. Tulya] Length = 227
>gi|261218818|ref|ZP_05933099.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella ceti M13/05/1] Length = 227
>gi|261222012|ref|ZP_05936293.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella ceti B1/94] Length = 227
>gi|261314425|ref|ZP_05953622.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella pinnipedialis M163/99/10] Length = 227
>gi|261317476|ref|ZP_05956673.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella pinnipedialis B2/94] Length = 227
>gi|261321683|ref|ZP_05960880.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella ceti M644/93/1] Length = 227
>gi|261752143|ref|ZP_05995852.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella suis bv. 5 str. 513] Length = 227
>gi|261754803|ref|ZP_05998512.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella suis bv. 3 str. 686] Length = 227
>gi|261758030|ref|ZP_06001739.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella sp. F5/99] Length = 227
>gi|265988512|ref|ZP_06101069.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella pinnipedialis M292/94/1] Length = 227
>gi|265990925|ref|ZP_06103482.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella melitensis bv. 1 str. Rev.1] Length = 227
>gi|265994763|ref|ZP_06107320.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella melitensis bv. 3 str. Ether] Length = 227
>gi|265997976|ref|ZP_06110533.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella ceti M490/95/1] Length = 227
>gi|294852180|ref|ZP_06792853.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella sp. NVSL 07-0026] Length = 227
>gi|297248176|ref|ZP_06931894.1| lipoprotein-releasing system ATP-binding protein [Brucella abortus bv. 5 str. B3196] Length = 227
>gi|306841940|ref|ZP_07474618.1| Lipoprotein-releasing system ATP-binding protein lolD [Brucella sp. BO2] Length = 227
>gi|306843760|ref|ZP_07476359.1| Lipoprotein-releasing system ATP-binding protein lolD [Brucella sp. BO1] Length = 227
>gi|47605891|sp|Q8G195|LOLD_BRUSU RecName: Full=Lipoprotein-releasing system ATP-binding protein LolD Length = 227
>gi|47605912|sp|Q8YGM0|LOLD_BRUME RecName: Full=Lipoprotein-releasing system ATP-binding protein LolD Length = 227
>gi|81309430|sp|Q57DS9|LOLD_BRUAB RecName: Full=Lipoprotein-releasing system ATP-binding protein LolD Length = 227
>gi|118572772|sp|Q2YNH6|LOLD_BRUA2 RecName: Full=Lipoprotein-releasing system ATP-binding protein LolD Length = 227
>gi|23347635|gb|AAN29753.1| lipoprotein releasing system ATP-binding protein LolD [Brucella suis 1330] Length = 227
>gi|62195905|gb|AAX74205.1| LolD, lipoprotein releasing system ATP-binding protein [Brucella abortus bv. 1 str. 9-941] Length = 227
>gi|82615802|emb|CAJ10800.1| ATP/GTP-binding site motif A (P-loop):ABC transporter:AAA ATPase [Brucella melitensis biovar Abortus 2308] Length = 227
>gi|161335599|gb|ABX61904.1| Lipoprotein-releasing system ATP-binding protein lolD [Brucella canis ATCC 23365] Length = 227
>gi|189019588|gb|ACD72310.1| ATP/GTP-binding site motif A (P-loop) [Brucella abortus S19] Length = 227
>gi|225617324|gb|EEH14369.1| Lipoprotein-releasing system ATP-binding protein lolD [Brucella ceti str. Cudo] Length = 227
>gi|225640703|gb|ACO00617.1| Lipoprotein-releasing system ATP-binding protein lolD [Brucella melitensis ATCC 23457] Length = 227
>gi|237790096|gb|EEP64306.1| Lipoprotein-releasing system ATP-binding protein lolD [Brucella abortus str. 2308 A] Length = 227
>gi|255999415|gb|ACU47814.1| lipoprotein releasing system ATP-binding protein LolD [Brucella microti CCM 4915] Length = 227
>gi|260096886|gb|EEW80761.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella abortus NCTC 8038] Length = 227
>gi|260153871|gb|EEW88963.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella melitensis bv. 1 str. 16M] Length = 227
>gi|260668117|gb|EEX55057.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella abortus bv. 4 str. 292] Length = 227
>gi|260672054|gb|EEX58875.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella abortus bv. 2 str. 86/8/59] Length = 227
>gi|260674684|gb|EEX61505.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella abortus bv. 6 str. 870] Length = 227
>gi|260873131|gb|EEX80200.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella abortus bv. 9 str. C68] Length = 227
>gi|260915433|gb|EEX82294.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella abortus bv. 3 str. Tulya] Length = 227
>gi|260920596|gb|EEX87249.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella ceti B1/94] Length = 227
>gi|260923907|gb|EEX90475.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella ceti M13/05/1] Length = 227
>gi|261294373|gb|EEX97869.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella ceti M644/93/1] Length = 227
>gi|261296699|gb|EEY00196.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella pinnipedialis B2/94] Length = 227
>gi|261303451|gb|EEY06948.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella pinnipedialis M163/99/10] Length = 227
>gi|261738014|gb|EEY26010.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella sp. F5/99] Length = 227
>gi|261741896|gb|EEY29822.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella suis bv. 5 str. 513] Length = 227
>gi|261744556|gb|EEY32482.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella suis bv. 3 str. 686] Length = 227
>gi|262552444|gb|EEZ08434.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella ceti M490/95/1] Length = 227
>gi|262765876|gb|EEZ11665.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella melitensis bv. 3 str. Ether] Length = 227
>gi|263001709|gb|EEZ14284.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella melitensis bv. 1 str. Rev.1] Length = 227
>gi|263094381|gb|EEZ18226.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella melitensis bv. 2 str. 63/9] Length = 227
>gi|264660709|gb|EEZ30970.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella pinnipedialis M292/94/1] Length = 227
>gi|294820769|gb|EFG37768.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella sp. NVSL 07-0026] Length = 227
>gi|297175345|gb|EFH34692.1| lipoprotein-releasing system ATP-binding protein [Brucella abortus bv. 5 str. B3196] Length = 227
>gi|306275951|gb|EFM57664.1| Lipoprotein-releasing system ATP-binding protein lolD [Brucella sp. BO1] Length = 227
>gi|306287973|gb|EFM59381.1| Lipoprotein-releasing system ATP-binding protein lolD [Brucella sp. BO2] Length = 227
>gi|326408846|gb|ADZ65911.1| ATP/GTP-binding site motif A (P-loop) [Brucella melitensis M28] Length = 227
>gi|326538561|gb|ADZ86776.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella melitensis M5-90] Length = 227
Score = 259 bits (663), Expect = 2e-67, Method: Compositional matrix adjust.
Identities = 118/226 (52%), Positives = 173/226 (76%), Gaps = 1/226 (0%)
Query: 3 SAEVLL-LQNVKHSYRQVGKPFPVLENVHLSLKKGEIVALVSPSGTGKSTILHIAGLLEV 61
+AE++L L+ + +Y++ + +L + +L++GE+VALV+PSG GKST+LH AGLLE
Sbjct: 2 AAEIILRLERIGRAYKEADRELIILNDADFTLRRGEMVALVAPSGAGKSTLLHTAGLLER 61
Query: 62 PDQGNVIIANQLCNKLSDDKKSFLRCSKIGFVYQEHRLLMDFSVIENIIFPQIIAGINHK 121
PD G+V++ + C+KLSDD+++ +R + +GFVYQ H LL +FS +EN++ PQ+I G++ K
Sbjct: 62 PDSGDVVLDGRSCSKLSDDERTAVRRNDVGFVYQFHHLLPEFSALENVMLPQMIRGLSRK 121
Query: 122 TAYQRAMDLLSYMDMSQYANRRSSDISGGEQQRVAICRAIANKPLIILADEPTGNLDLKT 181
A +RA LL YM + + A+ R +++SGGEQQRVAI RA+AN PL++LADEPTGNLD T
Sbjct: 122 AAAERAQQLLEYMKIGKRASHRPAELSGGEQQRVAIARAVANAPLVLLADEPTGNLDPTT 181
Query: 182 AQQVFSILKYLVVRSGLAALIATHNHDLASQMDRQITIRDGMIADL 227
+ VF L+ LV +SGLAALIATHNH+LA +MDR++T++DG + DL
Sbjct: 182 SSYVFGALEALVRQSGLAALIATHNHELARRMDRRVTLKDGRVVDL 227