>TIGR00656 asp_kin_monofn asparate kinase, monofunctional class; InterPro: IPR005260 Aspartate kinase catalyzes the first step in the biosynthesis of Lys (via its precursor diaminopimelate), Met, and Thr. In E. coli, a distinct isozyme is inhibited by each of these three amino acid end products . The Met-sensitive (I) and Thr-sensitive (II) forms are bifunctional enzymes fused to homoserine dehydrogenase, which catalyses the next step in the biosynthesis of these amino acids. Inn contrast, the Lys-sensitive form (III) is a monofunctional enzyme; homoserine dehydrogenase is not part of the Lys biosynthetic pathway. This entry represents a subclass of aspartate kinases that are mostly Lys-sensitive and are not fused to homoserine dehydrogenase. The E. coli enzyme is a homodimer, while the Bacillus and Corynebacterium enzymes are alpha 2/beta 2 heterotetramers, where the beta subunit is translated from an in-phase alternative initiator at Met-246 , . The protein slr0657 from Synechocystis PCC6803 is extended by a duplication of the C-terminal region corresponding to the beta chain. Incorporation of a second copy of the C-terminal domain may be quite common in this subgroup of aspartokinases. ; GO: 0004072 aspartate kinase activity, 0009058 biosynthetic process.

Probab=97.98 E-value=3.4e-05 Score=54.90 Aligned_cols=124 Identities=24% Similarity=0.289 Sum_probs=86.9 Q ss_pred CCCHHHHHH-HHCCCCEECCCCCCCCCCCCCCCEEECCHHHHHHHHHHHHHHHHHCCCCEEEEECC-EEEEEEECCCCCC Q ss_conf 410001455-41285011123443222233310121230247766887898886059615897489-1699996678667 Q gi|254780873|r 280 ISASIFSPL-AEAHINIDMIIQNVSEDGQYVDITFTTPSSSLEKALAVLSDNKENIGYDVIQHEDN-LVKISAIGIGMQS 357 (411) Q Consensus 280 ~~a~If~~L-a~~~I~VdmI~qs~s~~~~~~~Isf~i~~~d~~~~~~~L~~~~~~~~~~~I~~~~~-~a~ISvVG~gm~~ 357 (411) T Consensus 265 l~p~~~~~~d~~~~~~~~~~~~~~~~~~----gt~~~~~~d~~~~~~~~~d~~~~-~~~~~~~~~~p~~~~~~~g~~~~~ 339 (480) T TIGR00656 265 LHPRTLEPADKEGGVPIEVRSSFDPEAE----GTLITNEKDFHGSSMEGPDVFEP-LVKGIALSKNPVARLTVPGPGMLG 339 (480) T ss_pred CCCCCCCCCCCCCCCCEEEEECCCCCCC----CCEECCCCCCCCCCCCCCCHHHH-HHHHEEECCCCEEEEEECCCCCCC T ss_conf 0321002011013663588624577767----41430443334566667402332-111013147852588860543235 Q ss_pred CCCHHHHHHHHHHHCCCEEEEEEECC----CEEEEEECHHHHHHHHHHHHHHCCC Q ss_conf 85579999999986798299997078----4899997088999999999987097 Q gi|254780873|r 358 YAGVASAFFLCLAEKGINIKAITTSE----IKISVLIDSAYTELAVRSLHSCYGL 408 (411) Q Consensus 358 ~~Giaakif~aL~~~~InI~~issSe----~~IS~VV~~~d~~~Av~~LH~~F~l 408 (411) T Consensus 340 ~~g~~~~~~~~la~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~l~~~~~~ 394 (480) T TIGR00656 340 KPGFLAELFGALAERGINVDLISQTPSEDKTSISLTVDEEDADEAVRALKDESGA 394 (480) T ss_pred CCHHHHHHHHHHHHCCCEEEEEECCCCCCCCEEEEEEECCCCHHHHHHHHHHHHH T ss_conf 5405889998874157428998506776633058997246606899988765433

HHsearch alignment for GI: 254780873 and conserved domain: TIGR00656