RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780873|ref|YP_003065286.1| aspartate kinase [Candidatus Liberibacter asiaticus str. psy62] (411 letters) >gnl|CDD|30873 COG0527, LysC, Aspartokinases [Amino acid transport and metabolism]. Length = 447 Score = 381 bits (980), Expect = e-106 Identities = 179/457 (39%), Positives = 252/457 (55%), Gaps = 58/457 (12%) Query: 1 MARIVMKFGGTSVANIDCIRSAALHVKREVDRGQEVAMVVSAMSGETDRLAELCRQVTS- 59 M IV KFGGTSVA+ + I A VK + + G +V +VVSAM G TD L L S Sbjct: 1 MRLIVQKFGGTSVADAERILRVADIVKEDSEEGVKVVVVVSAMGGVTDLLVALAEGAESG 60 Query: 60 --------------------------------------------IDNARERDVVISTGEQ 75 + RERD ++S GE+ Sbjct: 61 RDAVAEQRHRDIASELILDPFIAARLAEVIAEFKKVLLGIALLGEVSPRERDELLSLGER 120 Query: 76 VSSGLMVLALQSLGIQAISLQGWQIPIMTDSLHGMARICRVD-EKKIVTHLKKKQVVVIT 134 +S+ L+ AL +LG+ A SL G Q I TDS HG ARI D E++++ L++ +V V+ Sbjct: 121 LSAALLAAALNALGVDARSLDGRQAGIATDSNHGNARILDEDSERRLLRLLEEGKVPVVA 180 Query: 135 GFQGLSHDNSVTTLGRGGSDTSAVAIAAAIKADRCDIYTDVCGIYTTDPRIEPKAHLMKK 194 GFQG++ D TTLGRGGSD SA A+AAA+ AD +I+TDV G+YT DPRI P A L+ + Sbjct: 181 GFQGINEDGETTTLGRGGSDYSAAALAAALGADEVEIWTDVDGVYTADPRIVPDARLLPE 240 Query: 195 ISFEEMLEMSSLGAKVMQVRSVELAMLYKMCLFVRSSFEDHGQQEQLGTLICSGEDIMEK 254 IS+EE LE++ LGAKV+ R+VE AM + L ++++F + GTLI E ++ Sbjct: 241 ISYEEALELAYLGAKVLHPRAVEPAMRSGIPLRIKNTFNP----DAPGTLIT-AETESDE 295 Query: 255 KVITGIAYTKDEAQISLRRLRDHP--GISASIFSPLAEAHINIDMIIQNVSEDGQYVDIT 312 V+ GIA + A I++ + G +A +F LAEA IN+D+I Q++SE I+ Sbjct: 296 PVVKGIALDDNVALITVSGPGMNGMVGFAARVFGILAEAGINVDLITQSISEVS----IS 351 Query: 313 FTTPSSSLEKALAVLSDNKENIGYDVIQHEDNLVKISAIGIGMQSYAGVASAFFLCLAEK 372 FT P S +AL L + K ++ E+ L +S +G GM+S GVA+ F LAE+ Sbjct: 352 FTVPESDAPRALRALLEEKLE-LLAEVEVEEGLALVSIVGAGMRSNPGVAARIFQALAEE 410 Query: 373 GINIKAITTSEIKISVLIDSAYTELAVRSLHSCYGLD 409 INI I++SEI IS ++D E AVR+LH + L Sbjct: 411 NINIIMISSSEISISFVVDEKDAEKAVRALHEAFFLG 447 >gnl|CDD|58612 cd04246, AAK_AK-DapG-like, AAK_AK-DapG-like: Amino Acid Kinase Superfamily (AAK), AK-DapG-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional enzymes found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species, as well as, the catalytic AK domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related isoenzymes. In Bacillus subtilis, the regulation of the diaminopimelate-lysine biosynthetic pathway involves dual control by diaminopimelate and lysine, effected through separate diaminopimelate- and lysine-sensitive aspartokinase isoenzymes. The role of the AKI isoenzyme is most likely to provide a constant level of aspartyl-beta-phosphate for the biosynthesis of diaminopimelate for peptidoglycan synthesis and dipicolinate during sporulation. The B. subtilis 168 AKII is induced by methionine, and repressed and inhibited by lysine. In Corynebacterium glutamicum and other various Gram-positive bacteria, the DAP-lysine pathway is feedback regulated by the concerted action of lysine and threonine. Also included in this CD are the aspartokinases of the extreme thermophile, Thermus thermophilus HB27, the Gram-negative obligate methylotroph, Methylophilus methylotrophus AS1, and those single aspartokinase isoenzyme types found in Pseudomonas, C. glutamicum, and Amycolatopsis lactamdurans. The B. subtilis AKI is tetrameric consisting of two alpha and two beta subunits; the alpha (43 kD) and beta (17 kD) subunit formed by two in-phase overlapping genes. The alpha subunit contains the AK catalytic domain and two ACT domains. The beta subunit contains two ACT domains. The B. subtilis 168 AKII aspartokinase is also described as tetrameric consisting of two alpha and two beta subunits. Some archeal aspartokinases in this group lack recognizable ACT domains.. Length = 239 Score = 327 bits (840), Expect = 4e-90 Identities = 136/244 (55%), Positives = 179/244 (73%), Gaps = 5/244 (2%) Query: 3 RIVMKFGGTSVANIDCIRSAALHVKREVDRGQEVAMVVSAMSGETDRLAELCRQVTSIDN 62 IV KFGGTSVA+I+ I+ A +K+ V +G +V +VVSAM G TD L L ++V+ + Sbjct: 1 IIVQKFGGTSVADIERIKRVAERIKKAVKKGYQVVVVVSAMGGTTDELIGLAKEVSPRPS 60 Query: 63 ARERDVVISTGEQVSSGLMVLALQSLGIQAISLQGWQIPIMTDSLHGMARICRVDEKKIV 122 RE D+++STGEQ+S+ L+ +AL LGI+AISL GWQ I+TD HG ARI +D K+I+ Sbjct: 61 PRELDMLLSTGEQISAALLAMALNRLGIKAISLTGWQAGILTDDHHGNARIIDIDPKRIL 120 Query: 123 THLKKKQVVVITGFQGLSHDNSVTTLGRGGSDTSAVAIAAAIKADRCDIYTDVCGIYTTD 182 L++ VVV+ GFQG++ D +TTLGRGGSDT+AVA+AAA+KADRC+IYTDV G+YT D Sbjct: 121 EALEEGDVVVVAGFQGVNEDGEITTLGRGGSDTTAVALAAALKADRCEIYTDVDGVYTAD 180 Query: 183 PRIEPKAHLMKKISFEEMLEMSSLGAKVMQVRSVELAMLYKMCLFVRSSFEDHGQQEQLG 242 PRI PKA + IS++EMLEM+SLGAKV+ RSVELA Y + L VRSSF ++ G Sbjct: 181 PRIVPKARKLDVISYDEMLEMASLGAKVLHPRSVELAKKYNVPLRVRSSFSEN-----PG 235 Query: 243 TLIC 246 TLI Sbjct: 236 TLIT 239 >gnl|CDD|58627 cd04261, AAK_AKii-LysC-BS, AAK_AKii-LysC-BS: Amino Acid Kinase Superfamily (AAK), AKii; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, and the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related sequences. In B. subtilis 168, the regulation of the diaminopimelate (Dap)-lysine biosynthetic pathway involves dual control by Dap and lysine, effected through separate Dap- and lysine-sensitive aspartokinase isoenzymes. The B. subtilis 168 AKII is induced by methionine, and repressed and inhibited by lysine. Although Corynebacterium glutamicum is known to contain a single aspartokinase isoenzyme type, both the succinylase and dehydrogenase variant pathways of DAP-lysine synthesis operate simultaneously in this organism. In this organism and other various Gram-positive bacteria, the DAP-lysine pathway is feedback regulated by the concerted action of lysine and theronine. Also included in this CD are the aspartokinases of the extreme thermophile, Thermus thermophilus HB27, the Gram-negative obligate methylotroph, Methylophilus methylotrophus AS1, and those single aspartokinases found in Pseudomons, C. glutamicum, and Amycolatopsis lactamdurans. B. subtilis 168 AKII, and the C. glutamicum, Streptomyces clavuligerus and A. lactamdurans aspartokinases are described as tetramers consisting of two alpha and two beta subunits; the alpha (44 kD) and beta (18 kD) subunits formed by two in-phase overlapping polypeptides.. Length = 239 Score = 326 bits (838), Expect = 5e-90 Identities = 135/244 (55%), Positives = 174/244 (71%), Gaps = 5/244 (2%) Query: 3 RIVMKFGGTSVANIDCIRSAALHVKREVDRGQEVAMVVSAMSGETDRLAELCRQVTSIDN 62 IV KFGGTSVA+I+ I+ A +K+ +G +V +VVSAM G TD L EL ++++ Sbjct: 1 LIVQKFGGTSVASIERIKRVAERIKKRKKKGNQVVVVVSAMGGTTDELIELAKEISPRPP 60 Query: 63 ARERDVVISTGEQVSSGLMVLALQSLGIQAISLQGWQIPIMTDSLHGMARICRVDEKKIV 122 ARE DV++STGEQVS L+ +AL LGI+AISL GWQ I+TD HG ARI +D +I Sbjct: 61 ARELDVLLSTGEQVSIALLAMALNRLGIKAISLTGWQAGILTDGHHGKARIIDIDPDRIR 120 Query: 123 THLKKKQVVVITGFQGLSHDNSVTTLGRGGSDTSAVAIAAAIKADRCDIYTDVCGIYTTD 182 L++ VV++ GFQG++ D +TTLGRGGSDTSAVA+AAA+ ADRC+IYTDV G+YT D Sbjct: 121 ELLEEGDVVIVAGFQGINEDGDITTLGRGGSDTSAVALAAALGADRCEIYTDVDGVYTAD 180 Query: 183 PRIEPKAHLMKKISFEEMLEMSSLGAKVMQVRSVELAMLYKMCLFVRSSFEDHGQQEQLG 242 PRI PKA + +IS++EMLEM+SLGAKV+ RSVELA Y + L V SSF + G Sbjct: 181 PRIVPKARKLDEISYDEMLEMASLGAKVLHPRSVELAKKYGVPLRVLSSFSEEP-----G 235 Query: 243 TLIC 246 TLI Sbjct: 236 TLIT 239 >gnl|CDD|58600 cd04234, AAK_AK, AAK_AK: Amino Acid Kinase Superfamily (AAK), Aspartokinase (AK); this CD includes the N-terminal catalytic domain of aspartokinase (4-L-aspartate-4-phosphotransferase;). AK is the first enzyme in the biosynthetic pathway of the aspartate family of amino acids (lysine, threonine, methionine, and isoleucine) and the bacterial cell wall component, meso-diaminopimelate. It also catalyzes the conversion of aspartate and ATP to aspartylphosphate and ADP. One mechanism for the regulation of this pathway is by the production of several isoenzymes of aspartokinase with different repressors and allosteric inhibitors. Pairs of ACT domains are proposed to specifically bind amino acids leading to allosteric regulation of the enzyme. In Escherichia coli, three different aspartokinase isoenzymes are regulated specifically by lysine, methionine, and threonine. AK-HSDHI (ThrA) and AK-HSDHII (MetL) are bifunctional enzymes that consist of an N-terminal AK and a C-terminal homoserine dehydrogenase (HSDH). ThrA and MetL are involved in threonine and methionine biosynthesis, respectively. The third isoenzyme, AKIII (LysC), is monofunctional and is involved in lysine synthesis. The three Bacillus subtilis isoenzymes, AKI (DapG), AKII (LysC), and AKIII (YclM), are feedback-inhibited by meso-diaminopimelate, lysine, and lysine plus threonine, respectively. The E. coli lysine-sensitive AK is described as a homodimer, whereas, the B. subtilis lysine-sensitive AK is described as a heterodimeric complex of alpha- and beta- subunits that are formed from two in-frame overlapping genes. A single AK enzyme type has been described in Pseudomonas, Amycolatopsis, and Corynebacterium. The fungal aspartate pathway is regulated at the AK step, with L-Thr being an allosteric inhibitor of the Saccharomyces cerevisiae AK (Hom3). At least two distinct AK isoenzymes can occur in higher plants, one is a monofunctional lysine-sensitive isoenzyme, which is involved in the overall regulation of the pathway and can be synergistically inhibited by S-adenosylmethionine. The other isoenzyme is a bifunctional, threonine-sensitive AK-HSDH protein. Also included in this CD is the catalytic domain of the Methylomicrobium alcaliphilum ectoine AK, the first enzyme of the ectoine biosynthetic pathway, found in this bacterium, and several other halophilic/halotolerant bacteria.. Length = 227 Score = 248 bits (635), Expect = 2e-66 Identities = 105/245 (42%), Positives = 145/245 (59%), Gaps = 19/245 (7%) Query: 3 RIVMKFGGTSVANIDCIRSAALHVKREVDRGQEVAMVVSAMSGETDRLAELCRQVTSIDN 62 +V KFGGTSVA+ + I+ A +K G V +VVSAM G TD L EL Sbjct: 1 MVVQKFGGTSVASAERIKRVADIIKAYEK-GNRVVVVVSAMGGVTDLLIELAL------- 52 Query: 63 ARERDVVISTGEQVSSGLMVLALQSLGIQAISLQGWQIPIMTDSLHGMARICRVDEKKIV 122 ++S GE++S+ L+ AL+ GI+A SL Q I TD HG ARI + +++ Sbjct: 53 ------LLSFGERLSARLLAAALRDRGIKARSLDARQAGITTDDNHGAARIIEISYERLK 106 Query: 123 THLKKKQ-VVVITGFQGLSHDNSVTTLGRGGSDTSAVAIAAAIKADRCDIYTDVCGIYTT 181 L + V V+TGF G + D +TTLGRGGSD SA A+AAA+ AD +I+TDV GIYT Sbjct: 107 ELLAEIGKVPVVTGFIGRNEDGEITTLGRGGSDYSAAALAAALGADEVEIWTDVDGIYTA 166 Query: 182 DPRIEPKAHLMKKISFEEMLEMSSLGAKVMQVRSVELAMLYKMCLFVRSSFEDHGQQEQL 241 DPRI P+A L+ +IS++E LE++ GAKV+ R+VE A + + V+++F Sbjct: 167 DPRIVPEARLIPEISYDEALELAYFGAKVLHPRAVEPARKANIPIRVKNTFNPEAP---- 222 Query: 242 GTLIC 246 GTLI Sbjct: 223 GTLIT 227 >gnl|CDD|58626 cd04260, AAK_AKi-DapG-BS, AAK_AKi-DapG-BS: Amino Acid Kinase Superfamily (AAK), AKi-DapG; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional class enzyme found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species. In Bacillus subtilis, the regulation of the diaminopimelate-lysine biosynthetic pathway involves dual control by diaminopimelate and lysine, effected through separate diaminopimelate- and lysine-sensitive aspartokinase isoenzymes. AKI activity is invariant during the exponential and stationary phases of growth and is not altered by addition of amino acids to the growth medium. The role of this isoenzyme is most likely to provide a constant level of aspartyl-beta-phosphate for the biosynthesis of diaminopimelate for peptidoglycan synthesis and dipicolinate during sporulation. The B. subtilis AKI is tetrameric consisting of two alpha and two beta subunits; the alpha (43 kD) and beta (17 kD) subunit formed by two in-phase overlapping genes. The alpha subunit contains the AK catalytic domain and two ACT domains. The beta subunit contains two ACT domains.. Length = 244 Score = 214 bits (546), Expect = 3e-56 Identities = 105/247 (42%), Positives = 158/247 (63%), Gaps = 10/247 (4%) Query: 4 IVMKFGGTSVANIDCIRSAALHVKREVDRGQEVAMVVSAM--SGE---TDRLAELCRQVT 58 IV KFGGTSV+ + A VK+ VD G + +VVSAM G+ TD L L Sbjct: 2 IVQKFGGTSVSTKERREQVAKKVKQAVDEGYKPVVVVSAMGRKGDPYATDTLINLVYAEN 61 Query: 59 SIDNARERDVVISTGEQVSSGLMVLALQSLGIQAISLQGWQIPIMTDSLHGMARICRVDE 118 S + RE D+++S GE +S+ ++ L++ G++A++L G Q I+TD + A+I +V+ Sbjct: 62 SDISPRELDLLMSCGEIISAVVLTSTLRAQGLKAVALTGAQAGILTDDNYSNAKIIKVNP 121 Query: 119 KKIVTHLKKKQVVVITGFQGLSHDNSVTTLGRGGSDTSAVAIAAAIKADRCDIYTDVCGI 178 KKI++ LK+ VVV+ GFQG++ D VTTLGRGGSDT+A A+ AA+ A+ +IYTDV GI Sbjct: 122 KKILSALKEGDVVVVAGFQGVTEDGEVTTLGRGGSDTTAAALGAALNAEYVEIYTDVDGI 181 Query: 179 YTTDPRIEPKAHLMKKISFEEMLEMSSLGAKVMQVRSVELAMLYKMCLFVRSSFEDHGQQ 238 T DPR+ P A ++ +S+ E+ +M+ GAKV+ R+VE+AM + + +RS+ ++ Sbjct: 182 MTADPRVVPNARILDVVSYNEVFQMAHQGAKVIHPRAVEIAMQANIPIRIRSTMSEN--- 238 Query: 239 EQLGTLI 245 GTLI Sbjct: 239 --PGTLI 243 >gnl|CDD|58609 cd04243, AAK_AK-HSDH-like, AAK_AK-HSDH-like: Amino Acid Kinase Superfamily (AAK), AK-HSDH-like; this family includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK- homoserine dehydrogenase (HSDH). These aspartokinases are found in such bacteria as E. coli (AKI-HSDHI, ThrA and AKII-HSDHII, MetL) and in higher plants (Z. mays AK-HSDH). AK and HSDH are the first and third enzymes in the biosynthetic pathway of the aspartate family of amino acids. AK catalyzes the phosphorylation of Asp to P-aspartyl phosphate. HSDH catalyzes the NADPH-dependent conversion of Asp 3-semialdehyde to homoserine. ThrA and MetL are involved in threonine and methionine biosynthesis, respectively. In E. coli, ThrA is subject to allosteric regulation by the end product L-threonine and the native enzyme is reported to be tetrameric. As with bacteria, plant AK and HSDH are feedback inhibited by pathway end products. Maize AK-HSDH is a Thr-sensitive 180-kD enzyme. Arabidopsis AK-HSDH is an alanine-activated, threonine-sensitive enzyme whose ACT domains, located C-terminal to the AK catalytic domain, were shown to be involved in allosteric activation. Also included in this CD is the catalytic domain of the aspartokinase (AK) of the lysine-sensitive aspartokinase isoenzyme AKIII, a monofunctional class enzyme (LysC) found in some bacteria such as E. coli. In E. coli, LysC is reported to be a homodimer of 50 kD subunits. Also included in this CD is the catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK - DAP decarboxylase (DapDC) found in some bacteria. DapDC, which is the lysA gene product, catalyzes the decarboxylation of DAP to lysine.. Length = 293 Score = 162 bits (412), Expect = 1e-40 Identities = 90/297 (30%), Positives = 139/297 (46%), Gaps = 59/297 (19%) Query: 4 IVMKFGGTSVANIDCIRSAALHVKREVDRGQEV-------------AMVVSAMSGET--- 47 V+KFGGTSVA+ + IR A +K V A+ A SG+ Sbjct: 2 KVLKFGGTSVASAERIRRVADIIKSRASSPVLVVVSALGGVTNRLVALAELAASGDDAQA 61 Query: 48 ----------------------------------DRLAELCRQVTSIDNA--RERDVVIS 71 +RL +L + + + R V+S Sbjct: 62 IVLQEIRERHLDLIKELLSGESAAELLAALDSLLERLKDLLEGIRLLGELSDKTRAEVLS 121 Query: 72 TGEQVSSGLMVLALQSLGIQAISLQGWQIPIMTDSLHGMARICRVDEKKIVTHL--KKKQ 129 GE +SS LM LQ G+ A L ++ ++TD A + K+ + L + + Sbjct: 122 FGELLSSRLMSAYLQEQGLPAAWLDAREL-LLTDDGFLNAVVDLKLSKERLAQLLAEHGK 180 Query: 130 VVVITGFQGLSHDNSVTTLGRGGSDTSAVAIAAAIKADRCDIYTDVCGIYTTDPRIEPKA 189 VVV GF + D TTLGRGGSD SA +AA + A+ +I+TDV G+YT DPR P A Sbjct: 181 VVVTQGFIASNEDGETTTLGRGGSDYSAALLAALLDAEEVEIWTDVDGVYTADPRKVPDA 240 Query: 190 HLMKKISFEEMLEMSSLGAKVMQVRSVELAMLYKMCLFVRSSFEDHGQQEQLGTLIC 246 L+K++S++E +E++ GAKV+ R+++ A+ + +F++++F E GTLI Sbjct: 241 RLLKELSYDEAMELAYFGAKVLHPRTIQPAIRKNIPIFIKNTFN----PEAPGTLIS 293 >gnl|CDD|58610 cd04244, AAK_AK-LysC-like, AAK_AK-LysC-like: Amino Acid Kinase Superfamily (AAK), AK-LysC-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive AK isoenzyme found in higher plants. The lysine-sensitive AK isoenzyme is a monofunctional protein. It is involved in the overall regulation of the aspartate pathway and can be synergistically inhibited by S-adenosylmethionine. Also included in this CD is an uncharacterized LysC-like AK found in Euryarchaeota and some bacteria. AK catalyzes the conversion of aspartate and ATP to aspartylphosphate and ADP.. Length = 298 Score = 158 bits (401), Expect = 3e-39 Identities = 101/302 (33%), Positives = 144/302 (47%), Gaps = 64/302 (21%) Query: 3 RIVMKFGGTSVANIDCIRSAALHVKREVDRGQEVAMVVSAMSGETDRLAELCRQVTSIDN 62 R+VMKFGGTSV + + IR A V G EV +VVSAM G TDRL S Sbjct: 1 RLVMKFGGTSVGSAERIRHVADLVGTY-AEGHEVVVVVSAMGGVTDRLLLAAEAAVSGRI 59 Query: 63 ARERDVV------------------------------ISTGEQVSSGLMVL--------- 83 A +D + + E++ G+ L Sbjct: 60 AGVKDFIEILRLRHIKAAKEAISDEEIAEVESIIDSLLEELEKLLYGIAYLGELTPRSRD 119 Query: 84 ----------------ALQSLGIQAISLQGWQIPIMTDSLHGMARICRVDEKKIVTHL-- 125 AL+SLGI+A +L G + I+TD G AR +++ L Sbjct: 120 YIVSFGERLSAPIFSAALRSLGIKARALDGGEAGIITDDNFGNARPLPATYERVRKRLLP 179 Query: 126 --KKKQVVVITGFQGLSHDNSVTTLGRGGSDTSAVAIAAAIKADRCDIYTDVCGIYTTDP 183 + ++ V+TGF G + D ++TTLGRGGSD SA I AA+ AD I+ DV G+ T DP Sbjct: 180 MLEDGKIPVVTGFIGATEDGAITTLGRGGSDYSATIIGAALDADEIWIWKDVDGVMTADP 239 Query: 184 RIEPKAHLMKKISFEEMLEMSSLGAKVMQVRSVELAMLYKMCLFVRSSFEDHGQQEQLGT 243 RI P+A + ++S+ E +E++ GAKV+ R+VE AM + + V+++F E GT Sbjct: 240 RIVPEARTIPRLSYAEAMELAYFGAKVLHPRTVEPAMEKGIPVRVKNTFN----PEAPGT 295 Query: 244 LI 245 LI Sbjct: 296 LI 297 >gnl|CDD|58599 cd02115, AAK, Amino Acid Kinases (AAK) superfamily, catalytic domain; present in such enzymes like N-acetylglutamate kinase (NAGK), carbamate kinase (CK), aspartokinase (AK), glutamate-5-kinase (G5K) and UMP kinase (UMPK). The AAK superfamily includes kinases that phosphorylate a variety of amino acid substrates. These kinases catalyze the formation of phosphoric anhydrides, generally with a carboxylate, and use ATP as the source of the phosphoryl group; are involved in amino acid biosynthesis. Some of these kinases control the process via allosteric feed-back inhibition.. Length = 248 Score = 154 bits (390), Expect = 4e-38 Identities = 72/234 (30%), Positives = 126/234 (53%), Gaps = 5/234 (2%) Query: 5 VMKFGGTSVANIDCIRSAALHVKREVDRGQEVAMVVSAMSGETDRLAELCRQVTSID--- 61 V+KFGG+SV++ + +R+ A + + G V +V A TD L + Sbjct: 1 VIKFGGSSVSSEERLRNLARILVKLASEGGRVVVVHGAGPQITDELLAHGELLGYARGLR 60 Query: 62 -NARERDVVISTGEQVSSGLMVLALQSLGIQAISLQGWQIPIMTDSLHGMARICRVDEKK 120 RE D + + GE +S+ L+ AL+ GI+A+ L Q + + + +I +V + Sbjct: 61 ITDRETDALAAMGEGMSNLLIAAALEQHGIKAVPLDLTQAGFASPNQGHVGKITKVSTDR 120 Query: 121 IVTHLKKKQVVVITGFQGLSHDNSVTTLGRGGSDTSAVAIAAAIKADRCDIYTDVCGIYT 180 + + L+ + +++GF G TLGRGGSD++A +AAA+KADR I TDV G+YT Sbjct: 121 LKSLLENGILPILSGFGGTDEK-ETGTLGRGGSDSTAALLAAALKADRLVILTDVDGVYT 179 Query: 181 TDPRIEPKAHLMKKISFEEMLEMSSLGAKVMQVRSVELAMLYKMCLFVRSSFED 234 DPR P A L+ ++++EE E++ GA V++ ++ + A + + + ++ Sbjct: 180 ADPRKVPDAKLLSELTYEEAAELAYAGAMVLKPKAADPAARAGIPVRIANTENP 233 >gnl|CDD|58624 cd04258, AAK_AKiii-LysC-EC, AAK_AKiii-LysC-EC: Amino Acid Kinase Superfamily (AAK), AKiii-LysC-EC: this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKIII. AKIII is a monofunctional class enzyme (LysC) found in some bacteria such as E. coli. Aspartokinase is the first enzyme in the aspartate metabolic pathway and catalyzes the conversion of aspartate and ATP to aspartylphosphate and ADP. In E. coli, LysC is reported to be a homodimer of 50 kD subunits.. Length = 292 Score = 153 bits (387), Expect = 1e-37 Identities = 95/299 (31%), Positives = 129/299 (43%), Gaps = 64/299 (21%) Query: 4 IVMKFGGTSVANIDCIRSAALHVKREVDRGQEVAMVVSAMSGETDRLAELC--------- 54 +V KFGGTSVA+ + A VK + +VVSA +G T+ L L Sbjct: 2 VVAKFGGTSVADYAAMLRCAAIVKSDASVR---LVVVSASAGVTNLLVALADAAESGEEI 58 Query: 55 --------------------RQVTSIDNARER-----------------------DVVIS 71 + E D ++S Sbjct: 59 ESIPQLHEIRAIHFAILNRLGAPEELRAKLEELLEELTQLAEGAALLGELSPASRDELLS 118 Query: 72 TGEQVSSGLMVLALQSLGIQAISLQGWQIPIMTDSLHGMAR----ICRVDEKKIVTHLKK 127 GE++SS L AL+ G+ A + + TDS G A K++ L Sbjct: 119 FGERMSSLLFSEALREQGVPAEWFDVRTV-LRTDSRFGRAAPDLNALAELAAKLLKPLLA 177 Query: 128 KQVVVITGFQGLSHDNSVTTLGRGGSDTSAVAIAAAIKADRCDIYTDVCGIYTTDPRIEP 187 VVV GF G + TTLGRGGSD SA +A A+ A+ I+TDV GIYTTDPRI P Sbjct: 178 GTVVVTQGFIGSTEKGRTTTLGRGGSDYSAALLAEALHAEELQIWTDVAGIYTTDPRICP 237 Query: 188 KAHLMKKISFEEMLEMSSLGAKVMQVRSVELAMLYKMCLFVRSSFEDHGQQEQLGTLIC 246 A +K+ISF E EM++ GAKV+ ++ A+ + +FV SS + E GTLI Sbjct: 238 AARAIKEISFAEAAEMATFGAKVLHPATLLPAIRKNIPVFVGSSKD----PEAGGTLIT 292 >gnl|CDD|58623 cd04257, AAK_AK-HSDH, AAK_AK-HSDH: Amino Acid Kinase Superfamily (AAK), AK-HSDH; this CD includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK - homoserine dehydrogenase (HSDH). These aspartokinases are found in bacteria (E. coli AKI-HSDHI, ThrA and E. coli AKII-HSDHII, MetL) and higher plants (Z. mays AK-HSDH). AK and HSDH are the first and third enzymes in the biosynthetic pathway of the aspartate family of amino acids. AK catalyzes the phosphorylation of Asp to P-aspartyl phosphate. HSDH catalyzes the NADPH-dependent conversion of Asp 3-semialdehyde to homoserine. ThrA and MetL are involved in threonine and methionine biosynthesis, respectively. In E. coli, ThrA is subject to allosteric regulation by the end product L-threonine and the native enzyme is reported to be tetrameric. As with bacteria, plant AK and HSDH are feedback inhibited by pathway end products. Maize AK-HSDH is a Thr-sensitive 180-kD enzyme. Arabidopsis AK-HSDH is an alanine-activated, threonine-sensitive enzyme whose ACT domains, located C-terminal to the AK catalytic domain, were shown to be involved in allosteric activation.. Length = 294 Score = 143 bits (362), Expect = 8e-35 Identities = 80/297 (26%), Positives = 134/297 (45%), Gaps = 60/297 (20%) Query: 5 VMKFGGTSVANIDCIRSAALHVKREVDRGQEVAMVVSAMSGETDRLAELCRQVTSIDNAR 64 V+KFGGTS+AN + IR A + + Q VA+VVSA TD L EL +S D+A Sbjct: 3 VLKFGGTSLANAERIRRVADIILNAAKQEQ-VAVVVSAPGKVTDLLLELAELASSGDDAY 61 Query: 65 ER--DVVISTGEQVSSGLMVLALQSLGIQAIS---------LQG---------------- 97 E + S + + L+ + + A+ L+G Sbjct: 62 EDILQELESKHLDLITELLSGDAAAELLSALGNDLEELKDLLEGIYLLGELPDSIRAKVL 121 Query: 98 -----WQIPIMTDSLHGMA-RICRVDEKKIVT----HLK------------------KKQ 129 +++ L+ +D ++++ +L + Sbjct: 122 SFGERLSARLLSALLNQQGLDAAWIDARELIVTDGGYLNAVVDIELSKERIKAWFSSNGK 181 Query: 130 VVVITGFQGLSHDNSVTTLGRGGSDTSAVAIAAAIKADRCDIYTDVCGIYTTDPRIEPKA 189 V+V+TGF + TTLGR GSD SA +AA + AD+ +I+TDV G+Y+ DPR A Sbjct: 182 VIVVTGFIASNPQGETTTLGRNGSDYSAAILAALLDADQVEIWTDVDGVYSADPRKVKDA 241 Query: 190 HLMKKISFEEMLEMSSLGAKVMQVRSVELAMLYKMCLFVRSSFEDHGQQEQLGTLIC 246 L+ +S++E +E+S GAKV+ ++++ + + ++++F E GTLI Sbjct: 242 RLLPSLSYQEAMELSYFGAKVLHPKTIQPVAKKNIPILIKNTF----NPEAPGTLIS 294 >gnl|CDD|144336 pfam00696, AA_kinase, Amino acid kinase family. This family includes kinases that phosphorylate a variety of amino acid substrates, as well as uridylate kinase and carbamate kinase. This family includes: Aspartokinase EC:2.7.2.4. Acetylglutamate kinase EC:2.7.2.8. Glutamate 5-kinase EC:2.7.2.11. Uridylate kinase EC:2.7.4.-. Carbamate kinase EC:2.7.2.2. Length = 230 Score = 142 bits (360), Expect = 1e-34 Identities = 76/236 (32%), Positives = 116/236 (49%), Gaps = 15/236 (6%) Query: 3 RIVMKFGGTSVANIDCIRSAALHVKREVDRGQEVAMVVSAMSGETDRLAELCRQVTSIDN 62 RIV+K GG+S+ + D I+ A + + G +V VVS G TD+L I Sbjct: 2 RIVIKLGGSSLTDEDAIKRIAEEIALLSELGIKVV-VVSGGGGFTDKLLAAYGIAEKIGL 60 Query: 63 ARERDVVISTGEQVSSGLM---VLALQSLGIQAISLQGWQIPIMTDSLHGMARICRVDEK 119 E +GL+ V A + LG +A++L ++D G R+ D + Sbjct: 61 RVTAGATGLIIEAALAGLLDIVVSAGERLGARAVALL------LSDGGIGAVRLDANDTE 114 Query: 120 KIVTHLKKKQVVVITGFQGLSHDNSVTTLGRGGSDTSAVAIAAAIKADRCDIYTDVCGIY 179 I L++ V VITGF G + TTLGRG SDT A +A A+ AD+ I TDV G+Y Sbjct: 115 AIKELLEEGVVPVITGFGGENDTGETTTLGRGSSDTLAALLAEALGADKLIILTDVDGVY 174 Query: 180 TTDPRIEPKAHLMKKISFEEMLEMS-----SLGAKVMQVRSVELAMLYKMCLFVRS 230 T DPR P A L+ ++S++E E+ + G KV +++ A + + + + Sbjct: 175 TADPRKVPDAKLIPELSYDEAEELLAAGDGTGGMKVKDPAALKAARRGGIPVVIVN 230 >gnl|CDD|35677 KOG0456, KOG0456, KOG0456, Aspartate kinase [Amino acid transport and metabolism]. Length = 559 Score = 138 bits (349), Expect = 3e-33 Identities = 122/474 (25%), Positives = 200/474 (42%), Gaps = 95/474 (20%) Query: 4 IVMKFGGTSVANIDCIRSAALHVKREVDRGQEVAMVVSAMSGETDRLAELCRQVTS---- 59 VMKFGG+SV + + R + V + +V+SAMS T+ L + Sbjct: 81 CVMKFGGSSVGSAE--RMIEVAVLILYFPDERPVVVLSAMSKTTNALLTAGEKAVCCGVA 138 Query: 60 ---------------IDNARE--------------------------------RDVVIST 72 I A E RD ++S Sbjct: 139 NVESIEELSIIKELHIRTAHELIVDPAVIAKLLEGLEQLLKGIAMMKELTLRTRDYLVSF 198 Query: 73 GEQVSSGLMVLALQSLGIQAISLQGWQIPIMTDSLHGMARI-----CRVDEKKIVTHLKK 127 GE +S+ L +G +A ++I +T I V + K+ Sbjct: 199 GECLSTRFFAAYLNDIGHKARQYDAFEIGFITTDDFTNDDILEATYPAVSKLLSGDWAKE 258 Query: 128 KQVVVITGFQG-LSHDNSVTTLGRGGSDTSAVAIAAAIKADRCDIYTDVCGIYTTDPRIE 186 V V+TGF G ++TTLGRGGSD +A I A+ D ++ DV G+ T DPRI Sbjct: 259 NAVPVVTGFLGKGWPTGALTTLGRGGSDLTATTIGKALGLDEIQVWKDVDGVLTCDPRIY 318 Query: 187 PKAHLMKKISFEEMLEMSSLGAKVMQVRSVELAMLYKMCLFVRSSFEDHGQQEQLGTLIC 246 P A L+ ++F+E E++ GA+V+ S+ A ++ + V++S+ GT+I Sbjct: 319 PGARLVPYLTFDEAAELAYFGAQVLHPFSMRPAREGRIPVRVKNSYNPTAP----GTVIT 374 Query: 247 SGEDIMEKKVITGIAYTKDEAQI---SLRRLRDHPGISASIFSPLAEAHINIDMIIQNVS 303 D M K +T I ++ + S R L H G A +F+ + I++D++ S Sbjct: 375 PDRD-MSKAGLTSIVLKRNVTMLDIASTRMLGQH-GFLAKVFTIFEKLGISVDVV--ATS 430 Query: 304 EDGQYVDITFTTPSSSLEKALAVLSDNKENIGYDVIQHEDNLVKISAIGI---------- 353 E V I+ T S L D++E I ++ Q + L KI+ + + Sbjct: 431 E----VSISLTLDPSKL--------DSRELIQGELDQAVEELEKIAVVDLLKGRSIISLI 478 Query: 354 -GMQSYAGVASAFFLCLAEKGINIKAIT--TSEIKISVLIDSAYTELAVRSLHS 404 +Q+ +G+ F LAE GIN++ I+ S++ IS +++ E V++LH Sbjct: 479 GNVQNSSGILERMFCVLAENGINVQMISQGASKVNISCIVNEKEAEKCVQALHK 532 >gnl|CDD|58625 cd04259, AAK_AK-DapDC, AAK_AK-DapDC: Amino Acid Kinase Superfamily (AAK), AK-DapDC; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the bifunctional enzyme AK - DAP decarboxylase (DapDC) found in some bacteria. Aspartokinase is the first enzyme in the aspartate metabolic pathway, catalyzes the conversion of aspartate and ATP to aspartylphosphate and ADP. DapDC, which is the lysA gene product, catalyzes the decarboxylation of DAP to lysine.. Length = 295 Score = 111 bits (278), Expect = 4e-25 Identities = 79/297 (26%), Positives = 136/297 (45%), Gaps = 59/297 (19%) Query: 4 IVMKFGGTSVANIDCIRSAALHVKREVDRGQEVAMVVSAMSGETDRLAELCRQVTSID-- 61 +V+KFGGTSV++ + A ++ ++ G + +V SA+SG +++L L Q + Sbjct: 2 VVLKFGGTSVSSRARWDTIAKLAQKHLNTGGQPLIVCSALSGISNKLEALIDQALLDEHH 61 Query: 62 ------NARERDV---------------------------------------VISTGEQV 76 +R ++ V++ GE + Sbjct: 62 SLFNAIQSRHLNLAEQLEVDADALLANDLAQLQRWLTGISLLKQASPRTRAEVLALGELM 121 Query: 77 SSGLMVLALQSLGIQAISLQGWQIPIMTDSLHG------MARICR-VDEKKIVTHLKKKQ 129 S+ L L++ G++ L ++ T +L G AR + + L Sbjct: 122 STRLGAAYLEAQGLKVKWLDARELLTATPTLGGETMNYLSARCESEYADALLQKRLADGA 181 Query: 130 VVVIT-GFQGLSHDNSVTTLGRGGSDTSAVAIAAAIKADRCDIYTDVCGIYTTDPRIEPK 188 ++IT GF + LGRGGSDTSA AA ++A RC+I+TDV G++T +P P Sbjct: 182 QLIITQGFIARNAHGETVLLGRGGSDTSAAYFAAKLQAARCEIWTDVPGLFTANPHEVPH 241 Query: 189 AHLMKKISFEEMLEMSSLGAKVMQVRSVELAMLYKMCLFVRSSFEDHGQQEQLGTLI 245 A L+K++ ++E E++++GAKV+ R + A + + VRS+ + E GTLI Sbjct: 242 ARLLKRLDYDEAQEIATMGAKVLHPRCIPPARRANIPMVVRSTE----RPELSGTLI 294 >gnl|CDD|153185 cd04913, ACT_AKii-LysC-BS-like_1, ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related proteins. This CD includes the N-terminal of the two ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis (BS) strain 168, and the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related sequences. In B. subtilis 168, the regulation of the diaminopimelate (Dap)-lysine biosynthetic pathway involves dual control by Dap and lysine, effected through separate Dap- and lysine-sensitive aspartokinase isoenzymes. The B. subtilis 168 AKII is induced by methionine and repressed and inhibited by lysine. Although Corynebacterium glutamicum is known to contain a single aspartokinase, both the succinylase and dehydrogenase variant pathways of DAP-lysine synthesis operate simultaneously in this organism. In corynebacteria and other various Gram-positive bacteria, the DAP-lysine pathway is feedback regulated by the concerted action of lysine and threonine. Conserved residues in the ACT domains have been shown to be involved in this concerted feedback inhibition. Also included in this CD are the aspartokinases of the extreme thermophile, Thermus thermophilus HB27, the Gram-negative obligate methylotroph, Methylophilus methylotrophus AS1, and those single aspartokinases found in Pseudomonas aeruginosa, C. glutamicum, and Amycolatopsis lactamdurans. B. subtilis 168 AKII, and the C. glutamicum, Streptomyces clavuligerus and A. lactamdurans aspartokinases are described as tetramers consisting of two alpha and two beta subunits; the alpha (44 kD) and beta (18 kD) subunits formed by two in-phase overlapping polypeptides. This CD includes the first ACT domain C-terminal to the AK catalytic domain of the alpha subunit and the first ACT domain of the beta subunit that lacks the AK catalytic domain. Unlike the C. glutamicum AK beta subunit, which is involved in feedback regulation, the B. subtilis AKII beta subunit is not. Cyanobacteria aspartokinases are unique to this CD and they have a unique domain architecture with two tandem pairs of ACT domains, C-terminal to the catalytic AK domain. In this CD, the first and third cyanobacteria AK ACT domains are present. Members of this CD belong to the superfamily of ACT regulatory domains. Length = 75 Score = 100 bits (251), Expect = 8e-22 Identities = 40/76 (52%), Positives = 57/76 (75%), Gaps = 1/76 (1%) Query: 266 EAQISLRRLRDHPGISASIFSPLAEAHINIDMIIQNVSEDGQYVDITFTTPSSSLEKALA 325 +A+I+LR + D PG++A IF LAEA+IN+DMI+QNVS DG DI+FT P S L+KALA Sbjct: 1 QAKITLRGVPDKPGVAAKIFGALAEANINVDMIVQNVSRDG-TTDISFTVPKSDLKKALA 59 Query: 326 VLSDNKENIGYDVIQH 341 VL K+ +G + +++ Sbjct: 60 VLEKLKKELGAEEVEY 75 >gnl|CDD|58611 cd04245, AAK_AKiii-YclM-BS, AAK_AKiii-YclM-BS: Amino Acid Kinase Superfamily (AAK), AKiii-YclM-BS; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII, a monofunctional class enzyme found in Bacilli (Bacillus subtilis YclM) and Clostridia species. Aspartokinase is the first enzyme in the aspartate metabolic pathway and catalyzes the conversion of aspartate and ATP to aspartylphosphate and ADP. In Bacillus subtilis (BS), YclM is reported to be a single polypeptide of 50 kD. The Bacillus subtilis 168 AKIII is induced by lysine and repressed by threonine, and it is synergistically inhibited by lysine and threonine.. Length = 288 Score = 97.3 bits (242), Expect = 7e-21 Identities = 51/186 (27%), Positives = 84/186 (45%), Gaps = 3/186 (1%) Query: 30 VDRGQEVAMVVSAMSGETDRLAELCRQV---TSIDNARERDVVISTGEQVSSGLMVLALQ 86 VDR E+A + + +AE+ + + D + + GE +++ LM L Sbjct: 73 VDRYAEIADELGLPMSILEEIAEILENLANLDYANPDYLLDALKARGEYLNAQLMAAYLN 132 Query: 87 SLGIQAISLQGWQIPIMTDSLHGMARICRVDEKKIVTHLKKKQVVVITGFQGLSHDNSVT 146 GI A + ++ G A+I +KI + +VI GF G S + + Sbjct: 133 YQGIDARYVIPKDAGLVVTDEPGNAQILPESYQKIKKLRDSDEKLVIPGFYGYSKNGDIK 192 Query: 147 TLGRGGSDTSAVAIAAAIKADRCDIYTDVCGIYTTDPRIEPKAHLMKKISFEEMLEMSSL 206 T RGGSD + +A +AD + +TDV GIY +PRI + ++++ EM E+S Sbjct: 193 TFSRGGSDITGAILARGFQADLYENFTDVDGIYAANPRIVANPKPISEMTYREMRELSYA 252 Query: 207 GAKVMQ 212 G V Sbjct: 253 GFSVFH 258 >gnl|CDD|153208 cd04936, ACT_AKii-LysC-BS-like_2, ACT domains of the lysine-sensitive, aspartokinase (AK) isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related domains. This CD includes the C-terminal of the two ACT domains of the lysine-sensitive, aspartokinase (AK) isoenzyme AKII of Bacillus subtilis (BS) strain 168, and the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related sequences. In B. subtilis strain 168, the regulation of the diaminopimelate (Dap)-lysine biosynthetic pathway involves dual control by Dap and lysine, effected through separate Dap- and lysine-sensitive AK isoenzymes. The B. subtilis strain 168 AKII is induced by methionine and repressed and inhibited by lysine. Although C. glutamicum is known to contain a single AK, both the succinylase and dehydrogenase variant pathways of DAP-lysine synthesis operate simultaneously in this organism. In corynebacteria and other various Gram-positive bacteria, the DAP-lysine pathway is feedback regulated by the concerted action of lysine and threonine. Conserved residues in the ACT domains have been shown to be involved in this concerted feedback inhibition. Also included in this CD are the AKs of the extreme thermophile, Thermus thermophilus HB27, the Gram-negative obligate methylotroph, Methylophilus methylotrophus AS1, and those single AKs found in Pseudomons, C. glutamicum, and Amycolatopsis lactamdurans. B. subtilis strain 168 AKII, and the C. glutamicum, Streptomyces clavuligerus and A. lactamdurans AKs are described as tetramers consisting of two alpha and two beta subunits; the alpha (44 kD) and beta (18 kD) subunits formed by two in-phase overlapping polypeptides. This CD includes the second ACT domain C-terminal to the AK catalytic domain of the alpha subunit and the second ACT domain of the beta subunit that lacks the AK catalytic domain. Unlike the C. glutamicum AK beta subunit, which is involved in feedback regulation, the B. subtilis AKII beta subunit is not. Cyanobacteria AKs are unique to this CD and they have a unique domain architecture with two tandem pairs of ACT domains, C-terminal to the catalytic AK domain. In this CD, the second and fourth cyanobacteria AK ACT domains are present. Members of this CD belong to the superfamily of ACT regulatory domains. Length = 63 Score = 88.0 bits (219), Expect = 4e-18 Identities = 35/62 (56%), Positives = 44/62 (70%) Query: 347 KISAIGIGMQSYAGVASAFFLCLAEKGINIKAITTSEIKISVLIDSAYTELAVRSLHSCY 406 K+S +G GM+S+ GVA+ F LAE GINI+ I+TSEIKIS LID E AVR+LH + Sbjct: 2 KVSIVGAGMRSHPGVAAKMFEALAEAGINIEMISTSEIKISCLIDEDDAEKAVRALHEAF 61 Query: 407 GL 408 L Sbjct: 62 EL 63 Score = 40.6 bits (96), Expect = 7e-04 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 6/56 (10%) Query: 274 LRDHPGISASIFSPLAEAHINIDMIIQNVSEDGQYVDITFTTPSSSLEKALAVLSD 329 +R HPG++A +F LAEA INI+MI + SE + I+ EKA+ L + Sbjct: 10 MRSHPGVAAKMFEALAEAGINIEMI--STSE----IKISCLIDEDDAEKAVRALHE 59 >gnl|CDD|153195 cd04923, ACT_AK-LysC-DapG-like_2, ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related domains. This CD includes the C-terminal of the two ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis (BS) strain 168, and the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, as well as, the second and fourth, of four, ACT domains present in cyanobacteria AK. Also included are the C-terminal of the two ACT domains of the diaminopimelate-sensitive aspartokinase isoenzyme AKI found in Bacilli (B. subtilis strain 168), Clostridia, and Actinobacteria bacterial species. Members of this CD belong to the superfamily of ACT regulatory domains. Length = 63 Score = 85.3 bits (212), Expect = 3e-17 Identities = 34/62 (54%), Positives = 44/62 (70%) Query: 347 KISAIGIGMQSYAGVASAFFLCLAEKGINIKAITTSEIKISVLIDSAYTELAVRSLHSCY 406 K+S +G GM+S+ GVA+ F LAE GINI+ I+TSEIKIS L+D E AVR+LH + Sbjct: 2 KVSIVGAGMRSHPGVAAKMFKALAEAGINIEMISTSEIKISCLVDEDDAEKAVRALHEAF 61 Query: 407 GL 408 L Sbjct: 62 EL 63 Score = 39.4 bits (93), Expect = 0.002 Identities = 24/65 (36%), Positives = 37/65 (56%), Gaps = 8/65 (12%) Query: 267 AQISLR--RLRDHPGISASIFSPLAEAHINIDMIIQNVSEDGQYVDITFTTPSSSLEKAL 324 A++S+ +R HPG++A +F LAEA INI+MI + SE + I+ EKA+ Sbjct: 1 AKVSIVGAGMRSHPGVAAKMFKALAEAGINIEMI--STSE----IKISCLVDEDDAEKAV 54 Query: 325 AVLSD 329 L + Sbjct: 55 RALHE 59 >gnl|CDD|153163 cd04891, ACT_AK-LysC-DapG-like_1, ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII and related proteins. This CD includes the N-terminal of the two ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis (BS) strain 168, and the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, as well as, the first and third, of four, ACT domains present in cyanobacteria AK. Also included are the N-terminal of the two ACT domains of the diaminopimelate-sensitive aspartokinase isoenzyme AKI found in Bacilli (Bacillus subtilis strain 168), Clostridia, and Actinobacteria bacterial species. Members of this CD belong to the superfamily of ACT regulatory domains. Length = 61 Score = 84.5 bits (210), Expect = 4e-17 Identities = 35/61 (57%), Positives = 47/61 (77%), Gaps = 1/61 (1%) Query: 267 AQISLRRLRDHPGISASIFSPLAEAHINIDMIIQNVSEDGQYVDITFTTPSSSLEKALAV 326 AQ++++ + D PG++A IFS LAEA IN+DMI+Q+VS G DI+FT P S LEKALA+ Sbjct: 1 AQVTIKGVPDKPGVAAKIFSALAEAGINVDMIVQSVSRGG-TTDISFTVPKSDLEKALAI 59 Query: 327 L 327 L Sbjct: 60 L 60 >gnl|CDD|58613 cd04247, AAK_AK-Hom3, AAK_AK-Hom3: Amino Acid Kinase Superfamily (AAK), AK-Hom3; this CD includes the N-terminal catalytic domain of the aspartokinase HOM3, a monofunctional class enzyme found in Saccharomyces cerevisiae and other related AK domains. Aspartokinase, the first enzyme in the aspartate metabolic pathway, catalyzes the conversion of aspartate and ATP to aspartylphosphate and ADP, and in fungi, is responsible for the production of threonine, isoleucine and methionine. S. cerevisiae has a single aspartokinase isoenzyme type, which is regulated by feedback, allosteric inhibition by L-threonine. Recent studies show that the allosteric transition triggered by binding of threonine to AK involves a large change in the conformation of the native hexameric enzyme that is converted to an inactive one of different shape and substantially smaller hydrodynamic size.. Length = 306 Score = 80.0 bits (197), Expect = 1e-15 Identities = 55/208 (26%), Positives = 100/208 (48%), Gaps = 18/208 (8%) Query: 16 IDCIRSAALH-VKREVDRGQEVAMVVSAMSGETDRLAELCRQVTSID--NARERDVVIST 72 ++ IRS L ++ + + A + ++ E + L + + + R +D+VIST Sbjct: 72 VEDIRSDHLAAARKFIKNPELQAELEEEINKECELLRKYLEAAKILSEISPRTKDLVIST 131 Query: 73 GEQVSSGLMVLALQSLGIQAISLQGWQIPIMTDSLHGMARICRVDEK---KIVTHLKKK- 128 GE++S M L+ G+ A + ++ + I +D+ ++ L +K Sbjct: 132 GEKLSCRFMAAVLRDRGVDA------EYVDLSHIVDLDFSIEALDQTFYDELAQVLGEKI 185 Query: 129 -----QVVVITGFQGLSHDNSVTTLGRGGSDTSAVAIAAAIKADRCDIYTDVCGIYTTDP 183 +V V+TGF G ++ +GRG +D A A + AD I+ +V GI+T DP Sbjct: 186 TACENRVPVVTGFFGNVPGGLLSQIGRGYTDLCAALCAVGLNADELQIWKEVDGIFTADP 245 Query: 184 RIEPKAHLMKKISFEEMLEMSSLGAKVM 211 R P A L+ I+ EE E++ G++V+ Sbjct: 246 RKVPTARLLPSITPEEAAELTYYGSEVI 273 Score = 35.7 bits (82), Expect = 0.026 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 2/60 (3%) Query: 4 IVMKFGGTSVANIDCIRSAALHVKREVDRGQEVAMVVSAMSGETDRLAELCRQVTSIDNA 63 +V KFGGTSV + A + + +G +VA+V SA S T R + + D A Sbjct: 3 VVQKFGGTSVGKF--PDNIADDIVKAYLKGNKVAVVCSARSTGTKAEGTTNRLLQAADEA 60 >gnl|CDD|58605 cd04239, AAK_UMPK-like, AAK_UMPK-like: UMP kinase (UMPK)-like, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis. Regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway). The UMP kinases of E. coli (Ec) and Pyrococcus furiosus (Pf) are known to function as homohexamers, with GTP and UTP being allosteric effectors. Like other related enzymes (carbamate kinase, aspartokinase, and N-acetylglutamate kinase) the E. coli and most bacterial UMPKs have a conserved, N-terminal, lysine residue proposed to function in the catalysis of the phosphoryl group transfer, whereas most archaeal UMPKs appear to lack this residue and the Pyrococcus furiosus structure has an additional Mg ion bound to the ATP molecule which is proposed to function as the catalysis instead. Also included in this CD are the alpha and beta subunits of the Mo storage protein (MosA and MosB) characterized as an alpha4-beta4 octamer containing an ATP-dependent, polynuclear molybdenum-oxide cluster. These and related sequences in this CD are members of the Amino Acid Kinase Superfamily (AAK).. Length = 229 Score = 72.5 bits (178), Expect = 2e-13 Identities = 67/255 (26%), Positives = 110/255 (43%), Gaps = 39/255 (15%) Query: 3 RIVMKFGGTSVA------NIDCIRSAALHVKREVDRGQEVAMVVSAMSGETDRLAELCRQ 56 RIV+K G ++A + + ++ A +K VD G EVA+VV G R Sbjct: 1 RIVLKLSGEALAGEGGGIDPEVLKEIAREIKEVVDLGVEVAIVVGG--GNIAR------- 51 Query: 57 VTSIDNARERDVVISTGEQVSSGLMVLALQSLGIQAISLQGWQIPIMTDSLHGMARIC-R 115 I AR T + + G++ + +L +Q +L+ + S M + Sbjct: 52 -GYIAAARGMPRA--TADYI--GMLATVMNALALQD-ALEKLGVKTRVMSAIPMQGVAEP 105 Query: 116 VDEKKIVTHLKKKQVVVITGFQGLSHDNSVTTLGRGGSDTSAVAIAAAIKADRCDIYTDV 175 ++ + HL+K ++V+ G G TT DT+A A I AD T+V Sbjct: 106 YIRRRAIRHLEKGRIVIFGGGTGNPG---FTT------DTAAALRAEEIGADVLLKATNV 156 Query: 176 CGIYTTDPRIEPKAHLMKKISFEEMLEMSSLGAKVMQVRSVELAMLYKMCLFV-----RS 230 G+Y DP+ P A +IS++E+L+ G KVM ++ L K+ + V Sbjct: 157 DGVYDADPKKNPDAKKYDRISYDELLKK---GLKVMDATALTLCRRNKIPIIVFNGLKPG 213 Query: 231 SFEDHGQQEQLGTLI 245 + + E +GTLI Sbjct: 214 NLLRALKGEHVGTLI 228 >gnl|CDD|153164 cd04892, ACT_AK-like_2, ACT domains C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase). This CD includes the second of two ACT domains C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase). The exception in this group, is the inclusion of the first ACT domain of the bifunctional aspartokinase - homoserine dehydrogenase-like enzyme group (ACT_AKi-HSDH-ThrA-like_1) which includes the monofunctional, threonine-sensitive, aspartokinase found in Methanococcus jannaschii and other related archaeal species. AK catalyzes the conversion of aspartate and ATP to aspartylphosphate and ADP. AK is the first enzyme in the pathway of the biosynthesis of the aspartate family of amino acids (lysine, threonine, methionine, and isoleucine) and the bacterial cell wall component, meso-diaminopimelate. One mechanism for the regulation of this pathway is by the production of several isoenzymes of AK with different repressors and allosteric inhibitors. Pairs of ACT domains are proposed to specifically bind amino acids leading to allosteric regulation of the enzyme. In Escherichia coli (EC), three different AK isoenzymes are regulated specifically by lysine, methionine, and threonine. AK-HSDHI (ThrA) and AK-HSDHII (MetL) are bifunctional enzymes that consist of an N-terminal AK and a C-terminal homoserine dehydrogenase (HSDH). ThrA and MetL are involved in threonine and methionine biosynthesis, respectively. The third isoenzyme, AKIII (LysC), is monofunctional and is involved in lysine synthesis. The three Bacillus subtilis (BS) isoenzymes, AKI (DapG), AKII (LysC), and AKIII (YclM), are feedback inhibited by meso-diaminopimelate, lysine, and lysine plus threonine, respectively. The E. coli lysine-sensitive AK is described as a homodimer, whereas, the B. subtilis lysine-sensitive AK is described as is a heterodimeric complex of alpha- and beta- subunits that are formed from two in-frame overlapping genes. A single AK enzyme type has been described in Pseudomonas, Amycolatopsis, and Corynebacterium, and apparently, unique to cyanobacteria, are AKs with two tandem pairs of ACT domains, C-terminal to the catalytic domain. The fungal aspartate pathway is regulated at the AK step, with L-Thr being an allosteric inhibitor of the Saccharomyces cerevisiae AK (Hom3). At least two distinct AK isoenzymes can occur in higher plants, a monofunctional lysine-sensitive isoenzyme, which is involved in the overall regulation of the pathway and can be synergistically inhibited by S-adenosylmethionine. The other isoenzyme is a bifunctional, threonine-sensitive AK-HSDH protein. Also included in this CD are the ACT domains of the Methylomicrobium alcaliphilum AK; the first enzyme of the ectoine biosynthetic pathway found in this bacterium and several other halophilic/halotolerant bacteria. Members of this CD belong to the superfamily of ACT regulatory domains. Length = 65 Score = 65.6 bits (161), Expect = 2e-11 Identities = 26/64 (40%), Positives = 38/64 (59%), Gaps = 2/64 (3%) Query: 347 KISAIGIGMQSYAGVASAFFLCLAEKGINIKAITT--SEIKISVLIDSAYTELAVRSLHS 404 +S +G GM+ GVA+ F LAE GINI I+ SE+ IS ++D + AV++LH Sbjct: 2 LVSVVGAGMRGTPGVAARIFSALAEAGINIIMISQGSSEVNISFVVDEDDADKAVKALHE 61 Query: 405 CYGL 408 + L Sbjct: 62 EFFL 65 Score = 47.5 bits (114), Expect = 6e-06 Identities = 25/58 (43%), Positives = 33/58 (56%), Gaps = 4/58 (6%) Query: 272 RRLRDHPGISASIFSPLAEAHINIDMIIQNVSEDGQYVDITFTTPSSSLEKALAVLSD 329 +R PG++A IFS LAEA INI MI Q SE V+I+F +KA+ L + Sbjct: 8 AGMRGTPGVAARIFSALAEAGINIIMISQGSSE----VNISFVVDEDDADKAVKALHE 61 >gnl|CDD|58620 cd04254, AAK_UMPK-PyrH-Ec, UMP kinase (UMPK)-Ec, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway). The UMP kinase of E. coli (Ec) is known to function as a homohexamer, with GTP and UTP being allosteric effectors. Like other related enzymes (carbamate kinase, aspartokinase, and N-acetylglutamate kinase) the E. coli and most bacterial and chloroplast UMPKs (this CD) have a conserved, N-terminal, lysine residue proposed to function in the catalysis of the phosphoryl group transfer, whereas most archaeal UMPKs appear to lack this residue and the Pyrococcus furiosus structure has an additional Mg ion bound to the ATP molecule which is proposed to function as the catalysis instead. Members of this CD belong to the Amino Acid Kinase Superfamily (AAK).. Length = 231 Score = 65.5 bits (160), Expect = 2e-11 Identities = 61/256 (23%), Positives = 108/256 (42%), Gaps = 40/256 (15%) Query: 3 RIVMKFGGTSVA-------NIDCIRSAALHVKREVDRGQEVAMVVSAMSGETDRLAELCR 55 R+++K G ++A + + + A +K VD G EVA+VV + R Sbjct: 2 RVLLKLSGEALAGENGFGIDPEVLNRIAREIKEVVDLGVEVAIVVGG--------GNIFR 53 Query: 56 QVTSIDNARERDVVISTGEQVSSGLMVLALQSLGIQAISLQGWQIPIMTDSLHGMARIC- 114 ++ + +R +T + + G++ + +L +Q +L+ + S M + Sbjct: 54 GASAAEAGMDR----ATADYM--GMLATVINALALQD-ALESLGVKTRVMSAIPMQGVAE 106 Query: 115 RVDEKKIVTHLKKKQVVVITGFQGLSHDNSVTTLGRGGSDTSAVAIAAAIKADRCDIYTD 174 ++ + HL+K +VV+ G G TT DT+A A I AD T Sbjct: 107 PYIRRRAIRHLEKGRVVIFAGGTGNPF---FTT------DTAAALRAIEINADVILKATK 157 Query: 175 VCGIYTTDPRIEPKAHLMKKISFEEMLEMSSLGAKVMQVRSVELAMLYKMCLFVRSSFED 234 V G+Y DP+ P A ++++E+L G KVM + L + + V + E Sbjct: 158 VDGVYDADPKKNPNAKRYDHLTYDEVLSK---GLKVMDATAFTLCRDNNLPIVVFNINEP 214 Query: 235 HG-----QQEQLGTLI 245 + E +GTLI Sbjct: 215 GNLLKAVKGEGVGTLI 230 >gnl|CDD|153140 cd04868, ACT_AK-like, ACT domains C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase). This CD includes each of two ACT domains C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase). Typically, AK consists of two ACT domains in a tandem repeat, but the second ACT domain is inserted within the first, resulting in, what is normally the terminal beta strand of ACT2, formed from a region N-terminal of ACT1. AK catalyzes the conversion of aspartate and ATP to aspartylphosphate and ADP. Aspartokinase is the first enzyme in the pathway of the biosynthesis of the aspartate family of amino acids (lysine, threonine, methionine, and isoleucine) and the bacterial cell wall component, meso-diaminopimelate. One mechanism for the regulation of this pathway is by the production of several isoenzymes of aspartokinase with different repressors and allosteric inhibitors. Pairs of ACT domains are proposed to specifically bind amino acids leading to allosteric regulation of the enzyme. In Escherichia coli (EC), three different aspartokinase isoenzymes are regulated specifically by lysine, methionine, and threonine. AK-HSDHI (ThrA) and AK-HSDHII (MetL) are bifunctional enzymes that consist of an N-terminal AK and a C-terminal homoserine dehydrogenase (HSDH). ThrA and MetL are involved in threonine and methionine biosynthesis, respectively. The third isoenzyme, AKIII (LysC), is monofunctional and is involved in lysine synthesis. The three Bacillus subtilis (BS) isoenzymes, AKI (DapG), AKII (LysC), and AKIII (YclM), are feedback inhibited by meso-diaminopimelate, lysine, and lysine plus threonine, respectively. The E. coli lysine-sensitive AK is described as a homodimer, whereas, the B. subtilis lysine-sensitive AK is described as is a heterodimeric complex of alpha- and beta- subunits that are formed from two in-frame overlapping genes. A single AK enzyme type has been described in Pseudomonas, Amycolatopsis, and Corynebacterium, and apparently, unique to cyanobacteria, are aspartokinases with two tandem pairs of ACT domains, C-terminal to the catalytic domain. The fungal aspartate pathway is regulated at the AK step, with L-Thr being an allosteric inhibitor of the Saccharomyces cerevisiae AK (Hom3). At least two distinct AK isoenzymes can occur in higher plants, a monofunctional lysine-sensitive isoenzyme, which is involved in the overall regulation of the pathway and can be synergistically inhibited by S-adenosylmethionine. The other isoenzyme is a bifunctional, threonine-sensitive AK-HSDH protein. Also included in this AK family CD are the ACT domains of the Methylomicrobium alcaliphilum AK; the first enzyme of the ectoine biosynthetic pathway found in this bacterium and several other halophilic/halotolerant bacteria. Members of this CD belong to the superfamily of ACT regulatory domains. Length = 60 Score = 61.0 bits (149), Expect = 6e-10 Identities = 31/63 (49%), Positives = 42/63 (66%), Gaps = 6/63 (9%) Query: 267 AQISLR--RLRDHPGISASIFSPLAEAHINIDMIIQNVSEDGQYVDITFTTPSSSLEKAL 324 A++S+ +R PG++A IFS LAEA IN+DMI Q+ SE V+I+FT S LEKA+ Sbjct: 1 AKVSIVGVGMRGTPGVAAKIFSALAEAGINVDMISQSESE----VNISFTVDESDLEKAV 56 Query: 325 AVL 327 L Sbjct: 57 KAL 59 Score = 52.5 bits (127), Expect = 2e-07 Identities = 26/59 (44%), Positives = 38/59 (64%), Gaps = 2/59 (3%) Query: 347 KISAIGIGMQSYAGVASAFFLCLAEKGINIKAITTS--EIKISVLIDSAYTELAVRSLH 403 K+S +G+GM+ GVA+ F LAE GIN+ I+ S E+ IS +D + E AV++LH Sbjct: 2 KVSIVGVGMRGTPGVAAKIFSALAEAGINVDMISQSESEVNISFTVDESDLEKAVKALH 60 >gnl|CDD|30874 COG0528, PyrH, Uridylate kinase [Nucleotide transport and metabolism]. Length = 238 Score = 60.2 bits (146), Expect = 1e-09 Identities = 59/260 (22%), Positives = 110/260 (42%), Gaps = 41/260 (15%) Query: 1 MARIVMKFGGTSVA-------NIDCIRSAALHVKREVDRGQEVAMVVSAMSGETDRLAEL 53 RI++K G ++A + + + A +K VD G EVA+VV + Sbjct: 5 YMRILLKLSGEALAGEQGFGIDPEVLDRIANEIKELVDLGVEVAVVVGG--------GNI 56 Query: 54 CRQVTSIDNARERDVVISTGEQVSSGLMVLALQSLGIQAISLQGWQIPIMTDSLHGMARI 113 R +R T + + G++ + +L +Q +L+ + S M ++ Sbjct: 57 ARGYIGAAAGMDR----VTADYM--GMLATVMNALALQD-ALERLGVDTRVQSAIAMPQV 109 Query: 114 C-RVDEKKIVTHLKKKQVVVITGFQGLSHDNSVTTLGRGGSDTSAVAIAAAIKADRCDIY 172 ++ + HL+K +VV+ G G TT DT+A A I+AD Sbjct: 110 AEPYSRREAIRHLEKGRVVIFGGGTGNPG---FTT------DTAAALRAEEIEADVLLKA 160 Query: 173 T-DVCGIYTTDPRIEPKAHLMKKISFEEMLEMSSLGAKVMQVRSVELAMLYKMCLFV--- 228 T V G+Y DP+ +P A ++++E+L++ KVM + LA + + V Sbjct: 161 TNKVDGVYDADPKKDPDAKKYDTLTYDEVLKIGL---KVMDPTAFSLARDNGIPIIVFNI 217 Query: 229 --RSSFEDHGQQEQLGTLIC 246 + + + E++GT++ Sbjct: 218 NKPGNLKRALKGEEVGTIVE 237 >gnl|CDD|58621 cd04255, AAK_UMPK-MosAB, AAK_UMPK-MosAB: This CD includes the alpha and beta subunits of the Mo storage protein (MosA and MosB) which are related to uridine monophosphate kinase (UMPK) enzymes that catalyze the phosphorylation of UMP by ATP, yielding UDP, and playing a key role in pyrimidine nucleotide biosynthesis. The Mo storage protein from the nitrogen-fixing bacterium, Azotobacter vinelandii, is characterized as an alpha4-beta4 octamer containing a polynuclear molybdenum-oxide cluster which is ATP-dependent to bind Mo and pH-dependent to release Mo. These and related bacterial sequences in this CD are members of the Amino Acid Kinase Superfamily (AAK).. Length = 262 Score = 52.6 bits (126), Expect = 2e-07 Identities = 38/154 (24%), Positives = 62/154 (40%), Gaps = 14/154 (9%) Query: 62 NARERDVVISTGEQVSS----------GLMVLALQSLGIQAISLQGWQIPIMTDSLHGMA 111 E ++I TG + G+ L LG ++S Q ++ + HG + Sbjct: 60 LRPEHKLLILTGGGTRARHVYSIGLDLGMPTGVLAKLG-ASVSEQNAEMLATLLAKHGGS 118 Query: 112 RICRVDEKKIVTHLKKKQVVVITGFQGLSHDNSVTTLGR---GGSDTSAVAIAAAIKADR 168 ++ D ++ T LK + VI+G GR +D A +A I A Sbjct: 119 KVGHGDLLQLPTFLKAGRAPVISGMPPYGLWEHPAEEGRIPPHRTDVGAFLLAEVIGARN 178 Query: 169 CDIYTDVCGIYTTDPRIEPKAHLMKKISFEEMLE 202 D G+YT DP+ KA + +IS E+L+ Sbjct: 179 LIFVKDEDGLYTADPKKNKKAEFIPEISAAELLK 212 >gnl|CDD|153194 cd04922, ACT_AKi-HSDH-ThrA_2, ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH). This CD includes the second of two ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH). The ACT domains are positioned between the N-terminal catalytic domain of AK and the C-terminal HSDH domain found in bacteria (Escherichia coli (EC) ThrA) and higher plants (Zea mays AK-HSDH). AK and HSDH are the first and third enzymes in the biosynthetic pathway of the aspartate family of amino acids. AK catalyzes the phosphorylation of Asp to P-aspartyl phosphate. HSDH catalyzes the NADPH-dependent conversion of Asp 3-semialdehyde to homoserine. HSDH is the first committed reaction in the branch of the pathway that leads to Thr and Met. In E. coli, ThrA is subject to allosteric regulation by the end product L-threonine and the native enzyme is reported to be tetrameric. As with bacteria, plant AK and HSDH are feedback inhibited by pathway end products. Maize AK-HSDH is a Thr-sensitive 180-kD enzyme. Arabidopsis AK-HSDH is an alanine-activated, threonine-sensitive enzyme whose ACT domains were shown to be involved in allosteric activation. Members of this CD belong to the superfamily of ACT regulatory domains. Length = 66 Score = 48.1 bits (115), Expect = 4e-06 Identities = 23/59 (38%), Positives = 35/59 (59%), Gaps = 2/59 (3%) Query: 348 ISAIGIGMQSYAGVASAFFLCLAEKGINIKAIT--TSEIKISVLIDSAYTELAVRSLHS 404 ++ +G GM GVA+ FF LA+ +NI+AI +SE IS +ID A+R++H Sbjct: 4 LALVGDGMAGTPGVAATFFSALAKANVNIRAIAQGSSERNISAVIDEDDATKALRAVHE 62 Score = 36.9 bits (86), Expect = 0.010 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 4/58 (6%) Query: 273 RLRDHPGISASIFSPLAEAHINIDMIIQNVSEDGQYVDITFTTPSSSLEKALAVLSDN 330 + PG++A+ FS LA+A++NI I Q SE +I+ KAL + + Sbjct: 10 GMAGTPGVAATFFSALAKANVNIRAIAQGSSE----RNISAVIDEDDATKALRAVHER 63 >gnl|CDD|145157 pfam01842, ACT, ACT domain. This family of domains generally have a regulatory role. ACT domains are linked to a wide range of metabolic enzymes that are regulated by amino acid concentration. Pairs of ACT domains bind specifically to a particular amino acid leading to regulation of the linked enzyme. The ACT domain is found in: D-3-phosphoglycerate dehydrogenase EC:1.1.1.95, which is inhibited by serine. Aspartokinase EC:2.7.2.4, which is regulated by lysine. Acetolactate synthase small regulatory subunit, which is inhibited by valine. Phenylalanine-4-hydroxylase EC:1.14.16.1, which is regulated by phenylalanine. Prephenate dehydrogenase EC:4.2.1.51. formyltetrahydrofolate deformylase EC:3.5.1.10, which is activated by methionine and inhibited by glycine. GTP pyrophosphokinase EC:2.7.6.5. Length = 66 Score = 47.3 bits (113), Expect = 8e-06 Identities = 21/58 (36%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Query: 273 RLRDHPGISASIFSPLAEAHINIDMIIQNVSED-GQYVDITFTTPSSSLEKALAVLSD 329 + D PG+ A +F LA+ INI+ I Q+ S D V I LE AL L Sbjct: 6 GVPDRPGLLARVFGALADRGINIESISQSTSGDKAGIVFIVVVVDEEDLEAALEALKK 63 Score = 27.3 bits (61), Expect = 7.2 Identities = 17/63 (26%), Positives = 33/63 (52%), Gaps = 7/63 (11%) Query: 349 SAIGIGMQSYAGVASAFFLCLAEKGINIKAITTS-------EIKISVLIDSAYTELAVRS 401 + + +G+ G+ + F LA++GINI++I+ S + I V++D E A+ + Sbjct: 1 TVLEVGVPDRPGLLARVFGALADRGINIESISQSTSGDKAGIVFIVVVVDEEDLEAALEA 60 Query: 402 LHS 404 L Sbjct: 61 LKK 63 >gnl|CDD|153196 cd04924, ACT_AK-Arch_2, ACT domains of a monofunctional aspartokinase found mostly in Archaea species (ACT_AK-Arch_2). Included in this CD is the second of two ACT domains of a monofunctional aspartokinase found mostly in Archaea species (ACT_AK-Arch_2). The first or N-terminal ACT domain of these proteins cluster with the ThrA-like ACT 1 domains (ACT_AKi-HSDH-ThrA-like_1) which includes the threonine-sensitive archaeal Methanococcus jannaschii aspartokinase ACT 1 domain. Members of this CD belong to the superfamily of ACT regulatory domains. Length = 66 Score = 47.1 bits (112), Expect = 9e-06 Identities = 21/63 (33%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Query: 348 ISAIGIGMQSYAGVASAFFLCLAEKGINIKAIT--TSEIKISVLIDSAYTELAVRSLHSC 405 ++ +G GM+ GVA F L + GIN+ I+ +SE IS ++ AV+++H Sbjct: 4 VAVVGSGMRGTPGVAGRVFGALGKAGINVIMISQGSSEYNISFVVAEDDGWAAVKAVHDE 63 Query: 406 YGL 408 +GL Sbjct: 64 FGL 66 Score = 32.9 bits (75), Expect = 0.18 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 4/56 (7%) Query: 274 LRDHPGISASIFSPLAEAHINIDMIIQNVSEDGQYVDITFTTPSSSLEKALAVLSD 329 +R PG++ +F L +A IN+ MI Q SE +I+F A+ + D Sbjct: 11 MRGTPGVAGRVFGALGKAGINVIMISQGSSE----YNISFVVAEDDGWAAVKAVHD 62 >gnl|CDD|153139 cd02116, ACT, ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme. Members of this CD belong to the superfamily of ACT regulatory domains. Pairs of ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme. The ACT domain has been detected in a number of diverse proteins; some of these proteins are involved in amino acid and purine biosynthesis, phenylalanine hydroxylation, regulation of bacterial metabolism and transcription, and many remain to be characterized. ACT domain-containing enzymes involved in amino acid and purine synthesis are in many cases allosteric enzymes with complex regulation enforced by the binding of ligands. The ACT domain is commonly involved in the binding of a small regulatory molecule, such as the amino acids L-Ser and L-Phe in the case of D-3-phosphoglycerate dehydrogenase and the bifunctional chorismate mutase-prephenate dehydratase enzyme (P-protein), respectively. Aspartokinases typically consist of two C-terminal ACT domains in a tandem repeat, but the second ACT domain is inserted within the first, resulting in, what is normally the terminal beta strand of ACT2, formed from a region N-terminal of ACT1. ACT domain repeats have been shown to have nonequivalent ligand-binding sites with complex regulatory patterns such as those seen in the bifunctional enzyme, aspartokinase-homoserine dehydrogenase (ThrA). In other enzymes, such as phenylalanine hydroxylases, the ACT domain appears to function as a flexible small module providing allosteric regulation via transmission of conformational changes, these conformational changes are not necessarily initiated by regulatory ligand binding at the ACT domain itself. ACT domains are present either singularly, N- or C-terminal, or in pairs present C-terminal or between two catalytic domains. Unique to cyanobacteria are four ACT domains C-terminal to an aspartokinase domain. A few proteins are composed almost entirely of ACT domain repeats as seen in the four ACT domain protein, the ACR protein, found in higher plants; and the two ACT domain protein, the glycine cleavage system transcriptional repressor (GcvR) protein, found in some bacteria. Also seen are single ACT domain proteins similar to the Streptococcus pneumoniae ACT domain protein (uncharacterized pdb structure 1ZPV) found in both bacteria and archaea. Purportedly, the ACT domain is an evolutionarily mobile ligand binding regulatory module that has been fused to different enzymes at various times. Length = 60 Score = 45.7 bits (109), Expect = 2e-05 Identities = 24/56 (42%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Query: 273 RLRDHPGISASIFSPLAEAHINIDMIIQNVSEDGQYVDITFTTPSSS-LEKALAVL 327 D PG+ A + S LAEA INI I Q S DG DI LEK L L Sbjct: 4 SGPDRPGLLAKVLSVLAEAGINITSIEQRTSGDGGEADIFIVVDGDGDLEKLLEAL 59 >gnl|CDD|58619 cd04253, AAK_UMPK-PyrH-Pf, AAK_UMPK-PyrH-Pf: UMP kinase (UMPK)-Pf, the mostly archaeal uridine monophosphate kinase (uridylate kinase) enzymes that catalyze UMP phosphorylation and play a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway). The UMP kinase of Pyrococcus furiosus (Pf) is known to function as a homohexamer, with GTP and UTP being allosteric effectors. Like other related enzymes (carbamate kinase, aspartokinase, and N-acetylglutamate kinase) the E. coli and most bacterial UMPKs have a conserved, N-terminal, lysine residue proposed to function in the catalysis of the phosphoryl group transfer, whereas most archaeal UMPKs (this CD) appear to lack this residue and the Pyrococcus furiosus structure has an additional Mg ion bound to the ATP molecule which is proposed to function as the catalysis instead. Members of this CD belong to the Amino Acid Kinase Superfamily (AAK).. Length = 221 Score = 45.6 bits (108), Expect = 3e-05 Identities = 49/207 (23%), Positives = 87/207 (42%), Gaps = 42/207 (20%) Query: 3 RIVMKFGGTSVA---NIDCIRSAALHVKREVDRGQEVAMVVSAMSGETDRLAELCRQVTS 59 RIV+ GG+ +A + D I+ A +V R++ G +VA+VV G R Sbjct: 1 RIVISLGGSVLAPEKDADFIKEYA-NVLRKISDGHKVAVVVGG--GRLAR--------EY 49 Query: 60 IDNARERDVVISTGEQVSSGLMVLALQSLGIQAISLQGWQIPIMTDSLHGMARICRVDEK 119 I AR+ + E L +GI A L ++ +L + Sbjct: 50 ISVARK----LGASEAF--------LDEIGIMATRLNAR---LLIAALGDAYPPVPTSYE 94 Query: 120 KIVTHLKKKQVVVITGFQ-GLSHDNSVTTLGRGGSDTSAVAIAAAIKADRCDIYTDVCGI 178 + + + ++VV+ G + G S +D A +A + AD T+V G+ Sbjct: 95 EALEAMFTGKIVVMGGTEPGQS------------TDAVAALLAERLGADLLINATNVDGV 142 Query: 179 YTTDPRIEPKAHLMKKISFEEMLEMSS 205 Y+ DPR +P A ++S +E++++ Sbjct: 143 YSKDPRKDPDAKKFDRLSADELIDIVG 169 >gnl|CDD|153193 cd04921, ACT_AKi-HSDH-ThrA-like_1, ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH). This CD includes the first of two ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH). The ACT domains are positioned between the N-terminal catalytic domain of AK and the C-terminal HSDH domain found in bacteria (Escherichia coli (EC) ThrA) and higher plants (Zea mays AK-HSDH). AK and HSDH are the first and third enzymes in the biosynthetic pathway of the aspartate family of amino acids. AK catalyzes the phosphorylation of Asp to P-aspartyl phosphate. HSDH catalyzes the NADPH-dependent conversion of Asp 3-semialdehyde to homoserine. HSDH is the first committed reaction in the branch of the pathway that leads to Thr and Met. In E. coli, ThrA is subject to allosteric regulation by the end product L-threonine and the native enzyme is reported to be tetrameric. As with bacteria, plant AK and HSDH are feedback inhibited by pathway end products. Maize AK-HSDH is a Thr-sensitive 180-kD enzyme. Arabidopsis AK-HSDH is an alanine-activated, threonine-sensitive enzyme whose ACT domains were shown to be involved in allosteric activation. Also included in this CD is the first of two ACT domains of a tetrameric, monofunctional, threonine-sensitive, AK found in Methanococcus jannaschii and other related archaeal species. Members of this CD belong to the superfamily of ACT regulatory domains. Length = 80 Score = 43.4 bits (103), Expect = 1e-04 Identities = 24/59 (40%), Positives = 30/59 (50%), Gaps = 4/59 (6%) Query: 269 ISLRRLRDHPGISASIFSPLAEAHINIDMIIQNVSEDGQYVDITFTTPSSSLEKALAVL 327 I + PGI+A IFS LA A IN+ +I Q SE I+F S +KAL L Sbjct: 6 IEGTGMVGVPGIAARIFSALARAGINVILISQASSEHS----ISFVVDESDADKALEAL 60 Score = 39.5 bits (93), Expect = 0.002 Identities = 22/69 (31%), Positives = 38/69 (55%), Gaps = 4/69 (5%) Query: 345 LVKISAIGIGMQSYAGVASAFFLCLAEKGINIKAIT--TSEIKISVLIDSAYTELAVRSL 402 L+ I G GM G+A+ F LA GIN+ I+ +SE IS ++D + + A+ +L Sbjct: 3 LINIE--GTGMVGVPGIAARIFSALARAGINVILISQASSEHSISFVVDESDADKALEAL 60 Query: 403 HSCYGLDVQ 411 + L+++ Sbjct: 61 EEEFALEIK 69 >gnl|CDD|153188 cd04916, ACT_AKiii-YclM-BS_2, ACT domains located C-terminal to the catalytic domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII. This CD includes the second of two ACT domains located C-terminal to the catalytic domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII, a monofunctional class enzyme found in Bacilli (Bacillus subtilis (BS) YclM) and Clostridia species. Aspartokinase is the first enzyme in the aspartate metabolic pathway and catalyzes the conversion of aspartate and ATP to aspartylphosphate and ADP. B. subtilis YclM is reported to be a single polypeptide of 50 kD. AKIII from B. subtilis strain 168 is induced by lysine and repressed by threonine and it is synergistically inhibited by lysine and threonine. Members of this CD belong to the superfamily of ACT regulatory domains. Length = 66 Score = 43.0 bits (102), Expect = 2e-04 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 4/56 (7%) Query: 272 RRLRDHPGISASIFSPLAEAHINIDMIIQNVSEDGQYVDITFTTPSSSLEKALAVL 327 +++ G+SA + LA+A INI MI Q SE + I + +KA+ + Sbjct: 9 EGMKNTVGVSARATAALAKAGINIRMINQGSSE----ISIMIGVHNEDADKAVKAI 60 Score = 37.2 bits (87), Expect = 0.008 Identities = 19/59 (32%), Positives = 35/59 (59%), Gaps = 2/59 (3%) Query: 348 ISAIGIGMQSYAGVASAFFLCLAEKGINIKAIT--TSEIKISVLIDSAYTELAVRSLHS 404 I +G GM++ GV++ LA+ GINI+ I +SEI I + + + + AV++++ Sbjct: 4 IMVVGEGMKNTVGVSARATAALAKAGINIRMINQGSSEISIMIGVHNEDADKAVKAIYE 62 >gnl|CDD|153191 cd04919, ACT_AK-Hom3_2, ACT domains located C-terminal to the catalytic domain of the aspartokinase (AK) HOM3. This CD includes the second of two ACT domains located C-terminal to the catalytic domain of the aspartokinase (AK) HOM3, a monofunctional class enzyme found in Saccharomyces cerevisiae, and other related ACT domains. AK is the first enzyme in the aspartate metabolic pathway, catalyzes the conversion of aspartate and ATP to aspartylphosphate and ADP, and in fungi, is responsible for the production of threonine, isoleucine and methionine. S. cerevisiae has a single AK, which is regulated by feedback, allosteric inhibition by L-threonine. Recent studies shown that the allosteric transition triggered by binding of threonine to AK involves a large change in the conformation of the native hexameric enzyme that is converted to an inactive one of different shape and substantially smaller hydrodynamic size. Members of this CD belong to the superfamily of ACT regulatory domains. Length = 66 Score = 40.2 bits (94), Expect = 0.001 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 2/58 (3%) Query: 348 ISAIGIGMQSYAGVASAFFLCLAEKGINIKAIT--TSEIKISVLIDSAYTELAVRSLH 403 +S +G M++ G+A F LA+ INI+ I+ SEI IS +ID A+ +H Sbjct: 4 LSLVGKHMKNMIGIAGRMFTTLADHRINIEMISQGASEINISCVIDEKDAVKALNIIH 61 Score = 35.2 bits (81), Expect = 0.034 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 4/56 (7%) Query: 272 RRLRDHPGISASIFSPLAEAHINIDMIIQNVSEDGQYVDITFTTPSSSLEKALAVL 327 + +++ GI+ +F+ LA+ INI+MI Q SE ++I+ KAL ++ Sbjct: 9 KHMKNMIGIAGRMFTTLADHRINIEMISQGASE----INISCVIDEKDAVKALNII 60 >gnl|CDD|58608 cd04242, AAK_G5K_ProB, AAK_G5K_ProB: Glutamate-5-kinase (G5K) catalyzes glutamate-dependent ATP cleavage; G5K transfers the terminal phosphoryl group of ATP to the gamma-carboxyl group of glutamate, in the first and controlling step of proline (and, in mammals, ornithine) biosynthesis. G5K is subject to feedback allosteric inhibition by proline or ornithine. In microorganisms and plants, proline plays an important role as an osmoprotectant and, in mammals, ornithine biosynthesis is crucial for proper ammonia detoxification, since a G5K mutation has been shown to cause human hyperammonaemia. Microbial G5K generally consists of two domains: a catalytic G5K domain and one PUA (pseudo uridine synthases and archaeosine-specific transglycosylases) domain, and some lack the PUA domain. G5K requires free Mg for activity, it is tetrameric, and it aggregates to higher forms in a proline-dependent way. G5K lacking the PUA domain remains tetrameric, active, and proline-inhibitable, but the Mg requirement and the proline-triggered aggregation are greatly diminished and abolished, respectively, and more proline is needed for inhibition. Although plant and animal G5Ks are part of a bifunctional polypeptide, delta 1-pyrroline-5-carboxylate synthetase (P5CS), composed of an N-terminal G5K (ProB) and a C-terminal glutamyl 5- phosphate reductase (G5PR; ProA); bacterial and yeast G5Ks are monofunctional single-polypeptide enzymes. In this CD, all three domain architectures are present: G5K, G5K+PUA, and G5K+G5PR.. Length = 251 Score = 39.7 bits (93), Expect = 0.002 Identities = 14/45 (31%), Positives = 25/45 (55%) Query: 151 GGSDTSAVAIAAAIKADRCDIYTDVCGIYTTDPRIEPKAHLMKKI 195 G +D + +A + AD + +DV G+Y +PR P A L+ ++ Sbjct: 142 GDNDRLSALVAGLVNADLLILLSDVDGLYDKNPRENPDAKLIPEV 186 >gnl|CDD|153153 cd04881, ACT_HSDH-Hom, ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains. The ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) encoded by the hom gene of Bacillus subtilis and other related sequences. HSDH reduces aspartate semi-aldehyde to the amino acid homoserine, one that is required for the biosynthesis of Met, Thr, and Ile from Asp. Neither the enzyme nor the aspartate pathway is found in the animal kingdom. This mostly bacterial HSDH group has a C-terminal ACT domain and is believed to be involved in enzyme regulation. A C-terminal deletion in the Corynebacterium glutamicum HSDH abolished allosteric inhibition by L-threonine. Members of this CD belong to the superfamily of ACT regulatory domains. Length = 79 Score = 38.7 bits (91), Expect = 0.003 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 3/68 (4%) Query: 275 RDHPGISASIFSPLAEAHINIDMIIQNVSEDGQYVD---ITFTTPSSSLEKALAVLSDNK 331 +D PG+ A I LAE I+I+ +IQ ++ G+ +T T ++L ALA + Sbjct: 8 KDKPGVLAKITGILAEHGISIESVIQKEADGGETAPVVIVTHETSEAALNAALAEIEALD 67 Query: 332 ENIGYDVI 339 G + Sbjct: 68 AVQGVPSV 75 >gnl|CDD|30894 COG0548, ArgB, Acetylglutamate kinase [Amino acid transport and metabolism]. Length = 265 Score = 38.6 bits (90), Expect = 0.003 Identities = 48/214 (22%), Positives = 84/214 (39%), Gaps = 22/214 (10%) Query: 4 IVMKFGGTSVANIDCIRSAALHVKREVDRGQEVAMVVSAMSGETDRLAELCRQVTSIDNA 63 IV+K GG+++ + + + + A + G +V + LA+L + + Sbjct: 5 IVIKLGGSAMEDENLLEAFASDIALLKSVGIRPVVVHGGGPQIDEMLAKLGIEPEFVKGL 64 Query: 64 RERD-VVISTGEQVSSGLM----VLALQSLGIQAISLQG---------WQIPIMTDSLHG 109 R D + E V G + V L G QA+ L G L Sbjct: 65 RVTDAETLEVVEMVLGGTVNKEIVARLSKHGGQAVGLSGVDGNLVTAKKLDVDDGVDLGY 124 Query: 110 MARICRVDEKKIVTHLKKKQVVVITGFQGLSHDNSVTTLGRGGSDTSAVAIAAAIKADRC 169 + I +V+ + I L + VI + D + +DT+A A+AAA+KA++ Sbjct: 125 VGEIRKVNPELIERLLDNGAIPVIAPI-AVDEDGETLNVN---ADTAAGALAAALKAEKL 180 Query: 170 DIYTDVCGIYTTDPRIEPKAHLMKKISFEEMLEM 203 + TDV G+ L+ ++ EE E+ Sbjct: 181 ILLTDVPGVLDDK----GDPSLISELDAEEAEEL 210 >gnl|CDD|30612 COG0263, ProB, Glutamate 5-kinase [Amino acid transport and metabolism]. Length = 369 Score = 37.9 bits (88), Expect = 0.005 Identities = 14/53 (26%), Positives = 28/53 (52%) Query: 144 SVTTLGRGGSDTSAVAIAAAIKADRCDIYTDVCGIYTTDPRIEPKAHLMKKIS 196 + + G +DT + +A + AD + +D+ G+Y +PR P A L+ ++ Sbjct: 142 ATEEIKFGDNDTLSALVAILVGADLLVLLSDIDGLYDANPRTNPDAKLIPEVE 194 >gnl|CDD|153209 cd04937, ACT_AKi-DapG-BS_2, ACT domains of the diaminopimelate-sensitive aspartokinase (AK) isoenzyme AKI. This CD includes the C-terminal of the two ACT domains of the diaminopimelate-sensitive aspartokinase (AK) isoenzyme AKI, a monofunctional class enzyme found in Bacilli (Bacillus subtilis (BS) strain 168), Clostridia, and Actinobacteria bacterial species. In B. subtilis, the regulation of the diaminopimelate-lysine biosynthetic pathway involves dual control by diaminopimelate and lysine, effected through separate diaminopimelate- and lysine-sensitive AK isoenzymes. AKI activity is invariant during the exponential and stationary phases of growth and is not altered by addition of amino acids to the growth medium. The role of this isoenzyme is most likely to provide a constant level of aspartyl-beta-phosphate for the biosynthesis of diaminopimelate for peptidoglycan synthesis and dipicolinate during sporulation. The BS AKI is tetrameric consisting of two alpha and two beta subunits; the alpha (43 kD) and beta (17 kD) subunit formed by two in-phase overlapping genes. The alpha subunit contains the AK catalytic domain and two ACT domains. The beta subunit contains two ACT domains. Members of this CD belong to the superfamily of ACT regulatory domains. Length = 64 Score = 37.4 bits (87), Expect = 0.007 Identities = 18/64 (28%), Positives = 30/64 (46%) Query: 345 LVKISAIGIGMQSYAGVASAFFLCLAEKGINIKAITTSEIKISVLIDSAYTELAVRSLHS 404 K++ IG ++ GV + L+++GI I S IS L+ + AV +LH Sbjct: 1 CAKVTIIGSRIRGVPGVMAKIVGALSKEGIEILQTADSHTTISCLVSEDDVKEAVNALHE 60 Query: 405 CYGL 408 + L Sbjct: 61 AFEL 64 >gnl|CDD|58617 cd04251, AAK_NAGK-UC, AAK_NAGK-UC: N-Acetyl-L-glutamate kinase - uncharacterized (NAGK-UC). This domain is similar to Escherichia coli and Pseudomonas aeruginosa NAGKs which catalyze the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of microbial arginine biosynthesis. These uncharacterized domain sequences are found in some bacteria (Deinococci and Chloroflexi) and archea and belong to the Amino Acid Kinase Superfamily (AAK).. Length = 257 Score = 37.2 bits (86), Expect = 0.009 Identities = 50/206 (24%), Positives = 83/206 (40%), Gaps = 30/206 (14%) Query: 4 IVMKFGGTSVANIDCIRSAALHVKREVDRGQEVAMVVSAMSGETDRLAELC----RQVTS 59 IV+K GG+ V+++D + ++ E +VV + + + VTS Sbjct: 1 IVVKIGGSVVSDLDKVID-------DIANFGERLIVVHGGGNYVNEYLKRLGVEPKFVTS 53 Query: 60 IDNARERDVVISTGE--QVSSGLM----VLALQSLGIQAISLQGWQIPIMTDSLHGMARI 113 R R T E + GL+ V L SLG++A+ L G ++ + R+ Sbjct: 54 PSGIRSRYTDKETLEVFVMVMGLINKKIVARLHSLGVKAVGLTGLDGRLLEAKRKEIVRV 113 Query: 114 CRVDEKKIVT-----HLKKKQVVVITGFQGLSHDNSVTTLGRGG--------SDTSAVAI 160 K I+ ++K +I + V+ + D +A AI Sbjct: 114 NERGRKMIIRGGYTGKVEKVNSDLIEALLDAGYLPVVSPVAYSEEGEPLNVDGDRAAAAI 173 Query: 161 AAAIKADRCDIYTDVCGIYTTDPRIE 186 AAA+KA+R + TDV G+Y IE Sbjct: 174 AAALKAERLILLTDVEGLYLDGRVIE 199 >gnl|CDD|58604 cd04238, AAK_NAGK-like, AAK_NAGK-like: N-Acetyl-L-glutamate kinase (NAGK)-like . Included in this CD are the Escherichia coli and Pseudomonas aeruginosa type NAGKs which catalyze the phosphorylation of N-acetyl-L-glutamate (NAG) by ATP in the second step of arginine biosynthesis found in bacteria and photosynthetic organisms using either the acetylated, noncyclic (NC), or non-acetylated, cyclic (C) route of ornithine biosynthesis. Also included in this CD is a distinct group of uncharacterized (UC) bacterial and archeal NAGKs. Members of this CD belong to the Amino Acid Kinase Superfamily (AAK).. Length = 256 Score = 35.9 bits (83), Expect = 0.022 Identities = 31/118 (26%), Positives = 51/118 (43%), Gaps = 16/118 (13%) Query: 74 EQVSSGL----MVLALQSLGIQAISLQGW--------QIPIMTDSLHGMARICRVDEKKI 121 E V +G +V L G +A+ L G + L + + V+ + + Sbjct: 72 EMVLAGKVNKELVSLLNRAGGKAVGLSGKDGGLIKAEKKEEKDIDLGFVGEVTEVNPELL 131 Query: 122 VTHLKKKQVVVITGFQGLSHDNSVTTLGRGGSDTSAVAIAAAIKADRCDIYTDVCGIY 179 T L+ + VI ++ D T DT+A AIAAA+KA++ + TDV G+ Sbjct: 132 ETLLEAGYIPVIAP---IAVDEDGETYNVNA-DTAAGAIAAALKAEKLILLTDVPGVL 185 >gnl|CDD|31796 COG1608, COG1608, Predicted archaeal kinase [General function prediction only]. Length = 252 Score = 35.3 bits (81), Expect = 0.031 Identities = 51/207 (24%), Positives = 82/207 (39%), Gaps = 15/207 (7%) Query: 4 IVMKFGGTSVANID---CIRSAAL-HVKREVDRGQEVAMVVSAMSGETDRLAELCRQVTS 59 I++K GG+ + + D +R L + RE+ G+ ++V G A + Sbjct: 3 IILKLGGSVITDKDKPRTVREDRLRRIAREISNGKPEKLIVVHGGGSFGHPAAKEFGLEG 62 Query: 60 IDNARERDVVISTGEQVS--SGLMVLALQSLGIQAISLQGWQIPIMTDSLHGMARICRVD 117 + N T + + ++V AL G++A+S+ PI RI Sbjct: 63 LKNYLSPLGFSLTHLAMLELNSIVVDALLDAGVRAVSVV----PI--SFSTFNGRILYTY 116 Query: 118 EKKIVTHLKKKQVVVITGFQGLSHDNSVTTLGRGGSDTSAVAIAAAIKADRCDIYTDVCG 177 + I L+K V V+ G DN + D + +A +K DR TDV G Sbjct: 117 LEAIKDALEKGFVPVLYGDVVPDDDNGYEIIS---GDDIVLHLAKELKPDRVIFLTDVDG 173 Query: 178 IYTTDPRIEPKAHLMKKISFEEMLEMS 204 +Y DP P A L+ +I L S Sbjct: 174 VYDRDPGKVPDARLLSEIEGRVALGGS 200 >gnl|CDD|153144 cd04872, ACT_1ZPV, ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein. This CD, ACT_1ZPV, includes those single ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein (pdb structure 1ZPV). Members of this CD belong to the superfamily of ACT regulatory domains. Length = 88 Score = 34.5 bits (80), Expect = 0.055 Identities = 21/74 (28%), Positives = 35/74 (47%), Gaps = 7/74 (9%) Query: 275 RDHPGISASIFSPLAEAHINIDMIIQNVSEDG----QYVDITFTTPSSSLEKALAVLSDN 330 +D GI A + + LAE ++NI I Q + + VDI + + + L + Sbjct: 9 KDRVGIVAGVSTKLAELNVNILDISQTIMDGYFTMIMIVDI--SESNLDFAELQEELEEL 66 Query: 331 KENIGYDV-IQHED 343 + +G + IQHED Sbjct: 67 GKELGVKIRIQHED 80 >gnl|CDD|58616 cd04250, AAK_NAGK-C, AAK_NAGK-C: N-Acetyl-L-glutamate kinase - cyclic (NAGK-C) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of arginine biosynthesis found in some bacteria and photosynthetic organisms using the non-acetylated, cyclic route of ornithine biosynthesis. In this pathway, glutamate is first N-acetylated and then phosphorylated by NAGK to give phosphoryl NAG, which is converted to NAG-ornithine. There are two variants of this pathway. In one, typified by the pathway in Thermotoga maritima and Pseudomonas aeruginosa, the acetyl group is recycled by reversible transacetylation from acetylornithine to glutamate. The phosphorylation of NAG by NAGK is feedback inhibited by arginine. In photosynthetic organisms, NAGK is the target of the nitrogen-signaling protein PII. Hexameric formation of NAGK domains appears to be essential to both arginine inhibition and NAGK-PII complex formation. NAGK-C are members of the Amino Acid Kinase Superfamily (AAK).. Length = 279 Score = 34.3 bits (79), Expect = 0.057 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 3/50 (6%) Query: 154 DTSAVAIAAAIKADRCDIYTDVCGIYTTDPRIEPKAHLMKKISFEEMLEM 203 DT+A AIAAA+KA++ + TDV G+ L+ +IS +E E+ Sbjct: 180 DTAAGAIAAALKAEKLILLTDVAGVLD---DPNDPGSLISEISLKEAEEL 226 >gnl|CDD|153186 cd04914, ACT_AKi-DapG-BS_1, ACT domains of the diaminopimelate-sensitive aspartokinase (AK) isoenzyme AKI. This CD includes the N-terminal of the two ACT domains of the diaminopimelate-sensitive aspartokinase (AK) isoenzyme AKI, a monofunctional class enzyme found in Bacilli (Bacillus subtilis (BS) strain 168), Clostridia, and Actinobacteria, bacterial species. In B. subtilis, the regulation of the diaminopimelate-lysine biosynthetic pathway involves dual control by diaminopimelate and lysine, effected through separate diaminopimelate- and lysine-sensitive aspartokinase isoenzymes. AKI activity is invariant during the exponential and stationary phases of growth and is not altered by addition of amino acids to the growth medium. The role of this isoenzyme is most likely to provide a constant level of aspartyl-beta-phosphate for the biosynthesis of diaminopimelate for peptidoglycan synthesis and dipicolinate during sporulation. The B. subtilis AKI is tetrameric consisting of two alpha and two beta subunits; the alpha (43 kD) and beta (17 kD) subunit formed by two in-phase overlapping genes. The alpha subunit contains the AK catalytic domain and two ACT domains. The beta subunit contains two ACT domains. Members of this CD belong to the superfamily of ACT regulatory domains. Length = 67 Score = 33.8 bits (78), Expect = 0.090 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 10/54 (18%) Query: 284 IFSPLAEAHINIDMIIQNVSEDGQYVDITFTTPSSSLEKALAVLSDNKENIGYD 337 +F LA A I++D+I NVS + + FT EKA+ +L E +G D Sbjct: 19 VFKALANAGISVDLI--NVSPEE----VIFTVDGEVAEKAVDIL----EKMGLD 62 >gnl|CDD|153189 cd04917, ACT_AKiii-LysC-EC_2, ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII. This CD includes the second of two ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII, a monofunctional class enzyme found in bacteria (Escherichia coli (EC) LysC). Aspartokinase is the first enzyme in the aspartate metabolic pathway and catalyzes the conversion of aspartate and ATP to aspartylphosphate and ADP. The E. coli AKIII (LysC) binds two feedback allosteric inhibitor lysine molecules at the dimer interface located between the ACT1 domain of two subunits. The second ACT domain (ACT2), this CD, is not involved in the binding of heterotrophic effectors. Members of this CD belong to the superfamily of ACT regulatory domains. Length = 64 Score = 33.3 bits (77), Expect = 0.14 Identities = 17/63 (26%), Positives = 27/63 (42%), Gaps = 4/63 (6%) Query: 345 LVKISAIGIGMQSYAGVASAFFLCLAEKGINIKAIT--TSEIKISVLIDSAYTELAVRSL 402 L ++ IG + AGV F L + IN++ I S + L+ + V+ L Sbjct: 1 LALVALIGNDISETAGVEKRIFDALED--INVRMICYGASNHNLCFLVKEEDKDEVVQRL 58 Query: 403 HSC 405 HS Sbjct: 59 HSR 61 >gnl|CDD|153181 cd04909, ACT_PDH-BS, C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH). The C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate, found in Bacillus subtilis (BS) and other Firmicutes, Deinococci, and Bacteroidetes. PDH is the first enzyme in the aromatic amino acid pathway specific for the biosynthesis of tyrosine. This enzyme is feedback-inhibited by tyrosine in B. subtilis and other microorganisms. Both phenylalanine and tryptophan have been shown to be inhibitors of this activity in B. subtilis. Bifunctional chorismate mutase-PDH (TyrA) enzymes such as those seen in Escherichia coli do not contain an ACT domain. Members of this CD belong to the superfamily of ACT regulatory domains. Length = 69 Score = 31.0 bits (71), Expect = 0.54 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Query: 276 DHPGISASIFSPLAEAHINI-DMIIQNVSED-GQYVDITFTTPSSSLEKALAVLSD 329 D PG+ A + L +A I+I ++ I + E G + I+F T E+A +L + Sbjct: 10 DEPGVIAEVTQILGDAGISIKNIEILEIREGIGGILRISFKTQ-EDRERAKEILKE 64 >gnl|CDD|33623 COG3830, COG3830, ACT domain-containing protein [Signal transduction mechanisms]. Length = 90 Score = 30.9 bits (70), Expect = 0.58 Identities = 22/73 (30%), Positives = 33/73 (45%), Gaps = 7/73 (9%) Query: 276 DHPGISASIFSPLAEAHINIDMIIQNVSED----GQYVDITFTTPSSSLEKALAVLSDNK 331 D GI A++ LAE +NI I Q V + VDI+ + + L+ Sbjct: 12 DRVGIVAAVSRVLAEHGVNILDISQTVMDGFFTMIMLVDISKEVVDFAALRDE--LAAEG 69 Query: 332 ENIGYDV-IQHED 343 + +G DV +Q ED Sbjct: 70 KKLGVDVRVQRED 82 >gnl|CDD|58607 cd04241, AAK_FomA-like, AAK_FomA-like: This CD includes a fosfomycin biosynthetic gene product, FomA, and similar proteins found in a wide range of organisms. Together, the fomA and fomB genes in the fosfomycin biosynthetic gene cluster of Streptomyces wedmorensis confer high-level fosfomycin resistance. FomA and FomB proteins converted fosfomycin to fosfomycin monophosphate and fosfomycin diphosphate in the presence of ATP and a magnesium ion, indicating that FomA and FomB catalyzed phosphorylations of fosfomycin and fosfomycin monophosphate, respectively. FomA and related sequences in this CD are members of the Amino Acid Kinase Superfamily (AAK).. Length = 252 Score = 31.0 bits (70), Expect = 0.59 Identities = 32/124 (25%), Positives = 51/124 (41%), Gaps = 11/124 (8%) Query: 84 ALQSLGIQAISLQGWQIPIMTDSLHGMARICRVDEKKIVTHLKKKQVVVITGFQGLSHDN 143 AL G+ A+S+ + + RI D + I L + V V+ G L Sbjct: 88 ALLEAGVPAVSVPPSSFFVTENG-----RIVSFDLEVIKELLDRGFVPVLHGDVVLDEGG 142 Query: 144 SVTTLGRGGSDTSAVAIAAAIKADRCDIYTDVCGIYTTDPRIEPKAHLMKKISFEEMLEM 203 +T L D V +A A+K +R TDV G+Y P P A L+ +I + ++ Sbjct: 143 GITILS---GDDIVVELAKALKPERVIFLTDVDGVYDKPP---PDAKLIPEIDVGSLEDI 196 Query: 204 SSLG 207 + Sbjct: 197 LAAL 200 >gnl|CDD|32237 COG2054, COG2054, Uncharacterized archaeal kinase related to aspartokinases, uridylate kinases [General function prediction only]. Length = 212 Score = 30.7 bits (69), Expect = 0.66 Identities = 24/76 (31%), Positives = 34/76 (44%), Gaps = 8/76 (10%) Query: 153 SDTSAVAIAAAIKADRCDIYTDVCGIYTTDPRIEPKAHLMKKISFEEMLEMSSLGAKVMQ 212 SD+ +V IAA A TDV GIY D PK L+++I ++ G + Sbjct: 118 SDSISVWIAAKAGATEVVKATDVDGIYEED----PKGKLVREIRASDLKT----GETSVD 169 Query: 213 VRSVELAMLYKMCLFV 228 +L + YKM V Sbjct: 170 PYLPKLLVKYKMNCRV 185 >gnl|CDD|153161 cd04889, ACT_PDH-BS-like, C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate. Included in this CD is the C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate, found in Bacillus subtilis (BS) and other Firmicutes, Deinococci, and Bacteroidetes. PDH is the first enzyme in the aromatic amino acid pathway specific for the biosynthesis of tyrosine. This enzyme is feedback inhibited by tyrosine in B. subtilis and other microorganisms. Both phenylalanine and tryptophan have been shown to be inhibitors of this activity in B. subtilis. Bifunctional chorismate mutase-PDH (TyrA) enzymes such as those seen in Escherichia coli do not contain an ACT domain. Also included in this CD is the N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains as seen in the uncharacterized structure (pdb 2F06) of the Bt0572 protein from Bacteroides thetaiotaomicron and related ACT domains. Members of this CD belong to the superfamily of ACT regulatory domains. Length = 56 Score = 30.6 bits (70), Expect = 0.83 Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 5/54 (9%) Query: 276 DHPGISASIFSPLAEAHINI-DMIIQNVSEDGQYVDITFTTPSSSLEKALAVLS 328 + PG A + LAEA INI + I + + + F+ P E+A VL Sbjct: 7 NKPGRLAEVTEILAEAGINIKAISIAETRGEFGILRLIFSDP----ERAKEVLK 56 >gnl|CDD|39088 KOG3885, KOG3885, KOG3885, Fibroblast growth factor [Signal transduction mechanisms]. Length = 155 Score = 30.6 bits (69), Expect = 0.84 Identities = 7/34 (20%), Positives = 18/34 (52%) Query: 340 QHEDNLVKISAIGIGMQSYAGVASAFFLCLAEKG 373 + + +I + +G+ + GV S +L + ++G Sbjct: 54 SDQHTIFEIITVAVGVVAIKGVESELYLAMNKEG 87 >gnl|CDD|58606 cd04240, AAK_UC, AAK_UC: Uncharacterized (UC) amino acid kinase-like proteins found mainly in archaea and a few bacteria. Sequences in this CD are members of the Amino Acid Kinase (AAK) superfamily.. Length = 203 Score = 29.9 bits (67), Expect = 1.2 Identities = 23/69 (33%), Positives = 32/69 (46%), Gaps = 12/69 (17%) Query: 138 GLSHDNSVTTLGRGGSDTSAVAIAAAIKADRCDIYTDVCGIYTTDPRIEPKAHLMKKISF 197 L H VT SD+ A +A + A R I TDV GIY E L+ +I+ Sbjct: 107 PLPHSWEVT------SDSIAAWLAKKLGAKRLVIVTDVDGIY------EKDGKLVNEIAA 154 Query: 198 EEMLEMSSL 206 E+L +S+ Sbjct: 155 AELLGETSV 163 >gnl|CDD|153207 cd04935, ACT_AKiii-DAPDC_1, ACT domains of a bifunctional AKIII (LysC)-like aspartokinase/meso-diaminopimelate decarboxylase (DAPDC) bacterial protein. This CD includes the first of two ACT domains of a bifunctional AKIII (LysC)-like aspartokinase/meso-diaminopimelate decarboxylase (DAPDC) bacterial protein. Aspartokinase (AK) is the first enzyme in the aspartate metabolic pathway and catalyzes the conversion of aspartate and ATP to aspartylphosphate and ADP. The lysA gene encodes the enzyme DAPDC, a pyridoxal-5'-phosphate (PLP)-dependent enzyme which catalyzes the final step in the lysine biosynthetic pathway converting meso-diaminopimelic acid (DAP) to l-lysine. Tandem ACT domains are positioned centrally with the AK catalytic domain N-terminal and the DAPDC domains C-terminal. Members of this CD belong to the superfamily of ACT regulatory domains. Length = 75 Score = 29.4 bits (66), Expect = 1.7 Identities = 11/44 (25%), Positives = 23/44 (52%) Query: 348 ISAIGIGMQSYAGVASAFFLCLAEKGINIKAITTSEIKISVLID 391 +S +GM G + F + G+++ ++TSE ++V +D Sbjct: 4 VSMETLGMWQQVGFLADVFAPFKKHGVSVDLVSTSETNVTVSLD 47 >gnl|CDD|28940 cd00058, FGF, Acidic and basic fibroblast growth factor family; FGFs are mitogens, which stimulate growth or differentiation of cells of mesodermal or neuroectodermal origin. The family plays essential roles in patterning and differentiation during vertebrate embryogenesis, and has neurotrophic activities. FGFs have a high affinity for heparan sulfate proteoglycans and require heparan sulfate to activate one of four cell surface FGF receptors. Upon binding to FGF, the receptors dimerize and their intracellular tyrosine kinase domains become active. FGFs have internal pseudo-threefold symmetry (beta-trefoil topology).. Length = 123 Score = 29.0 bits (65), Expect = 2.3 Identities = 10/32 (31%), Positives = 19/32 (59%) Query: 342 EDNLVKISAIGIGMQSYAGVASAFFLCLAEKG 373 +++ A+ +G+ S GVAS +LC+ + G Sbjct: 28 SYTILERIAVAVGVVSIKGVASCRYLCMNKCG 59 >gnl|CDD|30789 COG0440, IlvH, Acetolactate synthase, small (regulatory) subunit [Amino acid transport and metabolism]. Length = 163 Score = 29.0 bits (65), Expect = 2.3 Identities = 19/100 (19%), Positives = 35/100 (35%), Gaps = 8/100 (8%) Query: 274 LRDHPGISASIFSPLAEAHINIDMIIQNVSEDGQYVDITFTT-----PSSSLEKALAVLS 328 + + PG+ + + + NI+ + +E IT + K L L Sbjct: 11 VENEPGVLSRVTGLFSRRGYNIESLTVGPTETPGLSRITIVVSGDEQVLEQIIKQLNKLI 70 Query: 329 DN---KENIGYDVIQHEDNLVKISAIGIGMQSYAGVASAF 365 D + ++ E L+K+SA G A + F Sbjct: 71 DVLKVLDLTSEPHVERELALIKVSAEGSERGEIARITEIF 110 >gnl|CDD|153158 cd04886, ACT_ThrD-II-like, C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains. This CD includes the C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains. The Escherichia coli tdcB gene product, ThrD-II, anaerobically catalyzes the pyridoxal phosphate-dependent dehydration of L-threonine and L-serine to ammonia and to alpha-ketobutyrate and pyruvate, respectively. Tetrameric ThrD-II is subject to allosteric activation by AMP, inhibition by alpha-keto acids, and catabolite inactivation by several metabolites of glycolysis and the citric acid cycle. Also included in this CD are N-terminal ACT domains present in smaller (~170 a.a.) archaeal proteins of unknown function. Members of this CD belong to the superfamily of ACT regulatory domains. Length = 73 Score = 28.7 bits (65), Expect = 2.9 Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 10/74 (13%) Query: 273 RLRDHPGISASIFSPLAEAHINIDMIIQN-----VSEDGQYVDITFTTPSSS-LEKALAV 326 L D PG A + + +AEA NI + + + V++T T + +E+ +A Sbjct: 4 ELPDRPGQLAKLLAVIAEAGANIIEVSHDRAFKTLPLGEVEVELTLETRGAEHIEEIIAA 63 Query: 327 LSDNKENIGYDVIQ 340 L + GYDV + Sbjct: 64 LREA----GYDVRR 73 >gnl|CDD|153377 cd07365, MhpB_like, Subunit B of the Class III Extradiol ring-cleavage dioxygenase, 2,3-dihydroxyphenylpropionate 1,2-dioxygenase (MhpB), which catalyzes the oxidization and subsequent ring-opening of 2,3-dihydroxyphenylpropionate. 2,3-dihydroxyphenylpropionate 1,2-dioxygenase (MhpB) catalyzes the oxidization and subsequent ring-opening of 2,3-dihydroxyphenylpropionate, yielding the product 2-hydroxy-6-oxo-nona-2,4-diene 1,9-dicarboxylate. It is an essential enzyme in the beta-phenylpropionic degradation pathway, in which beta-phenylpropionic is first hydrolyzed to produce 2,3-dihydroxyphenylpropionate. The enzyme is a member of the class III extradiol dioxygenase family, a group of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. LigAB-like class III enzymes are usually composed of two subunits, designated A and B, which form a tetramer composed of two copies of each subunit. This model represents the catalytic subunit, B. MhpB is likely to be a tetramer. Length = 310 Score = 28.4 bits (64), Expect = 3.4 Identities = 30/91 (32%), Positives = 39/91 (42%), Gaps = 15/91 (16%) Query: 67 DVVISTGEQVSSGLMVLALQSL--GIQAISLQGWQIPIMTDS----LHGMARICRVDEKK 120 DV IS QV G L+ L G+ + IPI +S L M R + E Sbjct: 104 DVAISHRMQVDHG-FTQPLEELFGGLDRYPV----IPIFVNSVAPPLAPMRRARALGEA- 157 Query: 121 IVTHLKK--KQVVVITGFQGLSHDNSVTTLG 149 + L K K+V+ + G GLSHD V L Sbjct: 158 VGRFLAKLDKRVLFL-GSGGLSHDPPVPQLA 187 >gnl|CDD|36369 KOG1154, KOG1154, KOG1154, Gamma-glutamyl kinase [Amino acid transport and metabolism]. Length = 285 Score = 28.4 bits (63), Expect = 3.7 Identities = 15/35 (42%), Positives = 22/35 (62%) Query: 153 SDTSAVAIAAAIKADRCDIYTDVCGIYTTDPRIEP 187 +D+ A +AA IKAD + +DV G+YT P +P Sbjct: 169 NDSLAAILAAEIKADLLILLSDVDGLYTGPPDADP 203 >gnl|CDD|33403 COG3603, COG3603, Uncharacterized conserved protein [Function unknown]. Length = 128 Score = 28.0 bits (62), Expect = 4.6 Identities = 17/63 (26%), Positives = 27/63 (42%), Gaps = 11/63 (17%) Query: 276 DHPGISASIFSPLAEAHINIDMIIQNVSEDGQYVDITFTTPSSSLEKALAVLSDNKENIG 335 GI AS+ PL++ I I + D ++ + LEKA+ L E G Sbjct: 75 GLTGILASVSQPLSDNGIG---IFAVSTYDTDHILVR----EEDLEKAVKAL----EEAG 123 Query: 336 YDV 338 ++V Sbjct: 124 HEV 126 >gnl|CDD|153184 cd04912, ACT_AKiii-LysC-EC-like_1, ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII. This CD includes the first of two ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII, a monofunctional class enzyme found in bacteria (Escherichia coli (EC) LysC) and plants, (Zea mays Ask1, Ask2, and Arabidopsis thaliana AK1). Aspartokinase is the first enzyme in the aspartate metabolic pathway and catalyzes the conversion of aspartate and ATP to aspartylphosphate and ADP. Like the A. thaliana AK1 (AK1-AT), the E. coli AKIII (LysC) has two bound feedback allosteric inhibitor lysine molecules at the dimer interface located between the ACT1 domain of two subunits. The lysine-sensitive plant isoenzyme is synergistically inhibited by S-adenosylmethionine. A homolog of this group appears to be the Saccharomyces cerevisiae AK (Hom3) which clusters with this group as well. Members of this CD belong to the superfamily of ACT regulatory domains. Length = 75 Score = 27.6 bits (62), Expect = 5.9 Identities = 10/41 (24%), Positives = 20/41 (48%) Query: 365 FFLCLAEKGINIKAITTSEIKISVLIDSAYTELAVRSLHSC 405 F A+ G+++ I+TSE+ +S+ +D L + Sbjct: 21 VFEIFAKHGLSVDLISTSEVSVSLTLDPTKNLSDQLLLDAL 61 >gnl|CDD|36403 KOG1189, KOG1189, KOG1189, Global transcriptional regulator, cell division control protein [Amino acid transport and metabolism]. Length = 960 Score = 27.4 bits (60), Expect = 7.3 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Query: 284 IFSPLAEAHIN-IDMIIQNVSEDGQYVDITFTTPSSSLEK 322 IF HI+ I QNV D Y+ I F TP S K Sbjct: 498 IFGIPVPFHISTIKNASQNVEGDYTYLRINFNTPGSPGGK 537 >gnl|CDD|153154 cd04882, ACT_Bt0572_2, C-terminal ACT domain of a novel protein composed of just two ACT domains. Included in this CD is the C-terminal ACT domain of a novel protein composed of just two ACT domains, as seen in the yet uncharacterized structure (pdb 2F06) of the Bt0572 protein from Bacteroides thetaiotaomicron and related proteins. Members of this CD belong to the superfamily of ACT regulatory domains. Length = 65 Score = 27.2 bits (61), Expect = 8.7 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 2/59 (3%) Query: 273 RLRDHPGISASIFSPLAEAHINIDMIIQNVSEDGQYVDITFTTPSSSLEKALAVLSDNK 331 + D PG I L+E INI+ + V + G + F T +EKA+ VL + Sbjct: 5 EVPDKPGGLHEILQILSEEGINIEYMYAFVEKKGGKALLIFRT--EDIEKAIEVLQERG 61 >gnl|CDD|58622 cd04256, AAK_P5CS_ProBA, AAK_P5CS_ProBA: Glutamate-5-kinase (G5K) domain of the bifunctional delta 1-pyrroline-5-carboxylate synthetase (P5CS), composed of an N-terminal G5K (ProB) and a C-terminal glutamyl 5- phosphate reductase (G5PR, ProA), the first and second enzyme catalyzing proline (and, in mammals, ornithine) biosynthesis. G5K transfers the terminal phosphoryl group of ATP to the gamma-carboxyl group of glutamate, and is subject to feedback allosteric inhibition by proline or ornithine. In plants, proline plays an important role as an osmoprotectant and, in mammals, ornithine biosynthesis is crucial for proper ammonia detoxification, since a G5K mutation has been shown to cause human hyperammonaemia.. Length = 284 Score = 27.2 bits (60), Expect = 9.4 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Query: 153 SDTSAVAIAAAIKADRCDIYTDVCGIYTTDPRIEPKAHLM 192 +D+ A +A +KAD + +DV G+Y P A L+ Sbjct: 180 NDSLAARLAVELKADLLILLSDVDGLYDGPPG-SDDAKLI 218 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.319 0.133 0.367 Gapped Lambda K H 0.267 0.0708 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 4,471,944 Number of extensions: 228458 Number of successful extensions: 748 Number of sequences better than 10.0: 1 Number of HSP's gapped: 703 Number of HSP's successfully gapped: 96 Length of query: 411 Length of database: 6,263,737 Length adjustment: 96 Effective length of query: 315 Effective length of database: 4,189,273 Effective search space: 1319620995 Effective search space used: 1319620995 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 59 (26.5 bits)