Query gi|254780876|ref|YP_003065289.1| hypothetical protein CLIBASIA_03865 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 210 No_of_seqs 148 out of 458 Neff 5.0 Searched_HMMs 39220 Date Mon May 30 03:15:23 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780876.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 pfam04053 Coatomer_WDAD Coatom 83.9 1.5 3.9E-05 22.6 3.8 37 52-88 340-376 (435) 2 PRK11189 lipoprotein NlpI; Pro 67.1 9 0.00023 17.8 4.5 41 45-85 231-280 (297) 3 KOG0276 consensus 59.4 12 0.00032 17.0 3.5 39 50-88 665-703 (794) 4 smart00770 Zn_dep_PLPC Zinc de 59.3 13 0.00032 17.0 5.0 41 45-85 108-148 (241) 5 pfam00882 Zn_dep_PLPC Zinc dep 53.6 16 0.0004 16.4 5.1 43 43-85 82-124 (223) 6 pfam10952 DUF2753 Protein of u 47.4 19 0.0005 15.8 3.0 26 52-77 2-27 (140) 7 pfam08590 DUF1771 Domain of un 39.8 26 0.00065 15.1 6.2 44 49-92 14-57 (66) 8 TIGR00824 EIIA-man PTS system, 37.0 27 0.0007 14.9 2.3 22 43-64 36-58 (117) 9 COG1849 Uncharacterized protei 36.5 29 0.00074 14.7 3.2 15 50-64 9-23 (90) 10 pfam04010 DUF357 Protein of un 35.3 30 0.00077 14.6 3.4 14 69-82 34-47 (75) 11 pfam10484 MRP-S23 Mitochondria 35.0 30 0.00078 14.6 2.4 31 41-71 31-61 (74) 12 TIGR00601 rad23 UV excision re 31.4 29 0.00073 14.8 1.7 53 33-90 304-361 (453) 13 TIGR02933 nifM_nitrog nitrogen 30.7 30 0.00078 14.6 1.7 29 54-82 102-130 (270) 14 pfam11986 PB1-F2 Influenza A P 29.4 38 0.00096 14.0 2.1 22 67-88 29-50 (90) 15 CHL00173 cpeA phycoerythrin al 29.1 30 0.00076 14.6 1.4 22 67-88 76-97 (164) 16 COG1592 Rubrerythrin [Energy p 28.5 39 0.001 13.9 5.5 41 47-87 16-63 (166) 17 KOG0704 consensus 27.2 20 0.00052 15.7 0.3 26 30-58 82-107 (386) 18 PTZ00043 cytochrome c oxidase 25.6 42 0.0011 13.7 1.7 44 34-84 63-112 (270) 19 pfam00502 Phycobilisome Phycob 21.4 51 0.0013 13.2 1.5 20 69-88 73-92 (157) 20 COG1613 Sbp ABC-type sulfate t 20.9 42 0.0011 13.7 1.0 11 65-75 270-280 (348) 21 pfam06798 PrkA PrkA serine pro 20.2 57 0.0014 13.0 2.1 38 21-60 37-74 (254) 22 TIGR02918 TIGR02918 conserved 20.1 14 0.00036 16.7 -1.6 37 45-81 458-496 (511) No 1 >pfam04053 Coatomer_WDAD Coatomer WD associated region. This region is composed of WD40 repeats. Probab=83.89 E-value=1.5 Score=22.55 Aligned_cols=37 Identities=22% Similarity=0.447 Sum_probs=33.4 Q ss_pred HHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 9999999998626873678888899999999999998 Q gi|254780876|r 52 ERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88 (210) Q Consensus 52 ~ky~~la~da~~~gd~~~~e~~~qha~hy~r~~~~~~ 88 (210) .||.+|+..|+..|+--+||..||.+..|-+++--.. T Consensus 340 ~~Wk~Lg~~AL~~g~~~lAe~~~~k~~d~~~LllLy~ 376 (435) T pfam04053 340 HKWKRLGDAALSQGNIKLAEEAYQKAKDFDKLLLLYL 376 (435) T ss_pred HHHHHHHHHHHHCCCHHHHHHHHHHHCCHHHHHHHHH T ss_conf 9999999999974995899999997425345599999 No 2 >PRK11189 lipoprotein NlpI; Provisional Probab=67.11 E-value=9 Score=17.84 Aligned_cols=41 Identities=29% Similarity=0.375 Sum_probs=34.2 Q ss_pred CCHHHHHHHHHHHHHHHHHCCCHHHHHHHHH---------HHHHHHHHHH Q ss_conf 8999999999999999862687367888889---------9999999999 Q gi|254780876|r 45 GTAQHIAERYSVLARDAMSAGDYVVAENHLQ---------HAEHYNRIVS 85 (210) Q Consensus 45 ~~~~~~~~ky~~la~da~~~gd~~~~e~~~q---------ha~hy~r~~~ 85 (210) --|++|.|-|.-|||-.+..||.-.|.+||- +.||=+-+|- T Consensus 231 ~lAErLcEaYFYLaK~~~~~G~~~~A~~~fKLAla~NVyeFVEhRYA~lE 280 (297) T PRK11189 231 ELAERLCETYFYLAKYYLSLGDLDEAANLFKLALANNVYNFVEHRYALLE 280 (297) T ss_pred HHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHH T ss_conf 99999999999999999987998999999999870482588899999999 No 3 >KOG0276 consensus Probab=59.36 E-value=12 Score=16.98 Aligned_cols=39 Identities=18% Similarity=0.293 Sum_probs=34.6 Q ss_pred HHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 999999999998626873678888899999999999998 Q gi|254780876|r 50 IAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88 (210) Q Consensus 50 ~~~ky~~la~da~~~gd~~~~e~~~qha~hy~r~~~~~~ 88 (210) -..||.+|+.-|+++|+-.||+-.|+||-.|--||.... T Consensus 665 s~~Kw~~Lg~~al~~~~l~lA~EC~~~a~d~~~LlLl~t 703 (794) T KOG0276 665 SEVKWRQLGDAALSAGELPLASECFLRARDLGSLLLLYT 703 (794) T ss_pred CHHHHHHHHHHHHHCCCCHHHHHHHHHHCCHHHHHHHHH T ss_conf 667799999998641663458999975304355542355 No 4 >smart00770 Zn_dep_PLPC Zinc dependent phospholipase C (alpha toxin). This domain conveys a zinc dependent phospholipase C activity (EC 3.1.4.3). It is found in a monomeric phospholipase C of Bacillus cereus as well as in the alpha toxin of Clostridium perfringens and Clostridium bifermentans, which is involved in haemolysis and cell rupture. It is also found in a lecithinase of Listeria monocytogenes, which is involved in breaking the 2-membrane vacuoles that surround the bacterium. Structure information: PDB 1ca1. Probab=59.25 E-value=13 Score=16.95 Aligned_cols=41 Identities=29% Similarity=0.294 Sum_probs=38.1 Q ss_pred CCHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHH Q ss_conf 89999999999999998626873678888899999999999 Q gi|254780876|r 45 GTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVS 85 (210) Q Consensus 45 ~~~~~~~~ky~~la~da~~~gd~~~~e~~~qha~hy~r~~~ 85 (210) -||.....||-.||....-.||.=.|=.||--|-||+-=|+ T Consensus 108 ~~A~~~~~ky~~~A~~~~~~g~~~kA~fyLG~a~Hy~~D~t 148 (241) T smart00770 108 SNAKDTGRKYFKLALNEWKKGNYKKAFFYLGRACHYLGDLS 148 (241) T ss_pred CCHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCC T ss_conf 63899999999999999984579999999878888862068 No 5 >pfam00882 Zn_dep_PLPC Zinc dependent phospholipase C. Probab=53.57 E-value=16 Score=16.38 Aligned_cols=43 Identities=28% Similarity=0.248 Sum_probs=38.8 Q ss_pred CCCCHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHH Q ss_conf 7889999999999999998626873678888899999999999 Q gi|254780876|r 43 VRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVS 85 (210) Q Consensus 43 ~~~~~~~~~~ky~~la~da~~~gd~~~~e~~~qha~hy~r~~~ 85 (210) ..-||.....||-.||....-.|+.-.|-.||--|-||+-=|. T Consensus 82 ~~~~A~~~~~ky~~~A~~~~~~g~~~ka~fyLG~a~Hy~~D~~ 124 (223) T pfam00882 82 IFPTAKTECRKYFALALNEWRKGNYKKAFFYLGAACHYFGDLN 124 (223) T ss_pred CCCCHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCC T ss_conf 9985899999999999999983679999999978989887448 No 6 >pfam10952 DUF2753 Protein of unknown function (DUF2753). This bacterial family of proteins has no known function. Probab=47.40 E-value=19 Score=15.78 Aligned_cols=26 Identities=38% Similarity=0.500 Sum_probs=22.5 Q ss_pred HHHHHHHHHHHHCCCHHHHHHHHHHH Q ss_conf 99999999986268736788888999 Q gi|254780876|r 52 ERYSVLARDAMSAGDYVVAENHLQHA 77 (210) Q Consensus 52 ~ky~~la~da~~~gd~~~~e~~~qha 77 (210) ||++-||-.|+..||.+.+--.||-| T Consensus 2 EkhtLlAd~A~~~~d~~~sIlhYQqA 27 (140) T pfam10952 2 ERHTLLADEALKNGDPLRSILHYQQA 27 (140) T ss_pred CHHHHHHHHHHHCCCHHHHHHHHHHH T ss_conf 32588888885457689999999999 No 7 >pfam08590 DUF1771 Domain of unknown function (DUF1771). This domain is always found adjacent to pfam01713. Probab=39.76 E-value=26 Score=15.06 Aligned_cols=44 Identities=16% Similarity=0.100 Sum_probs=36.9 Q ss_pred HHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99999999999986268736788888999999999999987754 Q gi|254780876|r 49 HIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQ 92 (210) Q Consensus 49 ~~~~ky~~la~da~~~gd~~~~e~~~qha~hy~r~~~~~~~~~~ 92 (210) .+-.+|.+.|..|...||.-.|-.|...+-.+...+-++..+.- T Consensus 14 ~~r~~~~~~A~~Ay~~Gd~~~A~~lS~~gk~~~~~~~~~n~~Aa 57 (66) T pfam08590 14 QKRNELFQKAAEAYKRGDKAAAKELSEEGKKHGEKAEEANRQAA 57 (66) T ss_pred HHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99999999999998828888899999998999999999979999 No 8 >TIGR00824 EIIA-man PTS system, mannose/fructose/sorbose family, IIA component; InterPro: IPR013789 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) , is a major carbohydrate transport system in bacteria. The PTS catalyses the phosphorylation of incoming sugar substrates and coupled with translocation across the cell membrane, makes the PTS a link between the uptake and metabolism of sugars. The general mechanism of the PTS is the following: a phosphoryl group from phosphoenolpyruvate (PEP) is transferred via a signal transduction pathway, to enzyme I (EI) which in turn transfers it to a phosphoryl carrier, the histidine protein (HPr). Phospho-HPr then transfers the phosphoryl group to a sugar-specific permease, a membrane-bound complex known as enzyme 2 (EII), which transports the sugar to the cell. EII consists of at least three structurally distinct domains IIA, IIB and IIC . These can either be fused together in a single polypeptide chain or exist as two or three interactive chains, formerly called enzymes II (EII) and III (EIII). The first domain (IIA or EIIA) carries the first permease-specific phosphorylation site, a histidine which is phosphorylated by phospho-HPr. The second domain (IIB or EIIB) is phosphorylated by phospho-IIA on a cysteinyl or histidyl residue, depending on the sugar transported. Finally, the phosphoryl group is transferred from the IIB domain to the sugar substrate concomitantly with the sugar uptake processed by the IIC domain. This third domain (IIC or EIIC) forms the translocation channel and the specific substrate-binding site. An additional transmembrane domain IID, homologous to IIC, can be found in some PTSs, e.g. for mannose , , , . The Man family is unique in several respects among PTS permease families. It is the only PTS family in which members possess a IID protein. It is the only PTS family in which the IIB constituent is phosphorylated on a histidyl rather than a cysteyl residue. Its permease members exhibit broad specificity for a range of sugars, rather than being specific for just one or a few sugars. The mannose permease of Escherichia coli, for example, can transport and phosphorylate glucose, mannose, fructose, glucosamine, N-acetylglucosamine, and other sugars. Other members of this can transport sorbose, fructose and N-acetylglucosamine. This family is specific for IIA and IIB components.. Probab=36.96 E-value=27 Score=14.88 Aligned_cols=22 Identities=23% Similarity=0.377 Sum_probs=17.8 Q ss_pred CCC-CHHHHHHHHHHHHHHHHHC Q ss_conf 788-9999999999999998626 Q gi|254780876|r 43 VRG-TAQHIAERYSVLARDAMSA 64 (210) Q Consensus 43 ~~~-~~~~~~~ky~~la~da~~~ 64 (210) ++| |+++|++||.++-.|+..- T Consensus 36 ~~GEn~~~L~~k~~~~l~d~~t~ 58 (117) T TIGR00824 36 VPGENIETLQEKYEKALSDLDTE 58 (117) T ss_pred CCCCCHHHHHHHHHHHHHHCCCC T ss_conf 69989889999999998402668 No 9 >COG1849 Uncharacterized protein conserved in archaea [Function unknown] Probab=36.47 E-value=29 Score=14.74 Aligned_cols=15 Identities=27% Similarity=0.417 Sum_probs=10.3 Q ss_pred HHHHHHHHHHHHHHC Q ss_conf 999999999998626 Q gi|254780876|r 50 IAERYSVLARDAMSA 64 (210) Q Consensus 50 ~~~ky~~la~da~~~ 64 (210) -++||..+..+|+.. T Consensus 9 kiekYi~~leeaL~~ 23 (90) T COG1849 9 KIEKYIELLEEALKE 23 (90) T ss_pred HHHHHHHHHHHHHHH T ss_conf 999999989999998 No 10 >pfam04010 DUF357 Protein of unknown function (DUF357). Members of this family are short (less than 100 amino acid) proteins found in archaebacteria. The function of these proteins is unknown. Probab=35.32 E-value=30 Score=14.63 Aligned_cols=14 Identities=29% Similarity=0.396 Sum_probs=7.7 Q ss_pred HHHHHHHHHHHHHH Q ss_conf 78888899999999 Q gi|254780876|r 69 VAENHLQHAEHYNR 82 (210) Q Consensus 69 ~~e~~~qha~hy~r 82 (210) |++.|+.-|.||+. T Consensus 34 ma~~Y~~Da~~fl~ 47 (75) T pfam04010 34 MAKSYLEDAKYYLE 47 (75) T ss_pred HHHHHHHHHHHHHH T ss_conf 99999999999988 No 11 >pfam10484 MRP-S23 Mitochondrial ribosomal protein S23. MRP-S23 is one of the proteins that makes up the 55S ribosome in eukaryotes from nematodes to humans. It does not appear to carry any common motifs, either RNA binding or ribosomal protein motifs. All of the mammalian MRPs are encoded in nuclear genes that are evolving more rapidly than those encoding cytoplasmic ribosomal proteins. The MRPs are imported into mitochondria where they assemble coordinately with mitochondrially transcribed rRNAs into ribosomes that are responsible for translating the 13 mRNAs for essential proteins of the oxidative phosphorylation system. MRP-S23 is significantly up-regulated in uterine cancer cells. Probab=34.96 E-value=30 Score=14.59 Aligned_cols=31 Identities=16% Similarity=0.284 Sum_probs=22.8 Q ss_pred CCCCCCHHHHHHHHHHHHHHHHHCCCHHHHH Q ss_conf 7778899999999999999986268736788 Q gi|254780876|r 41 VKVRGTAQHIAERYSVLARDAMSAGDYVVAE 71 (210) Q Consensus 41 ~k~~~~~~~~~~ky~~la~da~~~gd~~~~e 71 (210) -+.+-.-|+.++||.+|-....+..+.|-.| T Consensus 31 ~~~~S~~QqFvq~Y~eLks~g~ldee~lfee 61 (74) T pfam10484 31 MNNRTQTQQFVQKYQELKSQGALDEEELFEE 61 (74) T ss_pred CCCCCHHHHHHHHHHHHHHHCCCCHHHHHHH T ss_conf 5654188999999999987035568889999 No 12 >TIGR00601 rad23 UV excision repair protein Rad23; InterPro: IPR004806 All proteins in this family for which functions are known are components of a multiprotein complex used for targeting nucleotide excision repair to specific parts of the genome. Rad23 contains a ubiquitin-like domain that interacts with catalytically active proteasomes and two ubiquitin (Ub)-associated (UBA) sequences that bind Ub. Rad23 interacts with ubiquitinated cellular proteins through the synergistic action of its UBA domains. In humans, Rad23 complexes with the XPC protein.; GO: 0006289 nucleotide-excision repair, 0005634 nucleus. Probab=31.39 E-value=29 Score=14.77 Aligned_cols=53 Identities=11% Similarity=0.174 Sum_probs=38.3 Q ss_pred CCCCCCCCC-C----CCCCHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 554568777-7----788999999999999999862687367888889999999999999877 Q gi|254780876|r 33 NYDSNGYDV-K----VRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQ 90 (210) Q Consensus 33 ~~~~~~~~~-k----~~~~~~~~~~ky~~la~da~~~gd~~~~e~~~qha~hy~r~~~~~~~~ 90 (210) .|-.+-|.+ . |-+||+-|--=-.+ ++.+++=|.+--.+|-|||+-||+|.-.. T Consensus 304 efLR~~PqFq~lRq~vq~NP~~L~~lL~~-----iG~~nPQL~~~I~~h~E~F~qlL~Epv~~ 361 (453) T TIGR00601 304 EFLRNQPQFQQLRQVVQQNPQLLPPLLQQ-----IGQENPQLLQQISQHPEEFLQLLNEPVEE 361 (453) T ss_pred HHCCCCHHHHHHHHHHHCCHHHHHHHHHH-----HCCCCHHHHHHHHHCCHHHHHHHCCCCCH T ss_conf 21167365676727761266789999997-----34537379999652606788875047313 No 13 >TIGR02933 nifM_nitrog nitrogen fixation protein NifM; InterPro: IPR014282 Members of this entry are found in a subset of nitrogen-fixing bacteria and are annotated as nitrogen fixation protein NifM. NifM is homologous to peptidyl-prolyl cis-trans isomerases and appears to be an accessory protein for NifH, the Fe protein, also called component II or dinitrogenase reductase, of nitrogenase.. Probab=30.73 E-value=30 Score=14.60 Aligned_cols=29 Identities=28% Similarity=0.283 Sum_probs=19.3 Q ss_pred HHHHHHHHHHCCCHHHHHHHHHHHHHHHH Q ss_conf 99999998626873678888899999999 Q gi|254780876|r 54 YSVLARDAMSAGDYVVAENHLQHAEHYNR 82 (210) Q Consensus 54 y~~la~da~~~gd~~~~e~~~qha~hy~r 82 (210) ....+.-+---.|--..-.|+-||.||.| T Consensus 102 L~~v~~q~p~p~~a~V~~wY~~Ha~~F~r 130 (270) T TIGR02933 102 LASVAEQAPQPDDAEVEAWYRRHAEQFVR 130 (270) T ss_pred HHHHHCCCCCCCCHHHHHHHHHHHHHCCC T ss_conf 99997058999603588998886740577 No 14 >pfam11986 PB1-F2 Influenza A Proapoptotic protein. PB1-F2 is a protein found in almost all known strains of Influenza A virus - a negative sense ssRNA Orthomyxovirus. It originates from translation of the viral polymerase gene in an alternative reading frame. PB1-F2 consists of two independent structural domains, two closely neighboring short helices at the N terminus, and an extended C-terminal helix. Although the protein has originally been described to induce apoptosis, it has now been shown that PB1-F2 more likely acts as an apoptosis promoter in concert with other apoptosis-inducing agents. PB1-F2 promotes apoptosis by localising to the mitochondria where it destabilizes the membrane. This will cause release of cytochrome C which activates the caspase cascade of apoptosis through the endogenous pathway. In this way it acts like the Bcl-2 protein family which are physiological apoptotic regulators in cells. Probab=29.36 E-value=38 Score=14.02 Aligned_cols=22 Identities=27% Similarity=0.309 Sum_probs=15.9 Q ss_pred HHHHHHHHHHHHHHHHHHHHHH Q ss_conf 3678888899999999999998 Q gi|254780876|r 67 YVVAENHLQHAEHYNRIVSMAQ 88 (210) Q Consensus 67 ~~~~e~~~qha~hy~r~~~~~~ 88 (210) +.-.-|..|--|||+|+++-+- T Consensus 29 klehpnstqlmdhylr~m~q~~ 50 (90) T pfam11986 29 KLEHPNSTQLMDHYLRTMSQVD 50 (90) T ss_pred CCCCCCHHHHHHHHHHHHHHHC T ss_conf 4678648889999999987721 No 15 >CHL00173 cpeA phycoerythrin alpha subunit; Provisional Probab=29.05 E-value=30 Score=14.64 Aligned_cols=22 Identities=18% Similarity=0.335 Sum_probs=13.2 Q ss_pred HHHHHHHHHHHHHHHHHHHHHH Q ss_conf 3678888899999999999998 Q gi|254780876|r 67 YVVAENHLQHAEHYNRIVSMAQ 88 (210) Q Consensus 67 ~~~~e~~~qha~hy~r~~~~~~ 88 (210) .....-.+---+||+|++.=+- T Consensus 76 ~~r~aaClRD~~~yLR~iTY~l 97 (164) T CHL00173 76 QEKVNKCYRDVDHYMRLVNYCL 97 (164) T ss_pred HHHHHHHHHHHHHHHHHHHHHH T ss_conf 7889999999999999998974 No 16 >COG1592 Rubrerythrin [Energy production and conversion] Probab=28.45 E-value=39 Score=13.92 Aligned_cols=41 Identities=20% Similarity=0.198 Sum_probs=32.8 Q ss_pred HHHHHHHHHHHHHHHHHCCCHHHHHHH-------HHHHHHHHHHHHHH Q ss_conf 999999999999998626873678888-------89999999999999 Q gi|254780876|r 47 AQHIAERYSVLARDAMSAGDYVVAENH-------LQHAEHYNRIVSMA 87 (210) Q Consensus 47 ~~~~~~ky~~la~da~~~gd~~~~e~~-------~qha~hy~r~~~~~ 87 (210) -++-..+|+.+|+-|...|..=.++-| ..||...+++|... T Consensus 16 Es~a~~rY~~~A~~A~~eG~~~va~lfr~iA~~E~~HA~~~~~~l~~~ 63 (166) T COG1592 16 ESMAVMRYLIFAKVAEEEGYPEIARLFRAIAEAEAVHAKNHLKLLGKL 63 (166) T ss_pred HHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCC T ss_conf 099999999999999987788999999999999999999999996300 No 17 >KOG0704 consensus Probab=27.18 E-value=20 Score=15.67 Aligned_cols=26 Identities=27% Similarity=0.148 Sum_probs=11.5 Q ss_pred CCCCCCCCCCCCCCCCCHHHHHHHHHHHH Q ss_conf 65555456877777889999999999999 Q gi|254780876|r 30 LVRNYDSNGYDVKVRGTAQHIAERYSVLA 58 (210) Q Consensus 30 ~~~~~~~~~~~~k~~~~~~~~~~ky~~la 58 (210) .-+.|-+..++.+... -|++||+.+| T Consensus 82 ~~~eFL~s~~~~~e~~---~i~eKYns~a 107 (386) T KOG0704 82 RFREFLSSQGIYKETW---PIREKYNSRA 107 (386) T ss_pred HHHHHHHHCCCCCCCC---CHHHHHCCHH T ss_conf 6789986584502364---4887634488 No 18 >PTZ00043 cytochrome c oxidase subunit; Provisional Probab=25.58 E-value=42 Score=13.72 Aligned_cols=44 Identities=25% Similarity=0.389 Sum_probs=25.4 Q ss_pred CCCCCCCCCCCC-----CHHHHHHH-HHHHHHHHHHCCCHHHHHHHHHHHHHHHHHH Q ss_conf 545687777788-----99999999-9999999862687367888889999999999 Q gi|254780876|r 34 YDSNGYDVKVRG-----TAQHIAER-YSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84 (210) Q Consensus 34 ~~~~~~~~k~~~-----~~~~~~~k-y~~la~da~~~gd~~~~e~~~qha~hy~r~~ 84 (210) |..+----|||| ++++|..| |.+||+|--. -|..|- .+|.+-+| T Consensus 63 f~~~ywywrir~es~lld~e~lp~ksykqla~dmgm---qiv~e~----~ehm~gll 112 (270) T PTZ00043 63 YFGSYWYWRIRGESNLMDYEKLPKKSYKQLAVDLGM---QIVNEP----SEHMLGLL 112 (270) T ss_pred HHHHHHHHEECCCCCCCCHHHCCHHHHHHHHHHHCC---EECCCC----HHHHHHHH T ss_conf 665502202205111269566025679999997386---524795----59899999 No 19 >pfam00502 Phycobilisome Phycobilisome protein. Probab=21.41 E-value=51 Score=13.22 Aligned_cols=20 Identities=20% Similarity=0.315 Sum_probs=12.9 Q ss_pred HHHHHHHHHHHHHHHHHHHH Q ss_conf 78888899999999999998 Q gi|254780876|r 69 VAENHLQHAEHYNRIVSMAQ 88 (210) Q Consensus 69 ~~e~~~qha~hy~r~~~~~~ 88 (210) -.+-.+---+||+|++.=+- T Consensus 73 r~~~C~RD~~~~LR~itYai 92 (157) T pfam00502 73 RMAACLRDIDYYLRLITYAL 92 (157) T ss_pred HHHHHHHHHHHHHHHHHHHH T ss_conf 79998999999999999999 No 20 >COG1613 Sbp ABC-type sulfate transport system, periplasmic component [Inorganic ion transport and metabolism] Probab=20.94 E-value=42 Score=13.72 Aligned_cols=11 Identities=45% Similarity=0.471 Sum_probs=4.7 Q ss_pred CCHHHHHHHHH Q ss_conf 87367888889 Q gi|254780876|r 65 GDYVVAENHLQ 75 (210) Q Consensus 65 gd~~~~e~~~q 75 (210) |-|..||.|++ T Consensus 270 gtr~vAeAyl~ 280 (348) T COG1613 270 GTRKVAEAYLK 280 (348) T ss_pred CCHHHHHHHHH T ss_conf 56899999998 No 21 >pfam06798 PrkA PrkA serine protein kinase C-terminal domain. This is a family of PrkA bacterial and archaeal serine kinases approximately 630 residues long. This family corresponds to the C-terminal domain. Probab=20.24 E-value=57 Score=12.96 Aligned_cols=38 Identities=13% Similarity=-0.070 Sum_probs=14.4 Q ss_pred CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH Q ss_conf 8877777766555545687777788999999999999999 Q gi|254780876|r 21 SFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60 (210) Q Consensus 21 ~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~ky~~la~d 60 (210) .+-|...+.+...|.+.. ..+--||-.|+.-....-++ T Consensus 37 iS~Rfi~~~ls~a~~~~~--~~~~inp~~vl~~Le~~i~~ 74 (254) T pfam06798 37 ISPRFIGKALSNALVSDS--EERCINPLDVLEELEQGIKD 74 (254) T ss_pred CCHHHHHHHHHHHHHCCC--CCCCCCHHHHHHHHHHHHHC T ss_conf 678999999999984388--88857899999999999860 No 22 >TIGR02918 TIGR02918 conserved hypothetical protein TIGR02918; InterPro: IPR014267 Members of this entry are found only in Gram-positive bacteria of the Firmicutes lineage, including several species of Staphylococcus, Streptococcus, and Lactobacillus.. Probab=20.13 E-value=14 Score=16.65 Aligned_cols=37 Identities=14% Similarity=0.016 Sum_probs=16.4 Q ss_pred CCHHHHHHHHHHHHHHHH--HCCCHHHHHHHHHHHHHHH Q ss_conf 899999999999999986--2687367888889999999 Q gi|254780876|r 45 GTAQHIAERYSVLARDAM--SAGDYVVAENHLQHAEHYN 81 (210) Q Consensus 45 ~~~~~~~~ky~~la~da~--~~gd~~~~e~~~qha~hy~ 81 (210) ....+|.+++...=-.=. .++=.-+.+.=|+=|+.|+ T Consensus 458 ~~~~~I~~~lA~~Iv~~Fv~~~~~~~~~~~SY~IA~~Fl 496 (511) T TIGR02918 458 DDEDEIITALAEKIVEYFVNENDIDAFHEVSYQIAEGFL 496 (511) T ss_pred CCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHH T ss_conf 887899999999989861267860026563178886631 Done!