Query         gi|254780876|ref|YP_003065289.1| hypothetical protein CLIBASIA_03865 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 210
No_of_seqs    148 out of 458
Neff          5.0 
Searched_HMMs 33803
Date          Wed Jun  1 19:08:17 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780876.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >2wxu_A Phospholipase C; cytol  84.0     2.6 7.8E-05   20.7   6.0   44   42-85     89-132 (250)
  2 >3fnb_A Acylaminoacyl peptidas  78.9       4 0.00012   19.6   5.6   37   48-84     66-102 (132)
  3 >1xnf_A Lipoprotein NLPI; TPR,  78.2     4.2 0.00012   19.5   4.7   41   46-86     33-82  (98)
  4 >1ah7_A Phospholipase C; phosp  73.2     5.7 0.00017   18.6   5.7   41   45-85     84-124 (245)
  5 >2pm7_A Protein WEB1, protein   68.9     6.2 0.00018   18.4   3.7   31   46-76      3-33  (71)
  6 >2pmr_A Uncharacterized protei  35.8      25 0.00075   14.7   3.6   34   49-82      7-51  (87)
  7 >2oo2_A Hypothetical protein A  24.9      39  0.0012   13.5   4.0   33   50-82     10-47  (86)
  8 >1jbo_B C-phycocyanin beta cha  24.6      39  0.0012   13.5   1.7   24   66-89     42-65  (139)
  9 >1hz4_A MALT regulatory protei  22.4      44  0.0013   13.2   3.3   37   45-81     38-74  (78)
 10 >2vml_A Phycocyanin alpha chai  21.7      45  0.0013   13.1   1.9   22   68-89     42-63  (127)

No 1  
>>2wxu_A Phospholipase C; cytolysis, hydrolase, hemolysis, metal-binding, Ca and membrane binding, gangrene determinant, zinc, toxin, calcium; 1.80A {Clostridium perfringens} PDB: 2wxt_A 1qm6_A 1qmd_A 1ca1_A 1gyg_A 1kho_A (A:1-250)
Probab=83.96  E-value=2.6  Score=20.68  Aligned_cols=44  Identities=27%  Similarity=0.345  Sum_probs=39.6

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             77889999999999999998626873678888899999999999
Q gi|254780876|r   42 KVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVS   85 (210)
Q Consensus        42 k~~~~~~~~~~ky~~la~da~~~gd~~~~e~~~qha~hy~r~~~   85 (210)
                      ...++|...+.||..||+.+.-.|+.-.|=.||-.|-||+-=|.
T Consensus        89 ~~~~~A~~~~~~y~~~A~~~~~~g~~~~a~~~LG~a~HYi~Dl~  132 (250)
T 2wxu_A           89 SIPDTGESQIRKFSALARYEWQRGNYKQATFYLGEAMHYFGDID  132 (250)
T ss_dssp             CBCCCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHT
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             25405899999999999999983689999999878888750378


No 2  
>>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics, PSI-2, protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans UA159} (A:1-132)
Probab=78.93  E-value=4  Score=19.59  Aligned_cols=37  Identities=11%  Similarity=-0.076  Sum_probs=32.2

Q ss_pred             HHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999862687367888889999999999
Q gi|254780876|r   48 QHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV   84 (210)
Q Consensus        48 ~~~~~ky~~la~da~~~gd~~~~e~~~qha~hy~r~~   84 (210)
                      ..+.++|..+|..+...|+++.|-.+|-.|--|+|+-
T Consensus        66 ~~~A~~~~~~A~~a~~~G~~~sA~~~ylRAa~yyr~A  102 (132)
T 3fnb_A           66 NEHADYLEDEVERVKKVGYRDLISHLYFSACFSIRAA  102 (132)
T ss_dssp             HHHHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999989997899888999999999999998


No 3  
>>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomics, unkown function; 1.98A {Escherichia coli} (A:178-275)
Probab=78.16  E-value=4.2  Score=19.48  Aligned_cols=41  Identities=27%  Similarity=0.340  Sum_probs=34.0

Q ss_pred             CHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHH---------HHHHHHHHH
Q ss_conf             99999999999999986268736788888999---------999999999
Q gi|254780876|r   46 TAQHIAERYSVLARDAMSAGDYVVAENHLQHA---------EHYNRIVSM   86 (210)
Q Consensus        46 ~~~~~~~ky~~la~da~~~gd~~~~e~~~qha---------~hy~r~~~~   86 (210)
                      -+++|.|-|.-||+-+++.||.-.|.+||+-|         ||=+-++--
T Consensus        33 ~aerLcEayFYLgk~~l~~G~~~~A~~~fklala~nv~~fvEhryA~~EL   82 (98)
T 1xnf_A           33 LAEHLSETNFYLGKYYLSLGDLDSATALFKLAVANNVHNFVEHRYALLEL   82 (98)
T ss_dssp             HHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHTTCCTTCHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHH
T ss_conf             07021589999999999878999999999999982996799999999999


No 4  
>>1ah7_A Phospholipase C; phospholipid hydrolysis, hydrolase; 1.50A {Bacillus cereus} (A:)
Probab=73.18  E-value=5.7  Score=18.64  Aligned_cols=41  Identities=24%  Similarity=0.173  Sum_probs=38.1

Q ss_pred             CCHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             89999999999999998626873678888899999999999
Q gi|254780876|r   45 GTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVS   85 (210)
Q Consensus        45 ~~~~~~~~ky~~la~da~~~gd~~~~e~~~qha~hy~r~~~   85 (210)
                      .+|...+.||..+|+.+.-.|+.-.|-.||-.|=||+-=|.
T Consensus        84 ~~A~~~~~~~y~~a~~~~~~g~~~~a~f~LG~a~Hyi~Dl~  124 (245)
T 1ah7_A           84 KQAKETGAKYFKLAGESYKNKDMKQAFFYLGLSLHYLGDVN  124 (245)
T ss_dssp             CCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHT
T ss_pred             CCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             87066999999999999864899999999999999970378


No 5  
>>2pm7_A Protein WEB1, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm6_A (A:329-399)
Probab=68.87  E-value=6.2  Score=18.42  Aligned_cols=31  Identities=13%  Similarity=0.330  Sum_probs=26.7

Q ss_pred             CHHHHHHHHHHHHHHHHHCCCHHHHHHHHHH
Q ss_conf             9999999999999998626873678888899
Q gi|254780876|r   46 TAQHIAERYSVLARDAMSAGDYVVAENHLQH   76 (210)
Q Consensus        46 ~~~~~~~ky~~la~da~~~gd~~~~e~~~qh   76 (210)
                      |-+.||+||+..|-=+.+.|+--+|+.||+-
T Consensus         3 ~nE~L~~k~lEyanlva~~G~felA~k~L~l   33 (71)
T 2pm7_A            3 NNEQLIAKFLEFINLTTSTGNFELATEFLNS   33 (71)
T ss_dssp             CCHHHHHHHHHHHHHHHTTTCHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHHHCCCHHHHHHHHHH
T ss_conf             7689999999999999959999999999984


No 6  
>>2pmr_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein structure initiative; 1.32A {Methanothermobacterthermautotrophicus str} (A:)
Probab=35.83  E-value=25  Score=14.68  Aligned_cols=34  Identities=15%  Similarity=-0.044  Sum_probs=24.2

Q ss_pred             HHHHHHHHHHHHHHHCCCH-----------HHHHHHHHHHHHHHH
Q ss_conf             9999999999998626873-----------678888899999999
Q gi|254780876|r   49 HIAERYSVLARDAMSAGDY-----------VVAENHLQHAEHYNR   82 (210)
Q Consensus        49 ~~~~ky~~la~da~~~gd~-----------~~~e~~~qha~hy~r   82 (210)
                      .-++||..+-.+|+..=..           -+++.|+.-|.||+.
T Consensus         7 Ek~~kY~~~leeal~~~~~~~~~~~a~~~~~mA~~Y~~Da~~fl~   51 (87)
T 2pmr_A            7 ERIEKDLELLEKNLMEMKSIKLSDDEEAVVERALNYRDDSVYYLE   51 (87)
T ss_dssp             HHHHHHHHHHHHHHHHHTTSCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999722667885199999999999999999988


No 7  
>>2oo2_A Hypothetical protein AF_1782; structural genomics, unknown function, PSI-2, protein structure initiative; 1.80A {Archaeoglobus fulgidus dsm 4304} (A:)
Probab=24.86  E-value=39  Score=13.52  Aligned_cols=33  Identities=3%  Similarity=-0.052  Sum_probs=25.5

Q ss_pred             HHHHHHHHHHHHHHCCCH-----HHHHHHHHHHHHHHH
Q ss_conf             999999999998626873-----678888899999999
Q gi|254780876|r   50 IAERYSVLARDAMSAGDY-----VVAENHLQHAEHYNR   82 (210)
Q Consensus        50 ~~~ky~~la~da~~~gd~-----~~~e~~~qha~hy~r   82 (210)
                      -++||..+-.+|+..=..     -+++.|+.-|.||+.
T Consensus        10 k~~kY~~~leeal~~~~~a~d~~~mA~~Y~~Da~~fl~   47 (86)
T 2oo2_A           10 ETLKWLERIEERVKEIEGDEGFMRNIEAYISDSRYFLE   47 (86)
T ss_dssp             HHHHHHHHHHHHGGGEEECHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999998999998712159999999999999999998


No 8  
>>1jbo_B C-phycocyanin beta chain; photosynthesis; HET: CYC; 1.45A {Synechococcus elongatus} (B:34-172)
Probab=24.63  E-value=39  Score=13.55  Aligned_cols=24  Identities=21%  Similarity=0.047  Sum_probs=15.3

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             736788888999999999999987
Q gi|254780876|r   66 DYVVAENHLQHAEHYNRIVSMAQA   89 (210)
Q Consensus        66 d~~~~e~~~qha~hy~r~~~~~~~   89 (210)
                      ...-..-.+---+||+|++.=+-.
T Consensus        42 ~~~r~~~C~RD~~~yLR~itYaiv   65 (139)
T 1jbo_B           42 TNRRMAACLRDMEIILRYVTYAIL   65 (139)
T ss_dssp             SHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             077899889999999999999998


No 9  
>>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transcription activator; 1.45A {Escherichia coli} (A:131-208)
Probab=22.35  E-value=44  Score=13.22  Aligned_cols=37  Identities=19%  Similarity=0.202  Sum_probs=32.0

Q ss_pred             CCHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHH
Q ss_conf             8999999999999999862687367888889999999
Q gi|254780876|r   45 GTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYN   81 (210)
Q Consensus        45 ~~~~~~~~ky~~la~da~~~gd~~~~e~~~qha~hy~   81 (210)
                      .-+++.+.-|.-|||=++.-||--.|..|++..++.+
T Consensus        38 ~~~~~~Lqc~alLakislaRGdldna~~~l~~~~~Ll   74 (78)
T 1hz4_A           38 YQPQQQLQCLAMLIQCSLARGDLDNARSQLNRLENLL   74 (78)
T ss_dssp             SCGGGGHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHH
T ss_conf             4803899999999999885377888999999999987


No 10 
>>2vml_A Phycocyanin alpha chain; photosynthesis, light-harvesting, electron transport, transport, chromophore, bIle pigment, phycobilisome; HET: CYC; 2.40A {Gloeobacter violaceus} PDB: 2vjr_A* (A:36-162)
Probab=21.69  E-value=45  Score=13.14  Aligned_cols=22  Identities=14%  Similarity=0.270  Sum_probs=14.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             6788888999999999999987
Q gi|254780876|r   68 VVAENHLQHAEHYNRIVSMAQA   89 (210)
Q Consensus        68 ~~~e~~~qha~hy~r~~~~~~~   89 (210)
                      .-.+-.+---+||+|++.=+-.
T Consensus        42 ~r~~~C~RD~~~yLR~itYaiv   63 (127)
T 2vml_A           42 TNQAKCARDISHYLRFITYSLV   63 (127)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999999999999999


Done!