Query         gi|254780876|ref|YP_003065289.1| hypothetical protein CLIBASIA_03865 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 210
No_of_seqs    148 out of 458
Neff          5.0 
Searched_HMMs 13730
Date          Wed Jun  1 10:32:41 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780876.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d1ca1a1 a.124.1.1 (A:1-249) Al  84.8    0.99 7.2E-05   20.9   6.1   44   42-85     89-132 (249)
  2 d2jbwa1 c.69.1.41 (A:8-367) 2,  81.0     1.4  0.0001   20.0   5.6   39   46-84     37-75  (360)
  3 d1olpa1 a.124.1.1 (A:1-249) Al  80.8     1.4  0.0001   20.0   5.6   43   43-85     90-132 (249)
  4 d2pmra1 a.8.11.1 (A:3-77) Unch  70.8     1.9 0.00014   19.2   3.4   34   49-82      3-47  (75)
  5 d2oo2a1 a.8.11.1 (A:1-75) Hypo  53.6     5.4  0.0004   16.4   3.5   34   49-82      7-45  (75)
  6 d1b0na1 a.34.1.1 (A:74-108) Si  21.1      19  0.0014   13.1   2.1   20   52-73      3-22  (35)
  7 d1b8da_ a.1.1.3 (A:) Phycoeryt  17.1      23  0.0017   12.5   1.8   26   66-91     75-100 (164)
  8 d3dbya2 a.29.13.1 (A:126-260)   15.6      25  0.0019   12.3   3.8   27   63-89    100-126 (135)
  9 d1a77a1 a.60.7.1 (A:209-316) F  13.2      28  0.0021   12.0   0.8   27   46-85     29-55  (108)
 10 d1jbob_ a.1.1.3 (B:) Phycocyan  11.7      33  0.0024   11.6   1.7   23   67-89     76-98  (172)

No 1  
>d1ca1a1 a.124.1.1 (A:1-249) Alpha-toxin, N-terminal domain {Clostridium perfringens, different strains [TaxId: 1502]}
Probab=84.76  E-value=0.99  Score=20.90  Aligned_cols=44  Identities=27%  Similarity=0.345  Sum_probs=39.5

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             77889999999999999998626873678888899999999999
Q gi|254780876|r   42 KVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVS   85 (210)
Q Consensus        42 k~~~~~~~~~~ky~~la~da~~~gd~~~~e~~~qha~hy~r~~~   85 (210)
                      .+..++...+.||..||.+..-.|+.-.|=.||-+|-||+-=|.
T Consensus        89 ~~~~~a~~~~~ky~~~A~~~~~~~~~~~a~~~LG~a~Hy~~D~~  132 (249)
T d1ca1a1          89 SIPDTGESQIRKFSALARYEWQRGNYKQATFYLGEAMHYFGDID  132 (249)
T ss_dssp             CCCCCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHT
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCC
T ss_conf             46604999999999999999975669999999878999873278


No 2  
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]}
Probab=80.96  E-value=1.4  Score=19.99  Aligned_cols=39  Identities=18%  Similarity=0.140  Sum_probs=34.4

Q ss_pred             CHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999862687367888889999999999
Q gi|254780876|r   46 TAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV   84 (210)
Q Consensus        46 ~~~~~~~ky~~la~da~~~gd~~~~e~~~qha~hy~r~~   84 (210)
                      .-..+.++|..+|..|...|+.+.|-.+|..|--|+|+-
T Consensus        37 ~w~~~a~~~~~~a~~~~~~g~~~~A~~~~~~A~~~~~~a   75 (360)
T d2jbwa1          37 YWMSLANEYEQEAERKVALGHDLSAGELLMSAALCAQYA   75 (360)
T ss_dssp             HHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999997699878999999999999973


No 3  
>d1olpa1 a.124.1.1 (A:1-249) Alpha-toxin, N-terminal domain {Clostridium absonum [TaxId: 29369]}
Probab=80.79  E-value=1.4  Score=19.95  Aligned_cols=43  Identities=23%  Similarity=0.360  Sum_probs=38.9

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             7889999999999999998626873678888899999999999
Q gi|254780876|r   43 VRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVS   85 (210)
Q Consensus        43 ~~~~~~~~~~ky~~la~da~~~gd~~~~e~~~qha~hy~r~~~   85 (210)
                      +..||.....||-.||.++.-.|+.-.|=.||-.|-||+-=|.
T Consensus        90 ~~~~A~~~~~ky~~~A~~~~~~g~~~~a~~~LG~a~Hy~~D~~  132 (249)
T d1olpa1          90 VPDNAESQTRKFATLAKNEWDKGNYEKAAWYLGQGMHYFGDLN  132 (249)
T ss_dssp             CSCCHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHHHHHT
T ss_pred             CCCCHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCC
T ss_conf             7752899999999999999983689999999876757762378


No 4  
>d2pmra1 a.8.11.1 (A:3-77) Uncharacterized protein MTH1690 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
Probab=70.78  E-value=1.9  Score=19.21  Aligned_cols=34  Identities=15%  Similarity=0.004  Sum_probs=25.0

Q ss_pred             HHHHHHHHHHHHHHHCCCHH-----------HHHHHHHHHHHHHH
Q ss_conf             99999999999986268736-----------78888899999999
Q gi|254780876|r   49 HIAERYSVLARDAMSAGDYV-----------VAENHLQHAEHYNR   82 (210)
Q Consensus        49 ~~~~ky~~la~da~~~gd~~-----------~~e~~~qha~hy~r   82 (210)
                      .-++||..+-++|+..-.++           +++.|+.-|.||+-
T Consensus         3 ErvekYi~~~eeAl~k~~~~~~~~~~e~il~ma~~Y~~Da~~f~~   47 (75)
T d2pmra1           3 ERIEKDLELLEKNLMEMKSIKLSDDEEAVVERALNYRDDSVYYLE   47 (75)
T ss_dssp             HHHHHHHHHHHHHHHHHTTSCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             889999999999998633034574089999999999999999988


No 5  
>d2oo2a1 a.8.11.1 (A:1-75) Hypothetical protein AF1782 {Archaeoglobus fulgidus [TaxId: 2234]}
Probab=53.62  E-value=5.4  Score=16.38  Aligned_cols=34  Identities=3%  Similarity=-0.044  Sum_probs=24.8

Q ss_pred             HHHHHHHHHHHHHHHCCCH-----HHHHHHHHHHHHHHH
Q ss_conf             9999999999998626873-----678888899999999
Q gi|254780876|r   49 HIAERYSVLARDAMSAGDY-----VVAENHLQHAEHYNR   82 (210)
Q Consensus        49 ~~~~ky~~la~da~~~gd~-----~~~e~~~qha~hy~r   82 (210)
                      .-++||.....+|+..--.     -+++.|+.-|.||+.
T Consensus         7 eriekYi~~~eeaL~~i~~~e~~l~ma~~Y~~Da~~fl~   45 (75)
T d2oo2a1           7 RETLKWLERIEERVKEIEGDEGFMRNIEAYISDSRYFLE   45 (75)
T ss_dssp             HHHHHHHHHHHHHGGGEEECHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999998999998720179999999999998999988


No 6  
>d1b0na1 a.34.1.1 (A:74-108) SinR repressor dimerisation domain {Bacillus subtilis [TaxId: 1423]}
Probab=21.07  E-value=19  Score=13.06  Aligned_cols=20  Identities=35%  Similarity=0.607  Sum_probs=14.7

Q ss_pred             HHHHHHHHHHHHCCCHHHHHHH
Q ss_conf             9999999998626873678888
Q gi|254780876|r   52 ERYSVLARDAMSAGDYVVAENH   73 (210)
Q Consensus        52 ~ky~~la~da~~~gd~~~~e~~   73 (210)
                      +.+.+|-+||+.||  |.-|-|
T Consensus         3 seW~~lVkeAM~SG--vSK~QF   22 (35)
T d1b0na1           3 SEWEKLVRDAMTSG--VSKKQF   22 (35)
T ss_dssp             HHHHHHHHHHHHSC--CCHHHH
T ss_pred             HHHHHHHHHHHHCC--CCHHHH
T ss_conf             78999999999846--779999


No 7  
>d1b8da_ a.1.1.3 (A:) Phycoerythrin alpha subunit {Red alga (Griffithsia monilis) [TaxId: 42003]}
Probab=17.08  E-value=23  Score=12.52  Aligned_cols=26  Identities=12%  Similarity=0.178  Sum_probs=17.3

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             73678888899999999999998775
Q gi|254780876|r   66 DYVVAENHLQHAEHYNRIVSMAQAQI   91 (210)
Q Consensus        66 d~~~~e~~~qha~hy~r~~~~~~~~~   91 (210)
                      ...-.+-.+---+||+|++.-+-..-
T Consensus        75 ~~~r~~~C~RD~~~~LR~itYai~aG  100 (164)
T d1b8da_          75 SPEKINKCYRDIDHYMRLINYSLVVG  100 (164)
T ss_dssp             SHHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             58998889999999999999999947


No 8  
>d3dbya2 a.29.13.1 (A:126-260) Uncharacterized protein BCE_G9241_0798 {Bacillus cereus [TaxId: 1396]}
Probab=15.60  E-value=25  Score=12.29  Aligned_cols=27  Identities=11%  Similarity=0.009  Sum_probs=19.9

Q ss_pred             HCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             268736788888999999999999987
Q gi|254780876|r   63 SAGDYVVAENHLQHAEHYNRIVSMAQA   89 (210)
Q Consensus        63 ~~gd~~~~e~~~qha~hy~r~~~~~~~   89 (210)
                      +.--+.++.--+--|+||+|+|...+.
T Consensus       100 s~~~PLl~dH~~REa~~Yl~~L~~l~~  126 (135)
T d3dbya2         100 SVLSARMADHMAREECYYLLKLAQSSG  126 (135)
T ss_dssp             BSCCHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             136704899999999999999999708


No 9  
>d1a77a1 a.60.7.1 (A:209-316) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Methanococcus jannaschii [TaxId: 2190]}
Probab=13.20  E-value=28  Score=12.02  Aligned_cols=27  Identities=15%  Similarity=0.118  Sum_probs=20.2

Q ss_pred             CHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999998626873678888899999999999
Q gi|254780876|r   46 TAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVS   85 (210)
Q Consensus        46 ~~~~~~~ky~~la~da~~~gd~~~~e~~~qha~hy~r~~~   85 (210)
                      ||-++|.+|-.|             |+.+.|++.|-.+..
T Consensus        29 tA~klIk~~g~i-------------e~l~~~~~~~~~~~~   55 (108)
T d1a77a1          29 RAYELVRSGVAK-------------DVLKKEVEYYDEIKR   55 (108)
T ss_dssp             HHHHHHHTTCHH-------------HHHHHHCTTHHHHHH
T ss_pred             HHHHHHHHCCCH-------------HHHHHHHHHHHHHHH
T ss_conf             999999983889-------------999871024699999


No 10 
>d1jbob_ a.1.1.3 (B:) Phycocyanin beta subunit {Synechococcus elongatus [TaxId: 32046]}
Probab=11.69  E-value=33  Score=11.60  Aligned_cols=23  Identities=22%  Similarity=0.049  Sum_probs=12.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             36788888999999999999987
Q gi|254780876|r   67 YVVAENHLQHAEHYNRIVSMAQA   89 (210)
Q Consensus        67 ~~~~e~~~qha~hy~r~~~~~~~   89 (210)
                      ..-.+-.+---+||+|++.=+-.
T Consensus        76 ~~r~~aC~RD~~~~LR~itYai~   98 (172)
T d1jbob_          76 NRRMAACLRDMEIILRYVTYAIL   98 (172)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             88999889999999999999999


Done!