BLAST/PSIBLAST alignment of GI: 254780876 and GI: 150397698 at iteration 1
>gi|150397698|ref|YP_001328165.1| hypothetical protein Smed_2500 [Sinorhizobium medicae WSM419] Length = 219
>gi|150029213|gb|ABR61330.1| conserved hypothetical protein [Sinorhizobium medicae WSM419] Length = 219
 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 53/83 (63%), Positives = 69/83 (83%)

Query: 29  PLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
           PL R YDS+G DVK+RGTAQHIAE+Y+ LARDA S+GD V+AEN+LQHAEHYNRI++ AQ
Sbjct: 31  PLTRTYDSSGPDVKIRGTAQHIAEKYAALARDAQSSGDRVIAENYLQHAEHYNRIIAAAQ 90

Query: 89  AQIQEKLQRDEQDDLLVKEQKER 111
           AQ+Q++ QRDE+ D   ++  +R
Sbjct: 91  AQMQDRFQRDERQDYQDRDSGDR 113