BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780876|ref|YP_003065289.1| hypothetical protein
CLIBASIA_03865 [Candidatus Liberibacter asiaticus str. psy62]
         (210 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780876|ref|YP_003065289.1| hypothetical protein CLIBASIA_03865 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040553|gb|ACT57349.1| hypothetical protein CLIBASIA_03865 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 210

 Score =  432 bits (1112), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 210/210 (100%), Positives = 210/210 (100%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD
Sbjct: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
           AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE
Sbjct: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120

Query: 121 ASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKS 180
           ASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKS
Sbjct: 121 ASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKS 180

Query: 181 GNQPVEATETIVPQELNSDNASSVDQDCKV 210
           GNQPVEATETIVPQELNSDNASSVDQDCKV
Sbjct: 181 GNQPVEATETIVPQELNSDNASSVDQDCKV 210


>gi|315122702|ref|YP_004063191.1| hypothetical protein CKC_04770 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496104|gb|ADR52703.1| hypothetical protein CKC_04770 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 208

 Score =  225 bits (573), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 160/210 (76%), Gaps = 2/210 (0%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MRS QQYKRSRGRGS+G NG+F RKNLNPLVRNYDSNGYDVKVRGTAQHIAERYS LARD
Sbjct: 1   MRSGQQYKRSRGRGSSGSNGNFGRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSALARD 60

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
           A+SAGDYVVAENH QHAEHYNRIVS+AQAQIQEKLQRDEQ++LL KE +   QNA S FE
Sbjct: 61  AISAGDYVVAENHFQHAEHYNRIVSIAQAQIQEKLQRDEQENLLSKESRGHVQNAPSGFE 120

Query: 121 ASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKS 180
            +    I+E KEP+F + IQP V D  FK P+ S EK    KKV RRR +RPRVF N K 
Sbjct: 121 DNST--IKEQKEPLFSSDIQPAVGDEVFKAPEPSLEKKAPNKKVYRRRVVRPRVFHNNKI 178

Query: 181 GNQPVEATETIVPQELNSDNASSVDQDCKV 210
            N+P E T T V  +    N+ +VD+D  +
Sbjct: 179 NNKPAEETTTSVLLQSQEVNSETVDKDFTL 208


>gi|261220923|ref|ZP_05935204.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|260919507|gb|EEX86160.1| conserved hypothetical protein [Brucella ceti B1/94]
          Length = 155

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 89/138 (64%), Gaps = 8/138 (5%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR  QQ +R RGRG+N      NRK  NPL RNY+SNG DVK+RG AQHIAE+YS LARD
Sbjct: 3   MRPAQQNRRMRGRGNNN-----NRKGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARD 57

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
           A ++GD V+AEN+LQHAEHYNRI+  A AQ     QR+E  D    + +E         E
Sbjct: 58  AQASGDRVMAENYLQHAEHYNRIIMAAMAQQNIPYQREENFDSDGGDDEEA---GFIPAE 114

Query: 121 ASPCPLIEEGKEPIFENS 138
           A+P P+   G +P+ E +
Sbjct: 115 AAPQPVNGSGPQPVIEGT 132


>gi|195970144|ref|NP_386715.2| hypothetical protein SMc02434 [Sinorhizobium meliloti 1021]
 gi|307313051|ref|ZP_07592678.1| conserved hypothetical protein [Sinorhizobium meliloti BL225C]
 gi|307321058|ref|ZP_07600464.1| conserved hypothetical protein [Sinorhizobium meliloti AK83]
 gi|187904205|emb|CAC47188.2| Hypothetical protein SMc02434 [Sinorhizobium meliloti 1021]
 gi|306893333|gb|EFN24113.1| conserved hypothetical protein [Sinorhizobium meliloti AK83]
 gi|306899370|gb|EFN30004.1| conserved hypothetical protein [Sinorhizobium meliloti BL225C]
          Length = 214

 Score =  120 bits (302), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 73/90 (81%)

Query: 29  PLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
           PL R YDS+G DVK+RGTAQHIAE+Y+ LARDA S+GD V+AEN+LQHAEHYNRI++ AQ
Sbjct: 31  PLTRTYDSSGPDVKIRGTAQHIAEKYAALARDAQSSGDRVIAENYLQHAEHYNRIIAAAQ 90

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNALSE 118
           AQ+Q++ QRDE+ D   ++  +R Q+ L +
Sbjct: 91  AQMQDRFQRDERQDYQDRDSADRDQDDLDQ 120


>gi|256253791|ref|ZP_05459327.1| hypothetical protein BcetB_05767 [Brucella ceti B1/94]
          Length = 144

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 66/128 (51%), Positives = 83/128 (64%), Gaps = 8/128 (6%)

Query: 11  RGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVA 70
           RGRG+N      NRK  NPL RNY+SNG DVK+RG AQHIAE+YS LARDA ++GD V+A
Sbjct: 2   RGRGNNN-----NRKGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARDAQASGDRVMA 56

Query: 71  ENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEG 130
           EN+LQHAEHYNRI+  A AQ     QR+E  D    + +E         EA+P P+   G
Sbjct: 57  ENYLQHAEHYNRIIMAAMAQQNIPYQREENFDSDGGDDEEA---GFIPAEAAPQPVNGSG 113

Query: 131 KEPIFENS 138
            +P+ E +
Sbjct: 114 PQPVIEGT 121


>gi|332716894|ref|YP_004444360.1| hypothetical protein AGROH133_13062 [Agrobacterium sp. H13-3]
 gi|325063579|gb|ADY67269.1| hypothetical protein AGROH133_13062 [Agrobacterium sp. H13-3]
          Length = 268

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 63/71 (88%)

Query: 29  PLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
           PL R YDS+G DVK+RGTAQHIAE+Y+ LARDA SAGD V+AEN+LQHAEHYNRI++ AQ
Sbjct: 36  PLTRTYDSSGPDVKIRGTAQHIAEKYATLARDAQSAGDRVIAENYLQHAEHYNRIIATAQ 95

Query: 89  AQIQEKLQRDE 99
           AQ+QE+ QRD+
Sbjct: 96  AQMQERFQRDD 106


>gi|222087301|ref|YP_002545838.1| hypothetical protein Arad_4126 [Agrobacterium radiobacter K84]
 gi|221724749|gb|ACM27905.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 234

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 53/72 (73%), Positives = 64/72 (88%)

Query: 28  NPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMA 87
           NPL R YDS+G DVK+RGTAQHIAE+Y+ LARDA S+GD V+AEN+LQHAEHYNRI++ A
Sbjct: 36  NPLTRTYDSSGPDVKIRGTAQHIAEKYATLARDAQSSGDRVMAENYLQHAEHYNRIIASA 95

Query: 88  QAQIQEKLQRDE 99
           QAQ+QE+ QRDE
Sbjct: 96  QAQMQERFQRDE 107


>gi|227823186|ref|YP_002827158.1| hypothetical protein NGR_c26550 [Sinorhizobium fredii NGR234]
 gi|227342187|gb|ACP26405.1| hypothetical protein NGR_c26550 [Sinorhizobium fredii NGR234]
          Length = 212

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 53/75 (70%), Positives = 66/75 (88%)

Query: 28  NPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMA 87
           NPL R YDS+G DVK+RGTAQHIAE+YS LARDA S+GD V+AEN+LQHAEHYNRI++ A
Sbjct: 30  NPLTRTYDSSGPDVKIRGTAQHIAEKYSALARDAQSSGDRVIAENYLQHAEHYNRIIAAA 89

Query: 88  QAQIQEKLQRDEQDD 102
           QAQ+Q++ QR+E+ D
Sbjct: 90  QAQMQDRFQREERQD 104


>gi|150397698|ref|YP_001328165.1| hypothetical protein Smed_2500 [Sinorhizobium medicae WSM419]
 gi|150029213|gb|ABR61330.1| conserved hypothetical protein [Sinorhizobium medicae WSM419]
          Length = 219

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 53/83 (63%), Positives = 69/83 (83%)

Query: 29  PLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
           PL R YDS+G DVK+RGTAQHIAE+Y+ LARDA S+GD V+AEN+LQHAEHYNRI++ AQ
Sbjct: 31  PLTRTYDSSGPDVKIRGTAQHIAEKYAALARDAQSSGDRVIAENYLQHAEHYNRIIAAAQ 90

Query: 89  AQIQEKLQRDEQDDLLVKEQKER 111
           AQ+Q++ QRDE+ D   ++  +R
Sbjct: 91  AQMQDRFQRDERQDYQDRDSGDR 113


>gi|90420191|ref|ZP_01228099.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335525|gb|EAS49275.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 366

 Score =  117 bits (293), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 62/93 (66%), Positives = 68/93 (73%), Gaps = 10/93 (10%)

Query: 1   MRSVQQYK-RSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLAR 59
           MR  QQ K R RGRG         RK  NPL R Y+SNG DVK+RGTAQHIAE+YS LAR
Sbjct: 23  MRPGQQQKNRMRGRG---------RKGPNPLSRGYESNGPDVKIRGTAQHIAEKYSTLAR 73

Query: 60  DAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQ 92
           DA  AGD V+AEN+LQHAEHYNRIV+ AQAQ Q
Sbjct: 74  DASGAGDRVMAENYLQHAEHYNRIVAAAQAQFQ 106


>gi|86359338|ref|YP_471230.1| hypothetical protein RHE_CH03754 [Rhizobium etli CFN 42]
 gi|86283440|gb|ABC92503.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 242

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 65/75 (86%)

Query: 29  PLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
           PL R YDS+G DVK+RGTAQHIAE+Y+ LARDA S+GD V+AEN+LQHAEHYNRI++ AQ
Sbjct: 37  PLTRTYDSSGPDVKIRGTAQHIAEKYAQLARDAQSSGDRVIAENYLQHAEHYNRIIASAQ 96

Query: 89  AQIQEKLQRDEQDDL 103
           AQ+QE+ QRD++ D 
Sbjct: 97  AQMQERFQRDDRSDF 111


>gi|159186053|ref|NP_356473.2| hypothetical protein Atu4176 [Agrobacterium tumefaciens str. C58]
 gi|159141187|gb|AAK89258.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 261

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 51/71 (71%), Positives = 63/71 (88%)

Query: 29  PLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
           PL R YDS+G DVK+RGTAQHIAE+Y+ LARDA S+GD V+AEN+LQHAEHYNRI++ AQ
Sbjct: 35  PLTRTYDSSGPDVKIRGTAQHIAEKYTALARDAQSSGDRVIAENYLQHAEHYNRIIASAQ 94

Query: 89  AQIQEKLQRDE 99
           AQ+QE+ QRD+
Sbjct: 95  AQMQERFQRDD 105


>gi|163759875|ref|ZP_02166959.1| hypothetical protein HPDFL43_16631 [Hoeflea phototrophica DFL-43]
 gi|162282833|gb|EDQ33120.1| hypothetical protein HPDFL43_16631 [Hoeflea phototrophica DFL-43]
          Length = 232

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 63/72 (87%)

Query: 28 NPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMA 87
          NPL R YDS+G DVKVRGTAQH+AE+Y  LARDA S+GD V+AEN+LQHAEHYNRI+  A
Sbjct: 26 NPLSRTYDSSGPDVKVRGTAQHVAEKYMNLARDAQSSGDRVMAENYLQHAEHYNRIIMTA 85

Query: 88 QAQIQEKLQRDE 99
          QAQ+QE++QRD+
Sbjct: 86 QAQLQERMQRDD 97


>gi|116254017|ref|YP_769855.1| hypothetical protein RL4280 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115258665|emb|CAK09769.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 255

 Score =  115 bits (287), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 51/71 (71%), Positives = 63/71 (88%)

Query: 29  PLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
           PL R YDS+G DVK+RGTAQHIAE+Y+ LARDA S+GD V+AEN+LQHAEHYNRI++ AQ
Sbjct: 39  PLTRTYDSSGPDVKIRGTAQHIAEKYAQLARDAQSSGDRVIAENYLQHAEHYNRIIASAQ 98

Query: 89  AQIQEKLQRDE 99
           AQ+QE+ QRD+
Sbjct: 99  AQMQERFQRDD 109


>gi|241206500|ref|YP_002977596.1| hypothetical protein Rleg_3814 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860390|gb|ACS58057.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 252

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 51/71 (71%), Positives = 63/71 (88%)

Query: 29  PLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
           PL R YDS+G DVK+RGTAQHIAE+Y+ LARDA S+GD V+AEN+LQHAEHYNRI++ AQ
Sbjct: 36  PLTRTYDSSGPDVKIRGTAQHIAEKYAQLARDAQSSGDRVIAENYLQHAEHYNRIIASAQ 95

Query: 89  AQIQEKLQRDE 99
           AQ+QE+ QRD+
Sbjct: 96  AQMQERFQRDD 106


>gi|209551098|ref|YP_002283015.1| hypothetical protein Rleg2_3522 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536854|gb|ACI56789.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 244

 Score =  114 bits (285), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 51/71 (71%), Positives = 63/71 (88%)

Query: 29  PLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
           PL R YDS+G DVK+RGTAQHIAE+Y+ LARDA S+GD V+AEN+LQHAEHYNRI++ AQ
Sbjct: 38  PLTRTYDSSGPDVKIRGTAQHIAEKYAQLARDAQSSGDRVIAENYLQHAEHYNRIIASAQ 97

Query: 89  AQIQEKLQRDE 99
           AQ+QE+ QRD+
Sbjct: 98  AQMQERFQRDD 108


>gi|327193410|gb|EGE60310.1| hypothetical protein RHECNPAF_1600042 [Rhizobium etli CNPAF512]
          Length = 236

 Score =  114 bits (285), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 51/71 (71%), Positives = 63/71 (88%)

Query: 29  PLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
           PL R YDS+G DVK+RGTAQHIAE+Y+ LARDA S+GD V+AEN+LQHAEHYNRI++ AQ
Sbjct: 37  PLTRTYDSSGPDVKIRGTAQHIAEKYAQLARDAQSSGDRVMAENYLQHAEHYNRIIASAQ 96

Query: 89  AQIQEKLQRDE 99
           AQ+QE+ QRD+
Sbjct: 97  AQMQERFQRDD 107


>gi|190893589|ref|YP_001980131.1| hypothetical protein RHECIAT_CH0004022 [Rhizobium etli CIAT 652]
 gi|190698868|gb|ACE92953.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 236

 Score =  114 bits (285), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 51/71 (71%), Positives = 63/71 (88%)

Query: 29  PLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
           PL R YDS+G DVK+RGTAQHIAE+Y+ LARDA S+GD V+AEN+LQHAEHYNRI++ AQ
Sbjct: 37  PLTRTYDSSGPDVKIRGTAQHIAEKYAQLARDAQSSGDRVMAENYLQHAEHYNRIIASAQ 96

Query: 89  AQIQEKLQRDE 99
           AQ+QE+ QRD+
Sbjct: 97  AQMQERFQRDD 107


>gi|218507329|ref|ZP_03505207.1| hypothetical protein RetlB5_06790 [Rhizobium etli Brasil 5]
          Length = 236

 Score =  114 bits (285), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 51/71 (71%), Positives = 63/71 (88%)

Query: 29  PLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
           PL R YDS+G DVK+RGTAQHIAE+Y+ LARDA S+GD V+AEN+LQHAEHYNRI++ AQ
Sbjct: 37  PLTRTYDSSGPDVKIRGTAQHIAEKYAQLARDAQSSGDRVMAENYLQHAEHYNRIIASAQ 96

Query: 89  AQIQEKLQRDE 99
           AQ+QE+ QRD+
Sbjct: 97  AQMQERFQRDD 107


>gi|148559868|ref|YP_001259695.1| hypothetical protein BOV_1798 [Brucella ovis ATCC 25840]
 gi|148371125|gb|ABQ61104.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
          Length = 261

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 59/114 (51%), Positives = 75/114 (65%), Gaps = 3/114 (2%)

Query: 25  KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
           K  NPL RNY+SNG DVK+RG AQHIAE+YS LARDA ++GD V+AEN+LQHAEHYNRI+
Sbjct: 23  KGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARDAQASGDRVMAENYLQHAEHYNRII 82

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENS 138
             A AQ     QR+E  D    + +E         EA+P P+   G +P+ E +
Sbjct: 83  MAAMAQQNIPYQREENFDSDGGDDEE---AGFIPAEAAPQPVNGSGPQPVIEGT 133


>gi|306842978|ref|ZP_07475612.1| cytoplasmic protein [Brucella sp. BO2]
 gi|306286906|gb|EFM58431.1| cytoplasmic protein [Brucella sp. BO2]
          Length = 263

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 59/114 (51%), Positives = 75/114 (65%), Gaps = 3/114 (2%)

Query: 25  KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
           K  NPL RNY+SNG DVK+RG AQHIAE+YS LARDA ++GD V+AEN+LQHAEHYNRI+
Sbjct: 25  KGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARDAQASGDRVMAENYLQHAEHYNRII 84

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENS 138
             A AQ     QR+E  D    + +E         EA+P P+   G +P+ E +
Sbjct: 85  MAAMAQQNIPYQREENFDSDGGDDEEA---GFIPAEAAPQPVNGSGPQPVIEGT 135


>gi|306844839|ref|ZP_07477422.1| cytoplasmic protein [Brucella sp. BO1]
 gi|306274771|gb|EFM56552.1| cytoplasmic protein [Brucella sp. BO1]
          Length = 261

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 59/114 (51%), Positives = 75/114 (65%), Gaps = 3/114 (2%)

Query: 25  KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
           K  NPL RNY+SNG DVK+RG AQHIAE+YS LARDA ++GD V+AEN+LQHAEHYNRI+
Sbjct: 23  KGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARDAQASGDRVMAENYLQHAEHYNRII 82

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENS 138
             A AQ     QR+E  D    + +E         EA+P P+   G +P+ E +
Sbjct: 83  MAAMAQQNIPYQREENFDSDGGDDEEA---GFIPAEAAPQPVNGSGPQPVIEGT 133


>gi|256045464|ref|ZP_05448352.1| hypothetical protein Bmelb1R_13276 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256158372|ref|ZP_05456270.1| hypothetical protein BcetM4_05925 [Brucella ceti M490/95/1]
 gi|260884574|ref|ZP_05896188.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261217698|ref|ZP_05931979.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261315088|ref|ZP_05954285.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261323816|ref|ZP_05963013.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261751017|ref|ZP_05994726.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|265987427|ref|ZP_06099984.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265991890|ref|ZP_06104447.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265996883|ref|ZP_06109440.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|260874102|gb|EEX81171.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260922787|gb|EEX89355.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261299796|gb|EEY03293.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261304114|gb|EEY07611.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261740770|gb|EEY28696.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|262551351|gb|EEZ07341.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|263002893|gb|EEZ15249.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|264659624|gb|EEZ29885.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
          Length = 261

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 59/114 (51%), Positives = 75/114 (65%), Gaps = 3/114 (2%)

Query: 25  KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
           K  NPL RNY+SNG DVK+RG AQHIAE+YS LARDA ++GD V+AEN+LQHAEHYNRI+
Sbjct: 23  KGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARDAQASGDRVMAENYLQHAEHYNRII 82

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENS 138
             A AQ     QR+E  D    + +E         EA+P P+   G +P+ E +
Sbjct: 83  MAAMAQQNIPYQREENFDSDGGDDEEA---GFIPAEAAPQPVNGSGPQPVIEGT 133


>gi|237816232|ref|ZP_04595225.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|237788299|gb|EEP62514.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
          Length = 263

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 59/114 (51%), Positives = 75/114 (65%), Gaps = 3/114 (2%)

Query: 25  KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
           K  NPL RNY+SNG DVK+RG AQHIAE+YS LARDA ++GD V+AEN+LQHAEHYNRI+
Sbjct: 25  KGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARDAQASGDRVMAENYLQHAEHYNRII 84

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENS 138
             A AQ     QR+E  D    + +E         EA+P P+   G +P+ E +
Sbjct: 85  MAAMAQQNIPYQREENFDSDGGDDEEA---GFIPAEAAPQPVNGSGPQPVIEGT 135


>gi|225628070|ref|ZP_03786105.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|256059847|ref|ZP_05450034.1| hypothetical protein Bneo5_05782 [Brucella neotomae 5K33]
 gi|260562787|ref|ZP_05833273.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260567642|ref|ZP_05838112.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|261758810|ref|ZP_06002519.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|225616895|gb|EEH13942.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|260152803|gb|EEW87895.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260157160|gb|EEW92240.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|261738794|gb|EEY26790.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|326539583|gb|ADZ87798.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 263

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 59/114 (51%), Positives = 75/114 (65%), Gaps = 3/114 (2%)

Query: 25  KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
           K  NPL RNY+SNG DVK+RG AQHIAE+YS LARDA ++GD V+AEN+LQHAEHYNRI+
Sbjct: 25  KGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARDAQASGDRVMAENYLQHAEHYNRII 84

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENS 138
             A AQ     QR+E  D    + +E         EA+P P+   G +P+ E +
Sbjct: 85  MAAMAQQNIPYQREENFDSDGGDDEEA---GFIPAEAAPQPVNGSGPQPVIEGT 135


>gi|189024938|ref|YP_001935706.1| hypothetical protein BAbS19_I17500 [Brucella abortus S19]
 gi|254731048|ref|ZP_05189626.1| hypothetical protein Babob42_07596 [Brucella abortus bv. 4 str.
           292]
 gi|260758773|ref|ZP_05871121.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260760497|ref|ZP_05872840.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|189020510|gb|ACD73232.1| hypothetical protein BAbS19_I17500 [Brucella abortus S19]
 gi|260669091|gb|EEX56031.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260670929|gb|EEX57750.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
          Length = 261

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 59/114 (51%), Positives = 75/114 (65%), Gaps = 3/114 (2%)

Query: 25  KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
           K  NPL RNY+SNG DVK+RG AQHIAE+YS LARDA ++GD V+AEN+LQHAEHYNRI+
Sbjct: 23  KGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARDAQASGDRVMAENYLQHAEHYNRII 82

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENS 138
             A AQ     QR+E  D    + +E         EA+P P+   G +P+ E +
Sbjct: 83  MAAMAQQNIPYQREENFDSDGGDDEEA---GFIPAEAAPQPVNGSGPQPVIEGT 133


>gi|260545989|ref|ZP_05821729.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260096096|gb|EEW79972.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
          Length = 164

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 59/114 (51%), Positives = 75/114 (65%), Gaps = 3/114 (2%)

Query: 25  KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
           K  NPL RNY+SNG DVK+RG AQHIAE+YS LARDA ++GD V+AEN+LQHAEHYNRI+
Sbjct: 25  KGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARDAQASGDRVMAENYLQHAEHYNRII 84

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENS 138
             A AQ     QR+E  D    + +E         EA+P P+   G +P+ E +
Sbjct: 85  MAAMAQQNIPYQREENFDSDGGDDEEA---GFIPAEAAPQPVNGSGPQPVIEGT 135


>gi|254708863|ref|ZP_05170674.1| hypothetical protein BpinB_01103 [Brucella pinnipedialis B2/94]
 gi|261316355|ref|ZP_05955552.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261295578|gb|EEX99074.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
          Length = 162

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 59/114 (51%), Positives = 75/114 (65%), Gaps = 3/114 (2%)

Query: 25  KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
           K  NPL RNY+SNG DVK+RG AQHIAE+YS LARDA ++GD V+AEN+LQHAEHYNRI+
Sbjct: 25  KGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARDAQASGDRVMAENYLQHAEHYNRII 84

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENS 138
             A AQ     QR+E  D    + +E         EA+P P+   G +P+ E +
Sbjct: 85  MAAMAQQNIPYQREENFDSDGGDDEEA---GFIPAEAAPQPVNGSGPQPVIEGT 135


>gi|265999303|ref|ZP_06111640.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|263093129|gb|EEZ17264.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
          Length = 166

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 59/114 (51%), Positives = 75/114 (65%), Gaps = 3/114 (2%)

Query: 25  KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
           K  NPL RNY+SNG DVK+RG AQHIAE+YS LARDA ++GD V+AEN+LQHAEHYNRI+
Sbjct: 25  KGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARDAQASGDRVMAENYLQHAEHYNRII 84

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENS 138
             A AQ     QR+E  D    + +E         EA+P P+   G +P+ E +
Sbjct: 85  MAAMAQQNIPYQREENFDSDGGDDEEA---GFIPAEAAPQPVNGSGPQPVIEGT 135


>gi|261321455|ref|ZP_05960652.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261294145|gb|EEX97641.1| conserved hypothetical protein [Brucella ceti M644/93/1]
          Length = 159

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 59/114 (51%), Positives = 75/114 (65%), Gaps = 3/114 (2%)

Query: 25  KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
           K  NPL RNY+SNG DVK+RG AQHIAE+YS LARDA ++GD V+AEN+LQHAEHYNRI+
Sbjct: 25  KGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARDAQASGDRVMAENYLQHAEHYNRII 84

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENS 138
             A AQ     QR+E  D    + +E         EA+P P+   G +P+ E +
Sbjct: 85  MAAMAQQNIPYQREENFDSDGGDDEEA---GFIPAEAAPQPVNGSGPQPVIEGT 135


>gi|254717937|ref|ZP_05179748.1| hypothetical protein Bru83_00025 [Brucella sp. 83/13]
          Length = 150

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 59/114 (51%), Positives = 75/114 (65%), Gaps = 3/114 (2%)

Query: 25  KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
           K  NPL RNY+SNG DVK+RG AQHIAE+YS LARDA ++GD V+AEN+LQHAEHYNRI+
Sbjct: 23  KGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARDAQASGDRVMAENYLQHAEHYNRII 82

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENS 138
             A AQ     QR+E  D    + +E         EA+P P+   G +P+ E +
Sbjct: 83  MAAMAQQNIPYQREENFDSDGGDDEEA---GFIPAEAAPQPVNGSGPQPVIEGT 133


>gi|265982878|ref|ZP_06095613.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|264661470|gb|EEZ31731.1| conserved hypothetical protein [Brucella sp. 83/13]
          Length = 152

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 59/114 (51%), Positives = 75/114 (65%), Gaps = 3/114 (2%)

Query: 25  KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
           K  NPL RNY+SNG DVK+RG AQHIAE+YS LARDA ++GD V+AEN+LQHAEHYNRI+
Sbjct: 25  KGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARDAQASGDRVMAENYLQHAEHYNRII 84

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENS 138
             A AQ     QR+E  D    + +E         EA+P P+   G +P+ E +
Sbjct: 85  MAAMAQQNIPYQREENFDSDGGDDEEA---GFIPAEAAPQPVNGSGPQPVIEGT 135


>gi|261755578|ref|ZP_05999287.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|261745331|gb|EEY33257.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
          Length = 137

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 59/114 (51%), Positives = 75/114 (65%), Gaps = 3/114 (2%)

Query: 25  KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
           K  NPL RNY+SNG DVK+RG AQHIAE+YS LARDA ++GD V+AEN+LQHAEHYNRI+
Sbjct: 25  KGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARDAQASGDRVMAENYLQHAEHYNRII 84

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENS 138
             A AQ     QR+E  D    + +E         EA+P P+   G +P+ E +
Sbjct: 85  MAAMAQQNIPYQREENFDSDGGDDEEA---GFIPAEAAPQPVNGSGPQPVIEGT 135


>gi|222149909|ref|YP_002550866.1| hypothetical protein Avi_3953 [Agrobacterium vitis S4]
 gi|221736891|gb|ACM37854.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 294

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 61/71 (85%)

Query: 25 KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
          K  NPL R YDS+G DVK+RGTAQHIAE+Y  LARD+ S+GD V+AEN+LQHAEHYNRI+
Sbjct: 29 KGSNPLTRTYDSSGPDVKIRGTAQHIAEKYMALARDSHSSGDRVMAENYLQHAEHYNRII 88

Query: 85 SMAQAQIQEKL 95
          + AQAQ+QE++
Sbjct: 89 AAAQAQMQERV 99


>gi|260755550|ref|ZP_05867898.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260675658|gb|EEX62479.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
          Length = 140

 Score =  111 bits (278), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 59/114 (51%), Positives = 75/114 (65%), Gaps = 3/114 (2%)

Query: 25  KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
           K  NPL RNY+SNG DVK+RG AQHIAE+YS LARDA ++GD V+AEN+LQHAEHYNRI+
Sbjct: 25  KGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARDAQASGDRVMAENYLQHAEHYNRII 84

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENS 138
             A AQ     QR+E  D    + +E         EA+P P+   G +P+ E +
Sbjct: 85  MAAMAQQNIPYQREENFDSDGGDDEEA---GFIPAEAAPQPVNGSGPQPVIEGT 135


>gi|153008373|ref|YP_001369588.1| hypothetical protein Oant_1038 [Ochrobactrum anthropi ATCC 49188]
 gi|151560261|gb|ABS13759.1| conserved hypothetical protein [Ochrobactrum anthropi ATCC 49188]
          Length = 263

 Score =  111 bits (278), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 73/114 (64%), Gaps = 3/114 (2%)

Query: 25  KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
           K  NPL RNY+SNG DVK+RG AQHIAE+YS LARDA ++GD V+AEN+LQHAEHYNRI+
Sbjct: 26  KGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARDAQASGDRVMAENYLQHAEHYNRII 85

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENS 138
             A AQ     QR+E       +  +  +   +   A P P+   G +P+ E +
Sbjct: 86  MAAMAQNPVPFQREE---TFDDDGADDEEAGFTPVAAQPQPVNGSGPQPVIEGT 136


>gi|297247113|ref|ZP_06930831.1| conserved hypothetical protein [Brucella abortus bv. 5 str. B3196]
 gi|297174282|gb|EFH33629.1| conserved hypothetical protein [Brucella abortus bv. 5 str. B3196]
          Length = 148

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 59/114 (51%), Positives = 75/114 (65%), Gaps = 3/114 (2%)

Query: 25  KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
           K  NPL RNY+SNG DVK+RG AQHIAE+YS LARDA ++GD V+AEN+LQHAEHYNRI+
Sbjct: 25  KGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARDAQASGDRVMAENYLQHAEHYNRII 84

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENS 138
             A AQ     QR+E  D    + +E         EA+P P+   G +P+ E +
Sbjct: 85  MAAMAQQNIPYQREENFDSDGGDDEEA---GFIPAEAAPQPVNGSGPQPVIEGT 135


>gi|265993631|ref|ZP_06106188.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|262764612|gb|EEZ10533.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
          Length = 255

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 58/104 (55%), Positives = 71/104 (68%), Gaps = 3/104 (2%)

Query: 25  KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
           K  NPL RNY+SNG DVK+RG AQHIAE+YS LARDA ++GD V+AEN+LQHAEHYNRI+
Sbjct: 25  KGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARDAQASGDRVMAENYLQHAEHYNRII 84

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIE 128
             A AQ     QR+E  D    + +E         EA+P P+IE
Sbjct: 85  MAAMAQQNIPYQREENFDSDGGDDEEA---GFIPAEAAPQPVIE 125


>gi|256112204|ref|ZP_05453125.1| hypothetical protein Bmelb3E_05882 [Brucella melitensis bv. 3 str.
           Ether]
          Length = 253

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 58/104 (55%), Positives = 71/104 (68%), Gaps = 3/104 (2%)

Query: 25  KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
           K  NPL RNY+SNG DVK+RG AQHIAE+YS LARDA ++GD V+AEN+LQHAEHYNRI+
Sbjct: 23  KGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARDAQASGDRVMAENYLQHAEHYNRII 82

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIE 128
             A AQ     QR+E  D    + +E         EA+P P+IE
Sbjct: 83  MAAMAQQNIPYQREENFDSDGGDDEEA---GFIPAEAAPQPVIE 123


>gi|239832944|ref|ZP_04681273.1| Retinitis pigmentosa 1-like 1 protein [Ochrobactrum intermedium
          LMG 3301]
 gi|239825211|gb|EEQ96779.1| Retinitis pigmentosa 1-like 1 protein [Ochrobactrum intermedium
          LMG 3301]
          Length = 263

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 50/75 (66%), Positives = 59/75 (78%)

Query: 25 KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
          K  NPL RNY+SNG DVK+RG AQHIAE+YS LARDA ++GD V+AEN+LQHAEHYNRI+
Sbjct: 25 KGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARDAQASGDRVMAENYLQHAEHYNRII 84

Query: 85 SMAQAQIQEKLQRDE 99
            A AQ     QR+E
Sbjct: 85 MAAMAQNPVPFQREE 99


>gi|260467162|ref|ZP_05813340.1| conserved hypothetical protein [Mesorhizobium opportunistum
          WSM2075]
 gi|259029086|gb|EEW30384.1| conserved hypothetical protein [Mesorhizobium opportunistum
          WSM2075]
          Length = 317

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 58/67 (86%)

Query: 25 KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
          K  NPL RNY+SNG DVK+RG+AQ IAE+Y+ LARDA S+GD V+AEN+LQHAEHYNRI+
Sbjct: 31 KGPNPLTRNYESNGPDVKIRGSAQQIAEKYATLARDAQSSGDRVMAENYLQHAEHYNRII 90

Query: 85 SMAQAQI 91
          + AQAQ+
Sbjct: 91 AAAQAQM 97


>gi|110635326|ref|YP_675534.1| hypothetical protein Meso_2997 [Mesorhizobium sp. BNC1]
 gi|110286310|gb|ABG64369.1| conserved hypothetical protein [Chelativorans sp. BNC1]
          Length = 275

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 50/81 (61%), Positives = 65/81 (80%), Gaps = 2/81 (2%)

Query: 25  KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
           K  NPL R+Y+SNG DVK+RGTAQ IA++Y+ LARDA S+GD V+AEN+LQHAEHYNR++
Sbjct: 44  KGPNPLTRSYESNGPDVKIRGTAQQIADKYATLARDAQSSGDRVMAENYLQHAEHYNRLI 103

Query: 85  --SMAQAQIQEKLQRDEQDDL 103
             +MAQ Q Q+ L+   +DDL
Sbjct: 104 AAAMAQVQPQQNLRDFREDDL 124


>gi|17986478|ref|NP_539112.1| putative cytoplasmic protein [Brucella melitensis bv. 1 str. 16M]
 gi|23502718|ref|NP_698845.1| hypothetical protein BR1865 [Brucella suis 1330]
 gi|161619783|ref|YP_001593670.1| hypothetical protein BCAN_A1909 [Brucella canis ATCC 23365]
 gi|163843891|ref|YP_001628295.1| hypothetical protein BSUIS_A1706 [Brucella suis ATCC 23445]
 gi|225853304|ref|YP_002733537.1| hypothetical protein BMEA_A1919 [Brucella melitensis ATCC 23457]
 gi|254694505|ref|ZP_05156333.1| hypothetical protein Babob3T_07564 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254700514|ref|ZP_05162342.1| hypothetical protein Bsuib55_06631 [Brucella suis bv. 5 str. 513]
 gi|254707600|ref|ZP_05169428.1| hypothetical protein BpinM_11671 [Brucella pinnipedialis
           M163/99/10]
 gi|254715936|ref|ZP_05177747.1| hypothetical protein BcetM_05797 [Brucella ceti M13/05/1]
 gi|256030389|ref|ZP_05444003.1| hypothetical protein BpinM2_07035 [Brucella pinnipedialis
           M292/94/1]
 gi|256258270|ref|ZP_05463806.1| hypothetical protein Babob9C_13178 [Brucella abortus bv. 9 str.
           C68]
 gi|256370265|ref|YP_003107776.1| hypothetical protein BMI_I1885 [Brucella microti CCM 4915]
 gi|260169298|ref|ZP_05756109.1| hypothetical protein BruF5_13260 [Brucella sp. F5/99]
 gi|261214821|ref|ZP_05929102.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|17982077|gb|AAL51376.1| hypothetical cytosolic protein [Brucella melitensis bv. 1 str. 16M]
 gi|23348733|gb|AAN30760.1| conserved hypothetical protein [Brucella suis 1330]
 gi|161336594|gb|ABX62899.1| Hypothetical protein BCAN_A1909 [Brucella canis ATCC 23365]
 gi|163674614|gb|ABY38725.1| Hypothetical protein BSUIS_A1706 [Brucella suis ATCC 23445]
 gi|225641669|gb|ACO01583.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457]
 gi|256000428|gb|ACU48827.1| hypothetical protein BMI_I1885 [Brucella microti CCM 4915]
 gi|260916428|gb|EEX83289.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|326409869|gb|ADZ66934.1| conserved hypothetical protein [Brucella melitensis M28]
          Length = 252

 Score =  105 bits (263), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 30  LVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQA 89
           L RNY+SNG DVK+RG AQHIAE+YS LARDA ++GD V+AEN+LQHAEHYNRI+  A A
Sbjct: 19  LSRNYESNGPDVKIRGNAQHIAEKYSALARDAQASGDRVMAENYLQHAEHYNRIIMAAMA 78

Query: 90  QIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENS 138
           Q     QR+E  D    + +E         EA+P P+   G +P+ E +
Sbjct: 79  QQNIPYQREENFDSDGGDDEEA---GFIPAEAAPQPVNGSGPQPVIEGT 124


>gi|62290726|ref|YP_222519.1| hypothetical protein BruAb1_1844 [Brucella abortus bv. 1 str.
           9-941]
 gi|82700639|ref|YP_415213.1| hypothetical protein BAB1_1869 [Brucella melitensis biovar Abortus
           2308]
 gi|254696130|ref|ZP_05157958.1| hypothetical protein Babob28_00052 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|62196858|gb|AAX75158.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616740|emb|CAJ11825.1| conserved hypothetical protein [Brucella melitensis biovar Abortus
           2308]
          Length = 252

 Score =  105 bits (263), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 30  LVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQA 89
           L RNY+SNG DVK+RG AQHIAE+YS LARDA ++GD V+AEN+LQHAEHYNRI+  A A
Sbjct: 19  LSRNYESNGPDVKIRGNAQHIAEKYSALARDAQASGDRVMAENYLQHAEHYNRIIMAAMA 78

Query: 90  QIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENS 138
           Q     QR+E  D    + +E         EA+P P+   G +P+ E +
Sbjct: 79  QQNIPYQREENFDSDGGDDEEA---GFIPAEAAPQPVNGSGPQPVIEGT 124


>gi|254713714|ref|ZP_05175525.1| hypothetical protein BcetM6_10225 [Brucella ceti M644/93/1]
          Length = 148

 Score =  105 bits (263), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 30  LVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQA 89
           L RNY+SNG DVK+RG AQHIAE+YS LARDA ++GD V+AEN+LQHAEHYNRI+  A A
Sbjct: 19  LSRNYESNGPDVKIRGNAQHIAEKYSALARDAQASGDRVMAENYLQHAEHYNRIIMAAMA 78

Query: 90  QIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENS 138
           Q     QR+E  D    + +E         EA+P P+   G +P+ E +
Sbjct: 79  QQNIPYQREENFDSDGGDDEEA---GFIPAEAAPQPVNGSGPQPVIEGT 124


>gi|294851109|ref|ZP_06791782.1| conserved hypothetical protein [Brucella sp. NVSL 07-0026]
 gi|294819698|gb|EFG36697.1| conserved hypothetical protein [Brucella sp. NVSL 07-0026]
          Length = 154

 Score =  105 bits (263), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 30  LVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQA 89
           L RNY+SNG DVK+RG AQHIAE+YS LARDA ++GD V+AEN+LQHAEHYNRI+  A A
Sbjct: 19  LSRNYESNGPDVKIRGNAQHIAEKYSALARDAQASGDRVMAENYLQHAEHYNRIIMAAMA 78

Query: 90  QIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENS 138
           Q     QR+E  D    + +E         EA+P P+   G +P+ E +
Sbjct: 79  QQNIPYQREENFDSDGGDDEEA---GFIPAEAAPQPVNGSGPQPVIEGT 124


>gi|13472968|ref|NP_104535.1| hypothetical protein mll3431 [Mesorhizobium loti MAFF303099]
 gi|14023716|dbj|BAB50321.1| mll3431 [Mesorhizobium loti MAFF303099]
          Length = 318

 Score =  105 bits (263), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 58/67 (86%)

Query: 25 KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
          K  NPL RNY+SNG DVK+RG+AQ IAE+Y+ LARDA S+GD V+AEN+LQHAEHYNRI+
Sbjct: 31 KGPNPLTRNYESNGPDVKIRGSAQQIAEKYATLARDAQSSGDRVMAENYLQHAEHYNRII 90

Query: 85 SMAQAQI 91
          + AQAQ+
Sbjct: 91 AAAQAQM 97


>gi|254704885|ref|ZP_05166713.1| hypothetical protein Bsuib36_13400 [Brucella suis bv. 3 str. 686]
          Length = 126

 Score =  105 bits (261), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 30  LVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQA 89
           L RNY+SNG DVK+RG AQHIAE+YS LARDA ++GD V+AEN+LQHAEHYNRI+  A A
Sbjct: 19  LSRNYESNGPDVKIRGNAQHIAEKYSALARDAQASGDRVMAENYLQHAEHYNRIIMAAMA 78

Query: 90  QIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENS 138
           Q     QR+E  D    + +E         EA+P P+   G +P+ E +
Sbjct: 79  QQNIPYQREENFDSDGGDDEEA---GFIPAEAAPQPVNGSGPQPVIEGT 124


>gi|254690015|ref|ZP_05153269.1| hypothetical protein Babob68_07561 [Brucella abortus bv. 6 str.
           870]
          Length = 129

 Score =  105 bits (261), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 30  LVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQA 89
           L RNY+SNG DVK+RG AQHIAE+YS LARDA ++GD V+AEN+LQHAEHYNRI+  A A
Sbjct: 19  LSRNYESNGPDVKIRGNAQHIAEKYSALARDAQASGDRVMAENYLQHAEHYNRIIMAAMA 78

Query: 90  QIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENS 138
           Q     QR+E  D    +  +  +      EA+P P+   G +P+ E +
Sbjct: 79  QQNIPYQREENFD---SDGGDDEEAGFIPAEAAPQPVNGSGPQPVIEGT 124


>gi|319781347|ref|YP_004140823.1| hypothetical protein Mesci_1616 [Mesorhizobium ciceri biovar
          biserrulae WSM1271]
 gi|317167235|gb|ADV10773.1| hypothetical protein Mesci_1616 [Mesorhizobium ciceri biovar
          biserrulae WSM1271]
          Length = 315

 Score =  104 bits (259), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 46/67 (68%), Positives = 58/67 (86%)

Query: 25 KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
          K  NPL RNY+SNG DVK+RG+AQ IAE+Y+ LARD+ S+GD V+AEN+LQHAEHYNRI+
Sbjct: 33 KGPNPLTRNYESNGPDVKIRGSAQQIAEKYATLARDSHSSGDRVMAENYLQHAEHYNRII 92

Query: 85 SMAQAQI 91
          + AQAQ+
Sbjct: 93 AAAQAQM 99


>gi|218660372|ref|ZP_03516302.1| hypothetical protein RetlI_12504 [Rhizobium etli IE4771]
          Length = 119

 Score =  103 bits (258), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 57/64 (89%)

Query: 29  PLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
           PL R YDS+G DVK+RGTAQHIAE+Y+ LARDA S+GD V+AEN+LQHAEHYNRI++ AQ
Sbjct: 37  PLTRTYDSSGPDVKIRGTAQHIAEKYAQLARDAQSSGDRVMAENYLQHAEHYNRIIASAQ 96

Query: 89  AQIQ 92
           AQ+Q
Sbjct: 97  AQMQ 100


>gi|158426118|ref|YP_001527410.1| hypothetical protein AZC_4494 [Azorhizobium caulinodans ORS 571]
 gi|158333007|dbj|BAF90492.1| hypothetical protein [Azorhizobium caulinodans ORS 571]
          Length = 375

 Score =  102 bits (254), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 64/91 (70%), Gaps = 10/91 (10%)

Query: 1  MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
          MR+ QQ KR RGR         NR++ NP+ R Y+SNG DVKVRGTA HIAE+Y  LARD
Sbjct: 1  MRNGQQ-KRMRGR---------NRRSSNPMTRVYESNGPDVKVRGTAHHIAEKYLQLARD 50

Query: 61 AMSAGDYVVAENHLQHAEHYNRIVSMAQAQI 91
          A S+GD+V AEN+ QHAEHY R+++  Q Q 
Sbjct: 51 AQSSGDHVAAENYYQHAEHYQRLIASLQGQF 81


>gi|209883259|ref|YP_002287116.1| hypothetical protein OCAR_4100 [Oligotropha carboxidovorans OM5]
 gi|209871455|gb|ACI91251.1| conserved hypothetical protein [Oligotropha carboxidovorans OM5]
          Length = 229

 Score =  102 bits (253), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 63/84 (75%), Gaps = 2/84 (2%)

Query: 8  KRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDY 67
          KR RGR  +GGN   NR+  NP+ R ++SNG D+K+RGTA HIAE+Y  LARDA S+GD 
Sbjct: 9  KRMRGR--SGGNHGNNRRGQNPMTRVFESNGPDIKIRGTASHIAEKYVQLARDARSSGDP 66

Query: 68 VVAENHLQHAEHYNRIVSMAQAQI 91
          V AEN+ QHAEHY R+++ AQ Q+
Sbjct: 67 VAAENYYQHAEHYFRLIAAAQEQL 90


>gi|312115443|ref|YP_004013039.1| hypothetical protein Rvan_2729 [Rhodomicrobium vannielii ATCC
          17100]
 gi|311220572|gb|ADP71940.1| hypothetical protein Rvan_2729 [Rhodomicrobium vannielii ATCC
          17100]
          Length = 286

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 55/66 (83%)

Query: 25 KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
          K  N + RNY+S+G DVK+RGTA HIAE+Y+ LARDAM++GD V AEN+LQHAEHYNRI+
Sbjct: 25 KPQNSISRNYESSGPDVKIRGTAMHIAEKYTSLARDAMASGDSVAAENYLQHAEHYNRII 84

Query: 85 SMAQAQ 90
            AQAQ
Sbjct: 85 LAAQAQ 90


>gi|254559640|ref|YP_003066735.1| hypothetical protein METDI1099 [Methylobacterium extorquens DM4]
 gi|254266918|emb|CAX22717.1| conserved hypothetical protein [Methylobacterium extorquens DM4]
          Length = 429

 Score = 98.6 bits (244), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 53/64 (82%)

Query: 25 KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
          K  NPL R+Y+SNG DVK+RGTAQHIA++Y+ LARDA+++GD V AEN+ QH EHY RI+
Sbjct: 8  KGPNPLTRSYESNGPDVKIRGTAQHIADKYAQLARDALASGDPVAAENYFQHGEHYFRII 67

Query: 85 SMAQ 88
          + AQ
Sbjct: 68 TGAQ 71


>gi|218528946|ref|YP_002419762.1| hypothetical protein Mchl_0916 [Methylobacterium chloromethanicum
          CM4]
 gi|218521249|gb|ACK81834.1| conserved hypothetical protein [Methylobacterium chloromethanicum
          CM4]
          Length = 431

 Score = 98.2 bits (243), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 53/64 (82%)

Query: 25 KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
          K  NPL R+Y+SNG DVK+RGTAQHIA++Y+ LARDA+++GD V AEN+ QH EHY RI+
Sbjct: 8  KGPNPLTRSYESNGPDVKIRGTAQHIADKYAQLARDALASGDPVAAENYFQHGEHYFRII 67

Query: 85 SMAQ 88
          + AQ
Sbjct: 68 TGAQ 71


>gi|240137462|ref|YP_002961933.1| hypothetical protein MexAM1_META1p0727 [Methylobacterium
          extorquens AM1]
 gi|240007430|gb|ACS38656.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
          Length = 426

 Score = 98.2 bits (243), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 53/64 (82%)

Query: 25 KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
          K  NPL R+Y+SNG DVK+RGTAQHIA++Y+ LARDA+++GD V AEN+ QH EHY RI+
Sbjct: 8  KGPNPLTRSYESNGPDVKIRGTAQHIADKYAQLARDALASGDPVAAENYFQHGEHYFRII 67

Query: 85 SMAQ 88
          + AQ
Sbjct: 68 TGAQ 71


>gi|170746589|ref|YP_001752849.1| hypothetical protein Mrad2831_0139 [Methylobacterium
          radiotolerans JCM 2831]
 gi|170653111|gb|ACB22166.1| conserved hypothetical protein [Methylobacterium radiotolerans
          JCM 2831]
          Length = 350

 Score = 98.2 bits (243), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 54/66 (81%)

Query: 25 KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
          K  NPL R+Y+SNG DVK+RGTAQHIA++Y+ LARDA++AGD V AEN+ QH EHY RIV
Sbjct: 8  KGPNPLTRSYESNGPDVKIRGTAQHIADKYAQLARDALAAGDPVAAENYFQHGEHYFRIV 67

Query: 85 SMAQAQ 90
          S AQ Q
Sbjct: 68 SGAQDQ 73


>gi|163850386|ref|YP_001638429.1| hypothetical protein Mext_0953 [Methylobacterium extorquens PA1]
 gi|163661991|gb|ABY29358.1| conserved hypothetical protein [Methylobacterium extorquens PA1]
          Length = 437

 Score = 98.2 bits (243), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 53/64 (82%)

Query: 25 KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
          K  NPL R+Y+SNG DVK+RGTAQHIA++Y+ LARDA+++GD V AEN+ QH EHY RI+
Sbjct: 16 KGPNPLTRSYESNGPDVKIRGTAQHIADKYAQLARDALASGDPVAAENYFQHGEHYFRII 75

Query: 85 SMAQ 88
          + AQ
Sbjct: 76 TGAQ 79


>gi|170742859|ref|YP_001771514.1| hypothetical protein M446_4750 [Methylobacterium sp. 4-46]
 gi|168197133|gb|ACA19080.1| conserved hypothetical protein [Methylobacterium sp. 4-46]
          Length = 347

 Score = 97.4 bits (241), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 55/71 (77%)

Query: 25 KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
          K  NPL R Y+SNG DVK+RGTAQHIAE+Y+ LARDA + GD V+AEN+ QH EHY+RI+
Sbjct: 16 KGPNPLTRAYESNGPDVKIRGTAQHIAEKYAQLARDAQANGDPVMAENYFQHGEHYHRII 75

Query: 85 SMAQAQIQEKL 95
          + A  Q +++ 
Sbjct: 76 AAANEQYRQQF 86


>gi|307942492|ref|ZP_07657841.1| putative cytoplasmic protein [Roseibium sp. TrichSKD4]
 gi|307774313|gb|EFO33525.1| putative cytoplasmic protein [Roseibium sp. TrichSKD4]
          Length = 280

 Score = 97.4 bits (241), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 47/80 (58%), Positives = 57/80 (71%), Gaps = 9/80 (11%)

Query: 5   QQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSA 64
           Q  KR RGRG         RK  NPL R Y+SNG DVK+RGTAQH+A++Y  LARDA ++
Sbjct: 32  QSNKRMRGRG---------RKGPNPLTRTYESNGPDVKIRGTAQHVADKYQQLARDAQAS 82

Query: 65  GDYVVAENHLQHAEHYNRIV 84
           GD V+ EN+LQHAEHY RI+
Sbjct: 83  GDRVMGENYLQHAEHYLRII 102


>gi|188580160|ref|YP_001923605.1| hypothetical protein Mpop_0892 [Methylobacterium populi BJ001]
 gi|179343658|gb|ACB79070.1| conserved hypothetical protein [Methylobacterium populi BJ001]
          Length = 425

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 40/64 (62%), Positives = 53/64 (82%)

Query: 25 KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
          K  NPL R+Y+SNG DVK+RGTAQHIA++Y+ LARDA+++GD + AEN+ QH EHY RI+
Sbjct: 16 KGPNPLTRSYESNGPDVKIRGTAQHIADKYAQLARDALASGDPIAAENYFQHGEHYFRII 75

Query: 85 SMAQ 88
          + AQ
Sbjct: 76 TGAQ 79


>gi|298292696|ref|YP_003694635.1| hypothetical protein Snov_2727 [Starkeya novella DSM 506]
 gi|296929207|gb|ADH90016.1| conserved hypothetical protein [Starkeya novella DSM 506]
          Length = 353

 Score = 95.9 bits (237), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 44/63 (69%), Positives = 51/63 (80%)

Query: 29 PLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
          PL R Y+SNG DVKVRGTAQHI E+Y  LARDA ++GD V AEN+LQHAEHY RI++ AQ
Sbjct: 23 PLTRVYESNGPDVKVRGTAQHIVEKYQQLARDAQASGDPVAAENYLQHAEHYYRIIAAAQ 82

Query: 89 AQI 91
          AQ 
Sbjct: 83 AQF 85


>gi|220920163|ref|YP_002495464.1| hypothetical protein Mnod_0114 [Methylobacterium nodulans ORS
          2060]
 gi|219944769|gb|ACL55161.1| conserved hypothetical protein [Methylobacterium nodulans ORS
          2060]
          Length = 311

 Score = 95.9 bits (237), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 54/71 (76%)

Query: 25 KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
          K  NPL R Y+SNG DVK+RGTAQHIAE+Y+ LARDA + GD V+AEN+ QH EHY RI+
Sbjct: 16 KGPNPLTRAYESNGPDVKIRGTAQHIAEKYAQLARDAQANGDPVMAENYFQHGEHYQRII 75

Query: 85 SMAQAQIQEKL 95
          + A  Q +++ 
Sbjct: 76 AAANEQYRQQF 86


>gi|182677817|ref|YP_001831963.1| hypothetical protein Bind_0824 [Beijerinckia indica subsp. indica
          ATCC 9039]
 gi|182633700|gb|ACB94474.1| conserved hypothetical protein [Beijerinckia indica subsp. indica
          ATCC 9039]
          Length = 345

 Score = 94.7 bits (234), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 48/79 (60%), Positives = 58/79 (73%), Gaps = 7/79 (8%)

Query: 6  QYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAG 65
          Q KR RGR +N       RK  NPL R+Y+SNG DVK+RGTA HI E+Y  LARDA SAG
Sbjct: 5  QNKRMRGRPNN-------RKGPNPLTRSYESNGPDVKIRGTAHHIGEKYLQLARDAQSAG 57

Query: 66 DYVVAENHLQHAEHYNRIV 84
          D V+AE++LQHAEHY R++
Sbjct: 58 DPVMAESYLQHAEHYFRLI 76


>gi|114704327|ref|ZP_01437235.1| hypothetical protein FP2506_05321 [Fulvimarina pelagi HTCC2506]
 gi|114539112|gb|EAU42232.1| hypothetical protein FP2506_05321 [Fulvimarina pelagi HTCC2506]
          Length = 296

 Score = 94.4 bits (233), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 56/74 (75%), Gaps = 9/74 (12%)

Query: 11 RGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVA 70
          RGRG         RK  NPL R+Y+SNG DVK+RG AQHIA++Y+ LARDA ++GD VVA
Sbjct: 2  RGRG---------RKGPNPLSRSYESNGPDVKIRGNAQHIADKYAQLARDASASGDRVVA 52

Query: 71 ENHLQHAEHYNRIV 84
          EN+LQHAEHY RI+
Sbjct: 53 ENYLQHAEHYYRII 66


>gi|323138798|ref|ZP_08073862.1| hypothetical protein Met49242DRAFT_3250 [Methylocystis sp. ATCC
          49242]
 gi|322395946|gb|EFX98483.1| hypothetical protein Met49242DRAFT_3250 [Methylocystis sp. ATCC
          49242]
          Length = 294

 Score = 94.0 bits (232), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 42/65 (64%), Positives = 52/65 (80%)

Query: 20 GSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEH 79
          G   RK  NPL R+Y+SNG DVK+RGTAQHIAE+Y  LARDA S+GD ++AE+ LQHAEH
Sbjct: 3  GRSGRKGPNPLTRSYESNGPDVKIRGTAQHIAEKYLQLARDAQSSGDTIMAESLLQHAEH 62

Query: 80 YNRIV 84
          Y R++
Sbjct: 63 YFRLI 67


>gi|217978068|ref|YP_002362215.1| hypothetical protein Msil_1908 [Methylocella silvestris BL2]
 gi|217503444|gb|ACK50853.1| conserved hypothetical protein [Methylocella silvestris BL2]
          Length = 345

 Score = 94.0 bits (232), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 49/85 (57%), Positives = 60/85 (70%), Gaps = 7/85 (8%)

Query: 1  MRSVQQYK-RSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLAR 59
          MR  Q  K R RGR +N      NRK  NPL R+Y+S+G DVK+RGTA HI E+Y  LAR
Sbjct: 1  MRPGQNNKQRMRGRPNN------NRKGPNPLTRSYESSGPDVKIRGTAHHIGEKYLQLAR 54

Query: 60 DAMSAGDYVVAENHLQHAEHYNRIV 84
          DA S+GD V AE++LQHAEHY R++
Sbjct: 55 DAQSSGDPVTAESYLQHAEHYFRLI 79


>gi|46202827|ref|ZP_00052536.2| hypothetical protein Magn03006972 [Magnetospirillum
          magnetotacticum MS-1]
          Length = 196

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 40/64 (62%), Positives = 53/64 (82%)

Query: 25 KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
          K  NPL R+Y+SNG DVK+RGTAQHIA++Y+ LARDA+++GD + AEN+ QH EHY RI+
Sbjct: 8  KGPNPLTRSYESNGPDVKIRGTAQHIADKYAQLARDALASGDPIAAENYFQHGEHYFRII 67

Query: 85 SMAQ 88
          + AQ
Sbjct: 68 TSAQ 71


>gi|296447417|ref|ZP_06889342.1| conserved hypothetical protein [Methylosinus trichosporium OB3b]
 gi|296255037|gb|EFH02139.1| conserved hypothetical protein [Methylosinus trichosporium OB3b]
          Length = 318

 Score = 93.2 bits (230), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 57/79 (72%), Gaps = 8/79 (10%)

Query: 6  QYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAG 65
          Q KR RGR         NRK  NPL R+Y+SNG DVK+RGTAQHIAE+Y  LARDA S+ 
Sbjct: 5  QNKRIRGRS--------NRKGPNPLTRSYESNGPDVKIRGTAQHIAEKYLQLARDAQSSS 56

Query: 66 DYVVAENHLQHAEHYNRIV 84
          D ++AE+ LQHAEHY R++
Sbjct: 57 DTIMAESLLQHAEHYFRLI 75


>gi|319407660|emb|CBI81308.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 235

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 44/75 (58%), Positives = 56/75 (74%)

Query: 28  NPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMA 87
           NPL RNY+SNG DVK+RG AQ IA++Y  LARDA  AGD V++EN+LQHAEHY RI+  A
Sbjct: 24  NPLSRNYESNGPDVKIRGNAQQIADKYISLARDAQGAGDRVMSENYLQHAEHYLRIILAA 83

Query: 88  QAQIQEKLQRDEQDD 102
             Q+    +RDE ++
Sbjct: 84  ADQMSYSHKRDENNE 98


>gi|240851093|ref|YP_002972494.1| hypothetical protein Bgr_16640 [Bartonella grahamii as4aup]
 gi|240268216|gb|ACS51804.1| hypothetical protein Bgr_16640 [Bartonella grahamii as4aup]
          Length = 247

 Score = 92.8 bits (229), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 56/74 (75%)

Query: 29  PLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
           PL RNY+S+G DVK+RG AQ IA++Y  LARDA  AGD V++EN+LQHAEHY RI+  A 
Sbjct: 29  PLSRNYESSGPDVKIRGNAQQIADKYISLARDAQGAGDRVMSENYLQHAEHYLRIILAAA 88

Query: 89  AQIQEKLQRDEQDD 102
            Q+ + ++RDE  D
Sbjct: 89  GQMSQSVRRDENRD 102


>gi|49476055|ref|YP_034096.1| hypothetical protein BH13890 [Bartonella henselae str. Houston-1]
 gi|49238863|emb|CAF28154.1| hypothetical protein BH13890 [Bartonella henselae str. Houston-1]
          Length = 244

 Score = 92.8 bits (229), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 44/75 (58%), Positives = 56/75 (74%)

Query: 28  NPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMA 87
           NPL RNY+S+G DVK+RG AQ IA++Y  LARDA  AGD V++EN+LQHAEHY RI+  A
Sbjct: 28  NPLSRNYESSGPDVKIRGNAQQIADKYISLARDAQGAGDRVMSENYLQHAEHYLRIILAA 87

Query: 88  QAQIQEKLQRDEQDD 102
             Q  + ++RDE  D
Sbjct: 88  VGQTPQSVRRDENRD 102


>gi|154246562|ref|YP_001417520.1| hypothetical protein Xaut_2621 [Xanthobacter autotrophicus Py2]
 gi|154160647|gb|ABS67863.1| hypothetical protein Xaut_2621 [Xanthobacter autotrophicus Py2]
          Length = 401

 Score = 92.8 bits (229), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 48/63 (76%)

Query: 29 PLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
          PL R Y+SNG D KVRGTA HIAE+Y  LARDA S+GD+V AEN+ QHAEHY R+++  Q
Sbjct: 25 PLTRVYESNGPDTKVRGTAHHIAEKYQQLARDAQSSGDHVAAENYFQHAEHYLRLIASLQ 84

Query: 89 AQI 91
           Q 
Sbjct: 85 GQF 87


>gi|90422034|ref|YP_530404.1| hypothetical protein RPC_0510 [Rhodopseudomonas palustris BisB18]
 gi|90104048|gb|ABD86085.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB18]
          Length = 272

 Score = 92.4 bits (228), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 64/97 (65%), Gaps = 1/97 (1%)

Query: 28  NPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMA 87
           NP+ R ++SNG D+K+RGTA H+AE+Y  LARDA S+GD V AEN+ QHAEHY R+++ A
Sbjct: 35  NPMTRVFESNGPDIKIRGTASHVAEKYVQLARDARSSGDPVAAENYYQHAEHYFRLIAAA 94

Query: 88  QAQIQEKLQRDEQDDLLVKEQKERAQN-ALSEFEASP 123
           Q Q ++ L +   D+ +  +  E     + S F A P
Sbjct: 95  QEQFRQNLPQQRTDNEMQDDSGEFGDGESYSNFGAEP 131


>gi|163868959|ref|YP_001610188.1| hypothetical protein Btr_1955 [Bartonella tribocorum CIP 105476]
 gi|161018635|emb|CAK02193.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 247

 Score = 91.7 bits (226), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 55/74 (74%)

Query: 29  PLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
           PL RNY+S+G DVK+RG AQ IA++Y  LARDA  AGD V++EN+LQHAEHY RI+  A 
Sbjct: 29  PLSRNYESSGPDVKIRGNAQQIADKYISLARDAQGAGDRVMSENYLQHAEHYLRIILAAA 88

Query: 89  AQIQEKLQRDEQDD 102
            Q+ +  +RDE  D
Sbjct: 89  GQMSQSARRDENRD 102


>gi|49474611|ref|YP_032653.1| hypothetical protein BQ11000 [Bartonella quintana str. Toulouse]
 gi|49240115|emb|CAF26561.1| hypothetical protein BQ11000 [Bartonella quintana str. Toulouse]
          Length = 246

 Score = 91.3 bits (225), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 55/74 (74%)

Query: 29  PLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
           PL RNY+S+G DVK+RG AQ IA++Y  LARDA  AGD V++EN+LQHAEHY RI+  A 
Sbjct: 28  PLSRNYESSGPDVKIRGNAQQIADKYISLARDAQGAGDRVMSENYLQHAEHYLRIILAAV 87

Query: 89  AQIQEKLQRDEQDD 102
            Q  + ++RDE  D
Sbjct: 88  GQTPQSVRRDENRD 101


>gi|300025032|ref|YP_003757643.1| hypothetical protein Hden_3531 [Hyphomicrobium denitrificans ATCC
          51888]
 gi|299526853|gb|ADJ25322.1| conserved hypothetical protein [Hyphomicrobium denitrificans ATCC
          51888]
          Length = 320

 Score = 90.5 bits (223), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/70 (58%), Positives = 58/70 (82%)

Query: 25 KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
          K+ NPL+R+++S+G DVK+RGT  HIAE+Y  LARDA+S+GD V+AEN+LQHAEHYNRI+
Sbjct: 21 KSQNPLMRSFESSGPDVKIRGTPSHIAEKYVSLARDALSSGDPVLAENYLQHAEHYNRII 80

Query: 85 SMAQAQIQEK 94
             + Q+ ++
Sbjct: 81 LSYREQMAQQ 90


>gi|86747198|ref|YP_483694.1| hypothetical protein RPB_0071 [Rhodopseudomonas palustris HaA2]
 gi|86570226|gb|ABD04783.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2]
          Length = 244

 Score = 89.7 bits (221), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 73/115 (63%), Gaps = 5/115 (4%)

Query: 29  PLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
           P+ R ++SNG D+K+RGTA H+AE+Y  LARDA S+GD V AEN+ QHAEHY R+++ AQ
Sbjct: 31  PMTRVFESNGPDIKIRGTASHVAEKYVQLARDARSSGDPVAAENYYQHAEHYFRLIAAAQ 90

Query: 89  AQI-QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPK 142
            Q  Q + Q+  + D  + E  +  ++  S F A P  L+   ++P    S QP+
Sbjct: 91  EQFRQNQPQQAPRIDNDMSENDDDGESDYSNFGAEPG-LVPVQQQP---QSFQPR 141


>gi|39933685|ref|NP_945961.1| hypothetical protein RPA0608 [Rhodopseudomonas palustris CGA009]
 gi|39647531|emb|CAE26052.1| conserved unknown protein [Rhodopseudomonas palustris CGA009]
          Length = 231

 Score = 89.4 bits (220), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 52/66 (78%)

Query: 28 NPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMA 87
          NP+ R ++SNG D+K+RGTA HIAE+Y  LARDA S+GD V AEN+ QHAEHY R+++ A
Sbjct: 27 NPMTRVFESNGPDIKIRGTASHIAEKYVQLARDARSSGDPVAAENYYQHAEHYFRLIAAA 86

Query: 88 QAQIQE 93
          Q Q ++
Sbjct: 87 QEQFRQ 92


>gi|27375331|ref|NP_766860.1| hypothetical protein blr0220 [Bradyrhizobium japonicum USDA 110]
 gi|27348467|dbj|BAC45485.1| blr0220 [Bradyrhizobium japonicum USDA 110]
          Length = 262

 Score = 89.4 bits (220), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 53/69 (76%)

Query: 28 NPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMA 87
          NP+ R Y+SNG D+K+RGTA HIAE+Y  LARDA S+GD V AEN+ QHAEHY R+++ A
Sbjct: 25 NPMTRVYESNGPDIKIRGTASHIAEKYLQLARDARSSGDPVAAENYYQHAEHYFRLIAAA 84

Query: 88 QAQIQEKLQ 96
          Q Q ++  Q
Sbjct: 85 QEQFRQNQQ 93


>gi|192289042|ref|YP_001989647.1| hypothetical protein Rpal_0612 [Rhodopseudomonas palustris TIE-1]
 gi|192282791|gb|ACE99171.1| conserved hypothetical protein [Rhodopseudomonas palustris TIE-1]
          Length = 231

 Score = 89.4 bits (220), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 52/66 (78%)

Query: 28 NPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMA 87
          NP+ R ++SNG D+K+RGTA HIAE+Y  LARDA S+GD V AEN+ QHAEHY R+++ A
Sbjct: 27 NPMTRVFESNGPDIKIRGTASHIAEKYVQLARDARSSGDPVAAENYYQHAEHYFRLIAAA 86

Query: 88 QAQIQE 93
          Q Q ++
Sbjct: 87 QEQFRQ 92


>gi|167644953|ref|YP_001682616.1| hypothetical protein Caul_0988 [Caulobacter sp. K31]
 gi|167347383|gb|ABZ70118.1| conserved hypothetical protein [Caulobacter sp. K31]
          Length = 373

 Score = 88.2 bits (217), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 46/89 (51%), Positives = 59/89 (66%), Gaps = 1/89 (1%)

Query: 1  MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYD-VKVRGTAQHIAERYSVLAR 59
          MR  +  KR RGR + GG GS  +   +   R +DSNG + VKVRG AQ + E+Y  LAR
Sbjct: 1  MRDFKGMKRQRGRNNRGGAGSGGKPQQHNANRAFDSNGPEGVKVRGAAQSVYEKYQQLAR 60

Query: 60 DAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
          DA S+GD V+AEN+LQHAEHY R++   Q
Sbjct: 61 DATSSGDRVLAENYLQHAEHYFRVLRAIQ 89


>gi|319404696|emb|CBI78298.1| conserved hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 243

 Score = 87.8 bits (216), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 42/73 (57%), Positives = 54/73 (73%)

Query: 30  LVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQA 89
           L RNY+SNG DVK+RG AQ IA++Y  LARDA  AGD V++EN+LQHAEHY RI+  A  
Sbjct: 26  LSRNYESNGPDVKIRGNAQQIADKYISLARDAQGAGDSVMSENYLQHAEHYLRIILAAND 85

Query: 90  QIQEKLQRDEQDD 102
           Q+    +RDE ++
Sbjct: 86  QMSYSHKRDENNE 98


>gi|319406183|emb|CBI79820.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 239

 Score = 87.8 bits (216), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 40/73 (54%), Positives = 54/73 (73%)

Query: 30  LVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQA 89
           L RNY+SNG D+K+RG AQ +A++Y  LARDA  AGD V++EN+LQHAEHY RI+  A  
Sbjct: 27  LSRNYESNGPDIKIRGNAQQVADKYISLARDAQGAGDRVMSENYLQHAEHYLRIILAATD 86

Query: 90  QIQEKLQRDEQDD 102
           Q+    +RDE ++
Sbjct: 87  QVSYSHKRDENNE 99


>gi|146337701|ref|YP_001202749.1| hypothetical protein BRADO0569 [Bradyrhizobium sp. ORS278]
 gi|146190507|emb|CAL74506.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 279

 Score = 87.4 bits (215), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 51/65 (78%)

Query: 29 PLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
          PL R ++SNG D+K+RGTA H+AE+Y  LARDA S+GD V AEN+ QHAEHY R+++ AQ
Sbjct: 27 PLTRVFESNGPDIKIRGTASHVAEKYVQLARDARSSGDPVAAENYYQHAEHYFRLIAAAQ 86

Query: 89 AQIQE 93
           Q ++
Sbjct: 87 EQFRQ 91


>gi|316932077|ref|YP_004107059.1| hypothetical protein Rpdx1_0689 [Rhodopseudomonas palustris DX-1]
 gi|315599791|gb|ADU42326.1| hypothetical protein Rpdx1_0689 [Rhodopseudomonas palustris DX-1]
          Length = 234

 Score = 87.4 bits (215), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 51/65 (78%)

Query: 29 PLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
          P+ R ++SNG D+K+RGTA HIAE+Y  LARDA S+GD V AEN+ QHAEHY R+++ AQ
Sbjct: 29 PMTRVFESNGPDIKIRGTASHIAEKYVQLARDARSSGDPVAAENYYQHAEHYFRLIAAAQ 88

Query: 89 AQIQE 93
           Q ++
Sbjct: 89 EQFRQ 93


>gi|91974577|ref|YP_567236.1| hypothetical protein RPD_0095 [Rhodopseudomonas palustris BisB5]
 gi|91681033|gb|ABE37335.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB5]
          Length = 241

 Score = 87.0 bits (214), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 37/61 (60%), Positives = 49/61 (80%)

Query: 28 NPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMA 87
          NP+ R ++SNG D+K+RGTA H+AE+Y  LARDA S+GD V AEN+ QHAEHY R+++ A
Sbjct: 31 NPMTRVFESNGPDIKIRGTASHVAEKYVQLARDARSSGDPVAAENYYQHAEHYFRLIAAA 90

Query: 88 Q 88
          Q
Sbjct: 91 Q 91


>gi|148258774|ref|YP_001243359.1| hypothetical protein BBta_7607 [Bradyrhizobium sp. BTAi1]
 gi|146410947|gb|ABQ39453.1| hypothetical protein BBta_7607 [Bradyrhizobium sp. BTAi1]
          Length = 284

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 51/65 (78%)

Query: 29 PLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
          PL R ++SNG D+K+RGTA H+AE+Y  LARDA S+GD V AEN+ QHAEHY R+++ AQ
Sbjct: 27 PLTRVFESNGPDIKIRGTASHVAEKYVQLARDARSSGDPVAAENYYQHAEHYFRLIAAAQ 86

Query: 89 AQIQE 93
           Q ++
Sbjct: 87 EQFRQ 91


>gi|254472278|ref|ZP_05085678.1| hypothetical Cytosolic Protein [Pseudovibrio sp. JE062]
 gi|211958561|gb|EEA93761.1| hypothetical Cytosolic Protein [Pseudovibrio sp. JE062]
          Length = 220

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 39/61 (63%), Positives = 48/61 (78%)

Query: 30 LVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQA 89
          + R Y+SNG DVK+RGTA HIAE+Y  LARDA ++GD V +EN+ QHAEHY RIV+ AQ 
Sbjct: 1  MTRTYESNGPDVKIRGTALHIAEKYQQLARDAQASGDRVTSENYYQHAEHYQRIVAAAQP 60

Query: 90 Q 90
          Q
Sbjct: 61 Q 61


>gi|121602492|ref|YP_988580.1| hypothetical protein BARBAKC583_0247 [Bartonella bacilliformis
          KC583]
 gi|120614669|gb|ABM45270.1| conserved hypothetical protein [Bartonella bacilliformis KC583]
          Length = 216

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/70 (58%), Positives = 52/70 (74%)

Query: 30 LVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQA 89
          L RNY+SNG D+KVRG AQ IA++Y  L+ DA  AGD V++EN+LQHAEHY RI+  A  
Sbjct: 26 LSRNYESNGPDIKVRGNAQQIADKYISLSYDAQGAGDRVMSENYLQHAEHYLRIILAAAG 85

Query: 90 QIQEKLQRDE 99
          Q+  + QRDE
Sbjct: 86 QMPPQNQRDE 95


>gi|85713814|ref|ZP_01044804.1| hypothetical protein NB311A_04719 [Nitrobacter sp. Nb-311A]
 gi|85699718|gb|EAQ37585.1| hypothetical protein NB311A_04719 [Nitrobacter sp. Nb-311A]
          Length = 233

 Score = 85.9 bits (211), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 37/61 (60%), Positives = 49/61 (80%)

Query: 28 NPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMA 87
          NP+ R ++SNG D+K+RGTA H+AE+Y  LARDA S+GD V AEN+ QHAEHY R+++ A
Sbjct: 28 NPMTRVFESNGPDIKIRGTASHVAEKYVQLARDARSSGDPVAAENYYQHAEHYFRLIAAA 87

Query: 88 Q 88
          Q
Sbjct: 88 Q 88


>gi|75674573|ref|YP_316994.1| hypothetical protein Nwi_0375 [Nitrobacter winogradskyi Nb-255]
 gi|74419443|gb|ABA03642.1| conserved hypothetical protein [Nitrobacter winogradskyi Nb-255]
          Length = 231

 Score = 85.1 bits (209), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 37/61 (60%), Positives = 49/61 (80%)

Query: 28 NPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMA 87
          NP+ R ++SNG D+K+RGTA H+AE+Y  LARDA S+GD V AEN+ QHAEHY R+++ A
Sbjct: 26 NPMTRVFESNGPDIKIRGTASHVAEKYLQLARDARSSGDPVAAENYYQHAEHYFRLIAAA 85

Query: 88 Q 88
          Q
Sbjct: 86 Q 86


>gi|92116089|ref|YP_575818.1| hypothetical protein Nham_0468 [Nitrobacter hamburgensis X14]
 gi|91798983|gb|ABE61358.1| conserved hypothetical protein [Nitrobacter hamburgensis X14]
          Length = 240

 Score = 85.1 bits (209), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 37/61 (60%), Positives = 49/61 (80%)

Query: 28 NPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMA 87
          NP+ R ++SNG D+K+RGTA H+AE+Y  LARDA S+GD V AEN+ QHAEHY R+++ A
Sbjct: 28 NPMTRVFESNGPDIKIRGTASHVAEKYVQLARDARSSGDPVAAENYYQHAEHYFRLIAAA 87

Query: 88 Q 88
          Q
Sbjct: 88 Q 88


>gi|115522192|ref|YP_779103.1| hypothetical protein RPE_0162 [Rhodopseudomonas palustris BisA53]
 gi|115516139|gb|ABJ04123.1| conserved hypothetical protein [Rhodopseudomonas palustris
          BisA53]
          Length = 251

 Score = 85.1 bits (209), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 37/61 (60%), Positives = 49/61 (80%)

Query: 28 NPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMA 87
          NP+ R ++SNG D+K+RGTA H+AE+Y  LARDA S+GD V AEN+ QHAEHY R+++ A
Sbjct: 33 NPMTRVFESNGPDIKIRGTASHVAEKYVQLARDARSSGDPVAAENYYQHAEHYFRLIAAA 92

Query: 88 Q 88
          Q
Sbjct: 93 Q 93


>gi|299132855|ref|ZP_07026050.1| conserved hypothetical protein [Afipia sp. 1NLS2]
 gi|298592992|gb|EFI53192.1| conserved hypothetical protein [Afipia sp. 1NLS2]
          Length = 228

 Score = 85.1 bits (209), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 37/60 (61%), Positives = 48/60 (80%)

Query: 29 PLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
          P+ R ++SNG D+K+RGTA HIAE+Y  LARDA S+GD V AEN+ QHAEHY R+++ AQ
Sbjct: 28 PMTRVFESNGPDIKIRGTASHIAEKYVQLARDARSSGDPVAAENYYQHAEHYFRLIAAAQ 87


>gi|319409236|emb|CBI82880.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 88

 Score = 84.7 bits (208), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 49/64 (76%)

Query: 28 NPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMA 87
          NPL RNY+SNG DVK+RG AQ IA++Y  LARDA  AGD V++EN+LQHAEHY RI+  A
Sbjct: 22 NPLSRNYESNGPDVKIRGNAQQIADKYISLARDAQGAGDRVMSENYLQHAEHYLRIILAA 81

Query: 88 QAQI 91
             I
Sbjct: 82 VGHI 85


>gi|319899310|ref|YP_004159407.1| hypothetical protein BARCL_1165 [Bartonella clarridgeiae 73]
 gi|319403278|emb|CBI76837.1| conserved protein of unknown function [Bartonella clarridgeiae
          73]
          Length = 233

 Score = 84.7 bits (208), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 39/62 (62%), Positives = 48/62 (77%)

Query: 30 LVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQA 89
          L RNY+SNG DVK+RG AQ IA++Y  LARDA  AGD V++EN+LQHAEHY RI+  A  
Sbjct: 28 LSRNYESNGPDVKIRGNAQQIADKYIGLARDAQGAGDRVMSENYLQHAEHYLRIILAAAD 87

Query: 90 QI 91
          Q+
Sbjct: 88 QM 89


>gi|330994786|ref|ZP_08318708.1| hypothetical protein SXCC_04673 [Gluconacetobacter sp. SXCC-1]
 gi|329758047|gb|EGG74569.1| hypothetical protein SXCC_04673 [Gluconacetobacter sp. SXCC-1]
          Length = 245

 Score = 81.3 bits (199), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 60/92 (65%), Gaps = 8/92 (8%)

Query: 1   MRSVQQYKRSRGR-----GSNGGNGSFNRKNLNPLVRN--YDSNGYDVKVRGTAQHIAER 53
           +R +   KR RGR     GSNGG+   N   + PL RN  +DSNG D++VRGTAQ + E+
Sbjct: 53  LRQLMNMKRMRGRHNRSGGSNGGSVRHNNGQI-PLNRNHVFDSNGPDLRVRGTAQQLFEK 111

Query: 54  YSVLARDAMSAGDYVVAENHLQHAEHYNRIVS 85
           Y  L RDA S GD V+AE + QHAEHY RI++
Sbjct: 112 YLQLGRDASSTGDRVMAEAYFQHAEHYFRILN 143


>gi|154252201|ref|YP_001413025.1| hypothetical protein Plav_1749 [Parvibaculum lavamentivorans
          DS-1]
 gi|154156151|gb|ABS63368.1| conserved hypothetical protein [Parvibaculum lavamentivorans
          DS-1]
          Length = 248

 Score = 81.3 bits (199), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 51/77 (66%), Gaps = 8/77 (10%)

Query: 8  KRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDY 67
          KRSRGRG      S NR         YDSNG DVKVRGTA  + E+Y  LARDA+SAGD 
Sbjct: 9  KRSRGRGRKPQQHSANRA--------YDSNGPDVKVRGTAATVCEKYQQLARDAISAGDR 60

Query: 68 VVAENHLQHAEHYNRIV 84
          V AEN+ QHAEHY R++
Sbjct: 61 VTAENYYQHAEHYYRLL 77


>gi|209542326|ref|YP_002274555.1| hypothetical protein Gdia_0140 [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209530003|gb|ACI49940.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 144

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 65/101 (64%), Gaps = 11/101 (10%)

Query: 8   KRSRGR-----GSNGGNGSFNRKNLN-PLVRN--YDSNGYDVKVRGTAQHIAERYSVLAR 59
           KR RGR     GSNGG  S  ++N   PL RN  +DSNG D+++RGTAQ + E+Y  L R
Sbjct: 4   KRMRGRHHRSGGSNGG--SIRQQNGQIPLNRNHVFDSNGPDLRIRGTAQQLFEKYLQLGR 61

Query: 60  DAMSAGDYVVAENHLQHAEHYNRIV-SMAQAQIQEKLQRDE 99
           DA  +GD V+AE + QHAEHY RI+ +M QA  Q +  R E
Sbjct: 62  DASGSGDRVMAEAYFQHAEHYFRILNAMTQAAQQNQQDRQE 102


>gi|296116161|ref|ZP_06834779.1| hypothetical protein GXY_10204 [Gluconacetobacter hansenii ATCC
          23769]
 gi|295977267|gb|EFG84027.1| hypothetical protein GXY_10204 [Gluconacetobacter hansenii ATCC
          23769]
          Length = 172

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 56/85 (65%), Gaps = 8/85 (9%)

Query: 8  KRSRGR-----GSNGGNGSFNRKNLNPLVRN--YDSNGYDVKVRGTAQHIAERYSVLARD 60
          KR RGR     GSNGG    N   + PL RN  +DSNG D++VRGTAQ + E+Y  L RD
Sbjct: 4  KRMRGRHHRSGGSNGGGTRHNNGQI-PLNRNHVFDSNGPDLRVRGTAQQLFEKYLQLGRD 62

Query: 61 AMSAGDYVVAENHLQHAEHYNRIVS 85
          A  AGD V+AE + QHAEHY RI++
Sbjct: 63 ASGAGDRVMAEAYFQHAEHYFRILN 87


>gi|315500226|ref|YP_004089029.1| cytosolic protein [Asticcacaulis excentricus CB 48]
 gi|315418238|gb|ADU14878.1| cytosolic protein [Asticcacaulis excentricus CB 48]
          Length = 318

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 61/94 (64%), Gaps = 11/94 (11%)

Query: 8  KRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYD-VKVRGTAQHIAERYSVLARDAMSAGD 66
          +RSR R  +G     N+ N N   R Y+SNG D  KVRG AQ I E+Y  LARDA S+GD
Sbjct: 4  QRSRNRKPSG-----NQNNPN---RAYESNGPDGAKVRGNAQTIYEKYQQLARDANSSGD 55

Query: 67 YVVAENHLQHAEHYNRIVSMAQAQ--IQEKLQRD 98
           V+AEN+LQHAEHY R++   Q Q  + E LQRD
Sbjct: 56 RVLAENYLQHAEHYFRLIRQMQPQRPVSEFLQRD 89


>gi|329847924|ref|ZP_08262952.1| hypothetical protein ABI_09930 [Asticcacaulis biprosthecum C19]
 gi|328842987|gb|EGF92556.1| hypothetical protein ABI_09930 [Asticcacaulis biprosthecum C19]
          Length = 377

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/101 (47%), Positives = 61/101 (60%), Gaps = 8/101 (7%)

Query: 1  MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYD-VKVRGTAQHIAERYSVLAR 59
          M+  +  KR R R     +G+ N  N     R Y+SNG +  KVRG AQ I E+Y  LAR
Sbjct: 1  MKDFRGMKRQRNRNRKPSSGNQNNPN-----RAYESNGPEGTKVRGNAQTIYEKYQQLAR 55

Query: 60 DAMSAGDYVVAENHLQHAEHYNRIVSMAQAQ--IQEKLQRD 98
          DA S+GD V+AENHLQHAEHY R++   Q    + E +QRD
Sbjct: 56 DANSSGDRVLAENHLQHAEHYFRMIRQMQPTRPVSEFVQRD 96


>gi|197104292|ref|YP_002129669.1| hypothetical protein PHZ_c0826 [Phenylobacterium zucineum HLK1]
 gi|196477712|gb|ACG77240.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 316

 Score = 78.2 bits (191), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 51/71 (71%), Gaps = 3/71 (4%)

Query: 32 RNYDSNGYD-VKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQ 90
          R +DSNG D VKVRG AQH+ E+Y  LARDA S+GD V+AEN+LQHAEHY R++   Q Q
Sbjct: 29 RAFDSNGPDGVKVRGNAQHVFEKYQQLARDATSSGDRVLAENYLQHAEHYFRLLRAIQPQ 88

Query: 91 --IQEKLQRDE 99
              E L RD+
Sbjct: 89 RPAAEILGRDQ 99


>gi|163735801|ref|ZP_02143230.1| hypothetical protein RLO149_00600 [Roseobacter litoralis Och 149]
 gi|161390887|gb|EDQ15227.1| hypothetical protein RLO149_00600 [Roseobacter litoralis Och 149]
          Length = 183

 Score = 77.0 bits (188), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 96/194 (49%), Gaps = 26/194 (13%)

Query: 8   KRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDY 67
           K +R R SN G    NR         +DS+G + KVRGT Q I E+Y+ L RDA  + D 
Sbjct: 11  KGNRNRSSNQGGNVVNRV--------FDSSGPEGKVRGTPQQIIEKYNQLTRDAQLSNDR 62

Query: 68  VVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLI 127
           V AEN  QHAEHY R++S AQ +I  + +  E+ +   + +++R +    E +A+    +
Sbjct: 63  VAAENFQQHAEHYTRMLSEAQREIDARREEQERQNRERQAERDRERAERQERDAANAAAV 122

Query: 128 EEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEA 187
            E  +P+ E   Q +VE    +TP+       S  K +R     PR  P AK    P  A
Sbjct: 123 VE--QPVVEAPEQ-EVESGLVETPE-------SQPKPKR----APRRKPRAK----PAPA 164

Query: 188 TETIVPQELNSDNA 201
           T+   P     D+A
Sbjct: 165 TDESTPPASGGDDA 178


>gi|58038519|ref|YP_190483.1| hypothetical protein GOX0029 [Gluconobacter oxydans 621H]
 gi|58000933|gb|AAW59827.1| Hypothetical protein GOX0029 [Gluconobacter oxydans 621H]
          Length = 150

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 55/86 (63%), Gaps = 4/86 (4%)

Query: 8  KRSRGRGSNGGNGSFNRKNL-NPLVRN--YDSNGYDVKVRGTAQHIAERYSVLARDAMSA 64
          KR RGR    G+G     N   PL RN  +DSNG D++VRGTAQ + E+Y  L RDA   
Sbjct: 2  KRIRGRHHRAGSGPSRSSNAQTPLNRNHVFDSNGPDLRVRGTAQQLFEKYLQLGRDATGT 61

Query: 65 GDYVVAENHLQHAEHYNRIV-SMAQA 89
          GD ++AE + QHAEHY RI+ +M QA
Sbjct: 62 GDRILAEAYFQHAEHYFRILNAMNQA 87


>gi|329113399|ref|ZP_08242180.1| Hypothetical protein APO_0164 [Acetobacter pomorum DM001]
 gi|326697224|gb|EGE48884.1| Hypothetical protein APO_0164 [Acetobacter pomorum DM001]
          Length = 143

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 76/131 (58%), Gaps = 7/131 (5%)

Query: 9   RSRGRGSNGGNGSFNRKNLN-PLVRN--YDSNGYDVKVRGTAQHIAERYSVLARDAMSAG 65
           R+R   SNG NGS  + N   P+ RN  +DS+G DV+VRGTAQ + E+Y  L RD+  +G
Sbjct: 7   RTRHHRSNGSNGSSRQLNGQIPMNRNHVFDSHGPDVRVRGTAQQLFEKYLQLGRDSTGSG 66

Query: 66  DYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQ---NALSEFEAS 122
           D V AE + QHAEHY RI++      Q+  Q +  + L  ++Q+  AQ   +     E +
Sbjct: 67  DRVAAEGYFQHAEHYFRIMNAMAQAAQQSQQ-ERAERLAARQQRAVAQTNEDGEDRQENA 125

Query: 123 PCPLIEEGKEP 133
           P P I+E  EP
Sbjct: 126 PQPDIQEESEP 136


>gi|288956984|ref|YP_003447325.1| hypothetical protein AZL_001430 [Azospirillum sp. B510]
 gi|288909292|dbj|BAI70781.1| hypothetical protein AZL_001430 [Azospirillum sp. B510]
          Length = 145

 Score = 75.9 bits (185), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 47/64 (73%), Gaps = 4/64 (6%)

Query: 34  YDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQE 93
           +DSNG DV++RG A  + E+Y  LARDAMS+GD V AEN+LQHAEHY RI++    QIQE
Sbjct: 44  FDSNGPDVRIRGNAWQVQEKYQALARDAMSSGDRVQAENYLQHAEHYLRIIN----QIQE 99

Query: 94  KLQR 97
              R
Sbjct: 100 SENR 103


>gi|258542230|ref|YP_003187663.1| hypothetical protein APA01_11350 [Acetobacter pasteurianus IFO
          3283-01]
 gi|256633308|dbj|BAH99283.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01]
 gi|256636367|dbj|BAI02336.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03]
 gi|256639420|dbj|BAI05382.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07]
 gi|256642476|dbj|BAI08431.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22]
 gi|256645531|dbj|BAI11479.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26]
 gi|256648584|dbj|BAI14525.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32]
 gi|256651637|dbj|BAI17571.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654628|dbj|BAI20555.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12]
          Length = 143

 Score = 75.5 bits (184), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 54/80 (67%), Gaps = 3/80 (3%)

Query: 9  RSRGRGSNGGNGSFNRKNLN-PLVRN--YDSNGYDVKVRGTAQHIAERYSVLARDAMSAG 65
          R+R   SNG NGS  + N   P+ RN  +DS+G DV+VRGTAQ + E+Y  L RD+  +G
Sbjct: 7  RTRNHRSNGSNGSSRQLNGQIPMNRNHVFDSHGPDVRVRGTAQQLFEKYLQLGRDSTGSG 66

Query: 66 DYVVAENHLQHAEHYNRIVS 85
          D V AE + QHAEHY RI++
Sbjct: 67 DRVAAEGYFQHAEHYFRIMN 86


>gi|302381614|ref|YP_003817437.1| hypothetical protein Bresu_0499 [Brevundimonas subvibrioides ATCC
          15264]
 gi|302192242|gb|ADK99813.1| conserved hypothetical protein [Brevundimonas subvibrioides ATCC
          15264]
          Length = 360

 Score = 75.5 bits (184), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 46/91 (50%), Positives = 57/91 (62%), Gaps = 1/91 (1%)

Query: 1  MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYD-VKVRGTAQHIAERYSVLAR 59
          MR  +  KR RGR    G GS    N     R++DS G + +KVRG AQ + ERY  LAR
Sbjct: 1  MRDFKGMKRQRGRNRKPGGGSGGNANAANPNRSWDSQGPENIKVRGNAQTVYERYQQLAR 60

Query: 60 DAMSAGDYVVAENHLQHAEHYNRIVSMAQAQ 90
          DA S+GD V+AEN+LQHAEHY R++   Q Q
Sbjct: 61 DAGSSGDRVLAENYLQHAEHYFRVLRALQPQ 91


>gi|114569199|ref|YP_755879.1| hypothetical protein Mmar10_0648 [Maricaulis maris MCS10]
 gi|114339661|gb|ABI64941.1| conserved hypothetical protein [Maricaulis maris MCS10]
          Length = 250

 Score = 74.7 bits (182), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 50/81 (61%), Gaps = 9/81 (11%)

Query: 8  KRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDY 67
          KR RGRG         RK  N   R+Y+SNG +VK+RG A  I ++Y  LARDA  AGD 
Sbjct: 2  KRQRGRG---------RKPGNSANRSYESNGPEVKIRGNASQIYDKYMQLARDASLAGDR 52

Query: 68 VVAENHLQHAEHYNRIVSMAQ 88
          V AEN  QHAEHY RIV + Q
Sbjct: 53 VRAENLFQHAEHYLRIVQLNQ 73


>gi|296533066|ref|ZP_06895710.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957]
 gi|296266610|gb|EFH12591.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957]
          Length = 140

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 48/66 (72%), Gaps = 2/66 (3%)

Query: 22 FNRKNLNPLVRN--YDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEH 79
          F + N  P+ RN  +DSNG D+++RGTAQ + E+Y  L RDA  AGD V+AE++ QHAEH
Sbjct: 21 FRQNNHQPMNRNHVFDSNGPDMRLRGTAQQLFEKYLQLGRDATGAGDRVMAESYFQHAEH 80

Query: 80 YNRIVS 85
          Y RI++
Sbjct: 81 YFRILN 86


>gi|126736397|ref|ZP_01752139.1| hypothetical protein RCCS2_01359 [Roseobacter sp. CCS2]
 gi|126714218|gb|EBA11087.1| hypothetical protein RCCS2_01359 [Roseobacter sp. CCS2]
          Length = 184

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/84 (48%), Positives = 58/84 (69%), Gaps = 2/84 (2%)

Query: 28  NPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMA 87
           N + R +DS+G D KVRGT Q I E+Y+ L RDA+ +GD V AEN  QHAEHY R+++ A
Sbjct: 35  NIINRVFDSSGPDGKVRGTPQQIIEKYNQLHRDAVLSGDRVDAENFAQHAEHYTRLLAEA 94

Query: 88  QAQIQEKLQRDEQDDLLVKEQKER 111
           Q +++ K  R+EQ++   + Q ER
Sbjct: 95  QREVEAK--REEQEEQNRQRQAER 116


>gi|149204048|ref|ZP_01881016.1| hypothetical protein RTM1035_11020 [Roseovarius sp. TM1035]
 gi|149142490|gb|EDM30535.1| hypothetical protein RTM1035_11020 [Roseovarius sp. TM1035]
          Length = 246

 Score = 72.8 bits (177), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/79 (50%), Positives = 54/79 (68%), Gaps = 2/79 (2%)

Query: 23  NRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNR 82
           NR   N + R +DS+G + KVRGT Q I E+Y+ LARDA  AGD V  EN  QHAEHY R
Sbjct: 15  NRTVGNVVNRVFDSSGPEGKVRGTPQQIIEKYNQLARDAQLAGDRVATENFQQHAEHYLR 74

Query: 83  IVSMAQAQIQEKLQRDEQD 101
           ++S  +AQ ++  +R+EQ+
Sbjct: 75  LLS--EAQKEQDARREEQE 91


>gi|114766147|ref|ZP_01445151.1| hypothetical protein 1100011001352_R2601_24315 [Pelagibaca
           bermudensis HTCC2601]
 gi|114541607|gb|EAU44649.1| hypothetical protein R2601_24315 [Roseovarius sp. HTCC2601]
          Length = 238

 Score = 72.0 bits (175), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 40/84 (47%), Positives = 56/84 (66%), Gaps = 2/84 (2%)

Query: 32  RNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQI 91
           R +DSNG + KVRGT Q I ++Y+ LARDA    D V AEN  QHAEHY R++S AQ ++
Sbjct: 25  RVFDSNGPEGKVRGTPQQIIDKYNQLARDAALGNDRVAAENFQQHAEHYLRMLSEAQREV 84

Query: 92  QEKLQRDEQDDLLVKEQ--KERAQ 113
             K ++ E+++   + Q  KERA+
Sbjct: 85  DAKREQQERENRERQAQRDKERAE 108


>gi|304321741|ref|YP_003855384.1| hypothetical protein PB2503_10974 [Parvularcula bermudensis
          HTCC2503]
 gi|303300643|gb|ADM10242.1| hypothetical protein PB2503_10974 [Parvularcula bermudensis
          HTCC2503]
          Length = 199

 Score = 72.0 bits (175), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 52/82 (63%), Gaps = 13/82 (15%)

Query: 11 RGRGSN----GGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGD 66
          RGR SN    GGN        NP  R++DS G +VK+RGTA  I ++Y  LARDA S+GD
Sbjct: 7  RGRNSNRRRQGGN--------NP-NRSFDSTGPEVKIRGTATQIYDKYQALARDAASSGD 57

Query: 67 YVVAENHLQHAEHYNRIVSMAQ 88
           + AE+ LQHAEHY R++   Q
Sbjct: 58 RIRAESLLQHAEHYFRMMKAMQ 79


>gi|163793917|ref|ZP_02187891.1| hypothetical protein BAL199_12831 [alpha proteobacterium BAL199]
 gi|159181028|gb|EDP65545.1| hypothetical protein BAL199_12831 [alpha proteobacterium BAL199]
          Length = 369

 Score = 71.6 bits (174), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 43/55 (78%)

Query: 34 YDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
          +DSNG DV++RG A  + E+Y  LARDA ++GD V+AE++ QHAEHY RI+S+ Q
Sbjct: 28 FDSNGPDVRIRGNATQVHEKYLNLARDAAASGDRVLAESYFQHAEHYYRILSVFQ 82


>gi|56697310|ref|YP_167676.1| hypothetical protein SPO2459 [Ruegeria pomeroyi DSS-3]
 gi|56679047|gb|AAV95713.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3]
          Length = 236

 Score = 71.6 bits (174), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 53/80 (66%), Gaps = 2/80 (2%)

Query: 32  RNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQI 91
           R +DS+G + KVRGT Q I E+Y+ LARDA  A D V AEN  QHAEHY R++S AQ +I
Sbjct: 50  RVFDSSGPEGKVRGTPQQIIEKYNQLARDAQLANDRVAAENFQQHAEHYLRLLSEAQREI 109

Query: 92  QEKLQRDEQDDLLVKEQKER 111
               +R+EQ+    + Q ER
Sbjct: 110 D--ARREEQERQNRERQAER 127


>gi|84503527|ref|ZP_01001578.1| hypothetical protein OB2597_03469 [Oceanicola batsensis HTCC2597]
 gi|84388017|gb|EAQ01065.1| hypothetical protein OB2597_03469 [Oceanicola batsensis HTCC2597]
          Length = 189

 Score = 71.6 bits (174), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 55/84 (65%), Gaps = 2/84 (2%)

Query: 28  NPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMA 87
           N + R +DS+G + KVRGT Q I ++Y+ LARDA   GD V  EN  QHAEHY R++  A
Sbjct: 20  NIVNRVFDSSGPEGKVRGTPQQIIDKYNQLARDAQLGGDRVATENFQQHAEHYLRMLGSA 79

Query: 88  QAQIQEKLQRDEQDDLLVKEQKER 111
           Q + QEK QR++QD    K Q ER
Sbjct: 80  QKE-QEK-QREQQDAENRKRQSER 101


>gi|209965907|ref|YP_002298822.1| hypothetical protein RC1_2635 [Rhodospirillum centenum SW]
 gi|209959373|gb|ACJ00010.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 133

 Score = 71.6 bits (174), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 46/68 (67%), Gaps = 4/68 (5%)

Query: 33  NYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQ 92
            +DSNG DV++RG A  I E+Y  LARDA ++GD V AEN+LQHAEHY RI+     QI 
Sbjct: 32  TFDSNGPDVRIRGNAFQIYEKYQALARDAQASGDRVAAENYLQHAEHYYRII----CQIN 87

Query: 93  EKLQRDEQ 100
           E+  R  Q
Sbjct: 88  EQESRQRQ 95


>gi|310816143|ref|YP_003964107.1| hypothetical protein EIO_1685 [Ketogulonicigenium vulgare Y25]
 gi|308754878|gb|ADO42807.1| conserved hypothetical protein [Ketogulonicigenium vulgare Y25]
          Length = 209

 Score = 71.2 bits (173), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 66/115 (57%), Gaps = 10/115 (8%)

Query: 1   MRSVQQYKRSRGRGS-NGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLAR 59
           MRS     +SR RG+ N  N  F    +N   R +DS+G D KVRGT Q I E+Y+ L R
Sbjct: 1   MRS----SKSRSRGNKNRNNRPFGGNIIN---RVFDSSGPDGKVRGTPQQIIEKYNQLHR 53

Query: 60  DAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQD--DLLVKEQKERA 112
           DA  +GD V AEN  QHAEHY R+++ AQ ++    +  EQ   D   +  +ERA
Sbjct: 54  DAQLSGDRVNAENFAQHAEHYTRMLAEAQREVDRAREEAEQANRDRQAERDRERA 108


>gi|254461412|ref|ZP_05074828.1| conserved hypothetical protein [Rhodobacterales bacterium HTCC2083]
 gi|206678001|gb|EDZ42488.1| conserved hypothetical protein [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 191

 Score = 71.2 bits (173), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 55/80 (68%)

Query: 32  RNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQI 91
           R +DS+G + KVRGT Q I ++Y  LARD+  +GD V  EN  QHAEHY R++S AQ +I
Sbjct: 26  RVFDSSGPEGKVRGTPQQIIDKYQQLARDSQLSGDRVATENFSQHAEHYLRMLSAAQKEI 85

Query: 92  QEKLQRDEQDDLLVKEQKER 111
            E+ ++ E+++   + +++R
Sbjct: 86  DERREQQERENRERQAERDR 105


>gi|260433482|ref|ZP_05787453.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260417310|gb|EEX10569.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 192

 Score = 71.2 bits (173), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 47/101 (46%), Positives = 60/101 (59%), Gaps = 9/101 (8%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MRS     +SR R  N  N       +N   R +DS+G + KVRGT Q I ++Y+ LARD
Sbjct: 1   MRS----SKSRSRAKNNRNRPSGGNVVN---RVFDSSGPEGKVRGTPQQIIDKYNQLARD 53

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQD 101
           A  A D V AEN  QHAEHY R++S AQ +I  +  RDEQ+
Sbjct: 54  AQLANDRVAAENFQQHAEHYLRLLSEAQREIDAR--RDEQE 92


>gi|328542099|ref|YP_004302208.1| Retinitis pigmentosa 1-like 1 protein [polymorphum gilvum
          SL003B-26A1]
 gi|326411849|gb|ADZ68912.1| Retinitis pigmentosa 1-like 1 protein [Polymorphum gilvum
          SL003B-26A1]
          Length = 246

 Score = 71.2 bits (173), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 31/51 (60%), Positives = 41/51 (80%)

Query: 41 VKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQI 91
          +K+RGTA HIAE+Y  LARDA ++GD V++EN+ QHAEHY RIV+ AQ  +
Sbjct: 1  MKIRGTALHIAEKYQQLARDAQASGDRVMSENYFQHAEHYYRIVAAAQPNL 51


>gi|85705324|ref|ZP_01036423.1| hypothetical protein ROS217_17687 [Roseovarius sp. 217]
 gi|85670197|gb|EAQ25059.1| hypothetical protein ROS217_17687 [Roseovarius sp. 217]
          Length = 228

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/86 (47%), Positives = 52/86 (60%), Gaps = 6/86 (6%)

Query: 23  NRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNR 82
           NR   N + R +DS+G + KVRGT Q I E+Y+ LARDA  +GD V  EN  QHAEHY R
Sbjct: 15  NRTVGNVVNRVFDSSGPEGKVRGTPQQIIEKYNQLARDAQLSGDRVATENFQQHAEHYLR 74

Query: 83  IVSMAQAQI------QEKLQRDEQDD 102
           ++  AQ +       QE+  RD Q D
Sbjct: 75  LLGEAQKEQDARREEQERYNRDRQTD 100


>gi|254293184|ref|YP_003059207.1| hypothetical protein Hbal_0816 [Hirschia baltica ATCC 49814]
 gi|254041715|gb|ACT58510.1| conserved hypothetical protein [Hirschia baltica ATCC 49814]
          Length = 180

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/77 (51%), Positives = 48/77 (62%), Gaps = 9/77 (11%)

Query: 8  KRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDY 67
          KR RGRG         RK  N   R+ +SNG +VK+RG+A  I E+Y   ARDA +AGD 
Sbjct: 2  KRQRGRG---------RKPNNSGNRSLESNGPEVKIRGSASQIYEKYVQYARDAQTAGDR 52

Query: 68 VVAENHLQHAEHYNRIV 84
          V AEN  QHAEHY RI+
Sbjct: 53 VKAENLFQHAEHYYRIM 69


>gi|254500180|ref|ZP_05112331.1| hypothetical protein SADFL11_216 [Labrenzia alexandrii DFL-11]
 gi|222436251|gb|EEE42930.1| hypothetical protein SADFL11_216 [Labrenzia alexandrii DFL-11]
          Length = 200

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/64 (54%), Positives = 47/64 (73%), Gaps = 2/64 (3%)

Query: 41  VKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQA--QIQEKLQRD 98
           +K+RGTA H+AE+Y  LARDA ++GD V++EN+ QHAEHY RIV+ AQ   Q  +   R+
Sbjct: 1   MKIRGTAMHVAEKYQQLARDAQASGDRVMSENYNQHAEHYLRIVAAAQPPQQNTQHTARN 60

Query: 99  EQDD 102
           E DD
Sbjct: 61  EADD 64


>gi|295690767|ref|YP_003594460.1| cytosolic protein [Caulobacter segnis ATCC 21756]
 gi|295432670|gb|ADG11842.1| cytosolic protein [Caulobacter segnis ATCC 21756]
          Length = 372

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 44/58 (75%), Gaps = 1/58 (1%)

Query: 32 RNYDSNGYD-VKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
          R +DSNG + VKVRG AQ + E+Y  LARDA S+GD V+AEN+LQHAEHY R++   Q
Sbjct: 30 RAFDSNGPEGVKVRGAAQSVYEKYQQLARDASSSGDRVLAENYLQHAEHYFRVLRAIQ 87


>gi|89070963|ref|ZP_01158189.1| hypothetical protein OG2516_03478 [Oceanicola granulosus HTCC2516]
 gi|89043470|gb|EAR49684.1| hypothetical protein OG2516_03478 [Oceanicola granulosus HTCC2516]
          Length = 165

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/78 (48%), Positives = 52/78 (66%), Gaps = 2/78 (2%)

Query: 34  YDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQE 93
           +DS+G D KVRGT Q I ++Y+ L RDA  AGD V AEN  QHAEHY R+++ A  ++ +
Sbjct: 2   FDSSGPDGKVRGTPQQIIDKYNQLHRDAQLAGDRVDAENFAQHAEHYTRMLAEATKEVDQ 61

Query: 94  KLQRDEQDDLLVKEQKER 111
           K  R+EQ+    + Q ER
Sbjct: 62  K--REEQERQNRERQAER 77


>gi|83953608|ref|ZP_00962329.1| hypothetical protein NAS141_05273 [Sulfitobacter sp. NAS-14.1]
 gi|83841553|gb|EAP80722.1| hypothetical protein NAS141_05273 [Sulfitobacter sp. NAS-14.1]
          Length = 230

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/84 (48%), Positives = 57/84 (67%), Gaps = 6/84 (7%)

Query: 28  NPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMA 87
           N + R +DS+G + KVRGT Q I E+Y+ LARDA  + D V AEN  QHAEHY R++S A
Sbjct: 22  NVVNRVFDSSGPEGKVRGTPQQIIEKYNQLARDAQLSNDRVAAENFQQHAEHYLRMLSEA 81

Query: 88  QAQIQEKLQRDEQDDLLVKEQKER 111
           Q +I ++  RD+Q+    +E +ER
Sbjct: 82  QREIDQR--RDQQE----RENRER 99


>gi|16125129|ref|NP_419693.1| hypothetical protein CC_0876 [Caulobacter crescentus CB15]
 gi|221233857|ref|YP_002516293.1| cytosolic protein [Caulobacter crescentus NA1000]
 gi|13422137|gb|AAK22861.1| hypothetical protein CC_0876 [Caulobacter crescentus CB15]
 gi|220963029|gb|ACL94385.1| hypothetical cytosolic protein [Caulobacter crescentus NA1000]
          Length = 370

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 44/58 (75%), Gaps = 1/58 (1%)

Query: 32 RNYDSNGYD-VKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
          R +DSNG + VKVRG AQ + E+Y  LARDA S+GD V+AEN+LQHAEHY R++   Q
Sbjct: 30 RAFDSNGPEGVKVRGAAQSVYEKYQQLARDASSSGDRVLAENYLQHAEHYFRVLRAIQ 87


>gi|83592091|ref|YP_425843.1| hypothetical protein Rru_A0752 [Rhodospirillum rubrum ATCC 11170]
 gi|83575005|gb|ABC21556.1| hypothetical protein Rru_A0752 [Rhodospirillum rubrum ATCC 11170]
          Length = 315

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/87 (43%), Positives = 51/87 (58%), Gaps = 11/87 (12%)

Query: 1  MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRN--YDSNGYDVKVRGTAQHIAERYSVLA 58
          M++     R RGR  NG           P  RN  +DSNG  V+VRG AQ + E+Y  +A
Sbjct: 13 MKNANSRGRPRGRSMNG---------KRPPNRNQVFDSNGPGVRVRGNAQQLVEKYLAMA 63

Query: 59 RDAMSAGDYVVAENHLQHAEHYNRIVS 85
          RDA S GD ++AEN  QHA+HY R+++
Sbjct: 64 RDASSQGDRILAENCHQHADHYQRVLN 90


>gi|110680312|ref|YP_683319.1| hypothetical protein RD1_3125 [Roseobacter denitrificans OCh 114]
 gi|109456428|gb|ABG32633.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114]
          Length = 187

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 55/85 (64%), Gaps = 5/85 (5%)

Query: 20  GSFNRKN---LNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQH 76
           G+ NR N    N + R +DS+G + KVRGT Q I E+Y+ L RDA  + D V AEN  QH
Sbjct: 12  GNRNRSNNQGGNVVNRVFDSSGPEGKVRGTPQQIIEKYNQLTRDAQLSNDRVAAENFQQH 71

Query: 77  AEHYNRIVSMAQAQIQEKLQRDEQD 101
           AEHY R++S AQ +I  +  R+EQ+
Sbjct: 72  AEHYTRMLSEAQREIDAR--REEQE 94


>gi|83942388|ref|ZP_00954849.1| hypothetical protein EE36_15147 [Sulfitobacter sp. EE-36]
 gi|83846481|gb|EAP84357.1| hypothetical protein EE36_15147 [Sulfitobacter sp. EE-36]
          Length = 227

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/84 (48%), Positives = 57/84 (67%), Gaps = 6/84 (7%)

Query: 28  NPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMA 87
           N + R +DS+G + KVRGT Q I E+Y+ LARDA  + D V AEN  QHAEHY R++S A
Sbjct: 22  NVVNRVFDSSGPEGKVRGTPQQIIEKYNQLARDAQLSNDRVAAENFQQHAEHYLRMLSEA 81

Query: 88  QAQIQEKLQRDEQDDLLVKEQKER 111
           Q +I ++  RD+Q+    +E +ER
Sbjct: 82  QREIDQR--RDQQE----RENRER 99


>gi|114768930|ref|ZP_01446556.1| hypothetical protein OM2255_04350 [alpha proteobacterium HTCC2255]
 gi|114549847|gb|EAU52728.1| hypothetical protein OM2255_04350 [alpha proteobacterium HTCC2255]
          Length = 169

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/87 (43%), Positives = 58/87 (66%), Gaps = 6/87 (6%)

Query: 28  NPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMA 87
           N + R +DS+G + +VRGT Q I ++Y  LA DAM AGD +  EN LQH+EHY+R++ +A
Sbjct: 22  NVINRVFDSSGPEGRVRGTPQQIIDKYQSLASDAMLAGDRIAHENFLQHSEHYSRLLVVA 81

Query: 88  QAQIQEKLQRDEQDDLLVKEQKERAQN 114
           Q ++  K  R++Q     K+ + R+QN
Sbjct: 82  QKELDAK--REQQQ----KQHENRSQN 102


>gi|148260025|ref|YP_001234152.1| hypothetical protein Acry_1016 [Acidiphilium cryptum JF-5]
 gi|326403019|ref|YP_004283100.1| hypothetical protein ACMV_08710 [Acidiphilium multivorum AIU301]
 gi|146401706|gb|ABQ30233.1| hypothetical protein Acry_1016 [Acidiphilium cryptum JF-5]
 gi|325049880|dbj|BAJ80218.1| hypothetical protein ACMV_08710 [Acidiphilium multivorum AIU301]
          Length = 143

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/65 (56%), Positives = 47/65 (72%), Gaps = 3/65 (4%)

Query: 28 NPLVRN--YDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVS 85
           PL RN  +DSNG + +VRGTAQ + ++Y  L RDA  AGD V+AE++ QHAEHY RI+S
Sbjct: 26 TPLNRNHVFDSNGPEQRVRGTAQQLYDKYQQLGRDASGAGDRVLAESYFQHAEHYFRIIS 85

Query: 86 -MAQA 89
           M QA
Sbjct: 86 AMNQA 90


>gi|163746455|ref|ZP_02153813.1| hypothetical protein OIHEL45_13660 [Oceanibulbus indolifex HEL-45]
 gi|161380340|gb|EDQ04751.1| hypothetical protein OIHEL45_13660 [Oceanibulbus indolifex HEL-45]
          Length = 205

 Score = 69.3 bits (168), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 50/70 (71%), Gaps = 2/70 (2%)

Query: 32  RNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQI 91
           R +DS+G + KVRGT Q + E+Y+ LARDA  + D V AEN  QHAEHY R++S AQ ++
Sbjct: 29  RVFDSSGPEGKVRGTPQQVIEKYNQLARDAQLSNDRVAAENFQQHAEHYLRLLSEAQREV 88

Query: 92  QEKLQRDEQD 101
            ++  R+EQ+
Sbjct: 89  DQR--REEQE 96


>gi|260576767|ref|ZP_05844752.1| conserved hypothetical protein [Rhodobacter sp. SW2]
 gi|259021019|gb|EEW24330.1| conserved hypothetical protein [Rhodobacter sp. SW2]
          Length = 250

 Score = 69.3 bits (168), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 42/60 (70%)

Query: 32 RNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQI 91
          R +DS+G D KVRGT Q I E+Y  LARDA  + D V AEN  QHAEHY R+++ AQ ++
Sbjct: 24 RVFDSSGPDGKVRGTPQQIIEKYLFLARDAQLSNDRVAAENFNQHAEHYTRMLAEAQREL 83


>gi|304394126|ref|ZP_07376049.1| putative cytoplasmic protein [Ahrensia sp. R2A130]
 gi|303293566|gb|EFL87943.1| putative cytoplasmic protein [Ahrensia sp. R2A130]
          Length = 258

 Score = 68.2 bits (165), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 30/47 (63%), Positives = 38/47 (80%)

Query: 36 SNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNR 82
          SNG DV++RGTA HIAE+Y  LA DA +AGD V+A+++ Q AEHYNR
Sbjct: 39 SNGPDVRIRGTAAHIAEKYLSLANDAQTAGDTVMAQSYFQFAEHYNR 85


>gi|126728793|ref|ZP_01744608.1| hypothetical protein SSE37_08198 [Sagittula stellata E-37]
 gi|126710723|gb|EBA09774.1| hypothetical protein SSE37_08198 [Sagittula stellata E-37]
          Length = 258

 Score = 68.2 bits (165), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 56/84 (66%)

Query: 28  NPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMA 87
           N + R +DSNG + KVRGT Q I ++Y+ LARDA  A D V  EN  QHAEHY R++S A
Sbjct: 22  NVVNRVFDSNGPEGKVRGTPQQIIDKYNQLARDAGLANDRVNMENFQQHAEHYMRMLSEA 81

Query: 88  QAQIQEKLQRDEQDDLLVKEQKER 111
           Q +  ++ ++ E+++   + Q++R
Sbjct: 82  QREQDQRREQQEKENRERQAQRDR 105


>gi|254440171|ref|ZP_05053665.1| hypothetical protein OA307_5041 [Octadecabacter antarcticus 307]
 gi|198255617|gb|EDY79931.1| hypothetical protein OA307_5041 [Octadecabacter antarcticus 307]
          Length = 238

 Score = 68.2 bits (165), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 36/74 (48%), Positives = 51/74 (68%), Gaps = 2/74 (2%)

Query: 28  NPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMA 87
           N + R +DS+G + KVRGT Q I E+Y+ L RD++ A D V +EN  QHAEHY R+++ A
Sbjct: 63  NIVNRVFDSSGPEGKVRGTPQQIVEKYTQLHRDSLLARDSVNSENFAQHAEHYTRLLAEA 122

Query: 88  QAQIQEKLQRDEQD 101
           Q +I  K  R+EQ+
Sbjct: 123 QKEIDAK--REEQE 134


>gi|89054299|ref|YP_509750.1| hypothetical protein Jann_1808 [Jannaschia sp. CCS1]
 gi|88863848|gb|ABD54725.1| hypothetical protein Jann_1808 [Jannaschia sp. CCS1]
          Length = 224

 Score = 68.2 bits (165), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 39/87 (44%), Positives = 54/87 (62%), Gaps = 6/87 (6%)

Query: 1  MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
          MRS +   RSR +G+   NGS      N + R +DS+G + KVRGT Q I ++Y+ L RD
Sbjct: 1  MRSSK--NRSRSKGNRNRNGSMG----NIVNRVFDSSGPEGKVRGTPQQIVDKYNQLTRD 54

Query: 61 AMSAGDYVVAENHLQHAEHYNRIVSMA 87
          A  + D V AE+  QHAEHY R+++ A
Sbjct: 55 AQLSNDRVAAESFQQHAEHYTRMLAQA 81


>gi|99080784|ref|YP_612938.1| hypothetical protein TM1040_0943 [Ruegeria sp. TM1040]
 gi|99037064|gb|ABF63676.1| conserved hypothetical protein [Ruegeria sp. TM1040]
          Length = 236

 Score = 67.8 bits (164), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 52/80 (65%), Gaps = 2/80 (2%)

Query: 32  RNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQI 91
           R +DS+G + KVRGT Q I ++Y+ LARDA    D V  EN  QHAEHY R+++ AQ +I
Sbjct: 45  RVFDSSGPEGKVRGTPQQIIDKYNQLARDAQLGNDRVATENFQQHAEHYLRMLNEAQREI 104

Query: 92  QEKLQRDEQDDLLVKEQKER 111
           + K  R+EQ+    + Q ER
Sbjct: 105 EAK--REEQERQNRERQAER 122


>gi|254487948|ref|ZP_05101153.1| conserved hypothetical protein [Roseobacter sp. GAI101]
 gi|214044817|gb|EEB85455.1| conserved hypothetical protein [Roseobacter sp. GAI101]
          Length = 237

 Score = 67.8 bits (164), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 43/60 (71%)

Query: 32 RNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQI 91
          R +DS+G + KVRGT Q + E+Y+ LARDA  + D V AEN  QHAEHY R++S AQ +I
Sbjct: 26 RVFDSSGPEGKVRGTPQQVIEKYNQLARDAQLSNDRVAAENFQQHAEHYLRMLSEAQREI 85


>gi|294678210|ref|YP_003578825.1| hypothetical protein RCAP_rcc02688 [Rhodobacter capsulatus SB
          1003]
 gi|294477030|gb|ADE86418.1| conserved hypothetical protein [Rhodobacter capsulatus SB 1003]
          Length = 252

 Score = 67.8 bits (164), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 31/60 (51%), Positives = 40/60 (66%)

Query: 32 RNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQI 91
          R +DS+G + KVRGT Q I E+Y  LARDA    D V  +N LQHAEHY R++  AQ ++
Sbjct: 24 RVFDSSGPEGKVRGTPQQIIEKYLALARDAQLGNDRVAEQNFLQHAEHYTRMLGEAQREL 83


>gi|254512270|ref|ZP_05124337.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11]
 gi|221535981|gb|EEE38969.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11]
          Length = 192

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/74 (48%), Positives = 52/74 (70%), Gaps = 2/74 (2%)

Query: 28  NPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMA 87
           N + R +DS+G + KVRGT Q I ++Y+ LARDA  + D V AEN  QHAEHY R++S A
Sbjct: 21  NVVNRVFDSSGPEGKVRGTPQQIIDKYNQLARDAQLSNDRVAAENFQQHAEHYLRMLSEA 80

Query: 88  QAQIQEKLQRDEQD 101
           Q +++   +R+EQ+
Sbjct: 81  QREME--ARREEQE 92


>gi|259418952|ref|ZP_05742869.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
 gi|259345174|gb|EEW57028.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
          Length = 279

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 52/80 (65%), Gaps = 2/80 (2%)

Query: 32  RNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQI 91
           R +DS+G + KVRGT Q I ++Y+ LARDA    D V  EN  QHAEHY R+++ AQ +I
Sbjct: 90  RVFDSSGPEGKVRGTPQQIIDKYNQLARDAQLGNDRVATENFQQHAEHYLRMLNEAQREI 149

Query: 92  QEKLQRDEQDDLLVKEQKER 111
           + K  R+EQ+    + Q ER
Sbjct: 150 EAK--REEQERQNRERQAER 167


>gi|146277162|ref|YP_001167321.1| hypothetical protein Rsph17025_1115 [Rhodobacter sphaeroides ATCC
          17025]
 gi|145555403|gb|ABP70016.1| hypothetical protein Rsph17025_1115 [Rhodobacter sphaeroides ATCC
          17025]
          Length = 249

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 41/60 (68%)

Query: 32 RNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQI 91
          R +DS+G + KVRGT   I E+Y  LARDA  + D V AEN LQHAEHY R++  AQ ++
Sbjct: 24 RVFDSSGPEGKVRGTPAQIIEKYLFLARDAQLSNDRVAAENFLQHAEHYTRLLGEAQREL 83


>gi|332558340|ref|ZP_08412662.1| hypothetical protein RSWS8N_04775 [Rhodobacter sphaeroides WS8N]
 gi|332276052|gb|EGJ21367.1| hypothetical protein RSWS8N_04775 [Rhodobacter sphaeroides WS8N]
          Length = 275

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 41/60 (68%)

Query: 32 RNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQI 91
          R +DS+G + KVRGT   I E+Y  LARDA  + D V AEN LQHAEHY R++  AQ ++
Sbjct: 24 RVFDSSGPEGKVRGTPAQIIEKYLFLARDAQLSNDRVAAENFLQHAEHYTRLLGEAQREL 83


>gi|221639321|ref|YP_002525583.1| hypothetical protein RSKD131_1222 [Rhodobacter sphaeroides KD131]
 gi|221160102|gb|ACM01082.1| Hypothetical Protein RSKD131_1222 [Rhodobacter sphaeroides KD131]
          Length = 275

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 41/60 (68%)

Query: 32 RNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQI 91
          R +DS+G + KVRGT   I E+Y  LARDA  + D V AEN LQHAEHY R++  AQ ++
Sbjct: 24 RVFDSSGPEGKVRGTPAQIIEKYLFLARDAQLSNDRVAAENFLQHAEHYTRLLGEAQREL 83


>gi|77463463|ref|YP_352967.1| hypothetical protein RSP_6078 [Rhodobacter sphaeroides 2.4.1]
 gi|77387881|gb|ABA79066.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1]
          Length = 275

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 41/60 (68%)

Query: 32 RNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQI 91
          R +DS+G + KVRGT   I E+Y  LARDA  + D V AEN LQHAEHY R++  AQ ++
Sbjct: 24 RVFDSSGPEGKVRGTPAQIIEKYLFLARDAQLSNDRVAAENFLQHAEHYTRLLGEAQREL 83


>gi|126462318|ref|YP_001043432.1| hypothetical protein Rsph17029_1550 [Rhodobacter sphaeroides ATCC
          17029]
 gi|126103982|gb|ABN76660.1| conserved hypothetical protein [Rhodobacter sphaeroides ATCC
          17029]
          Length = 275

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 41/60 (68%)

Query: 32 RNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQI 91
          R +DS+G + KVRGT   I E+Y  LARDA  + D V AEN LQHAEHY R++  AQ ++
Sbjct: 24 RVFDSSGPEGKVRGTPAQIIEKYLFLARDAQLSNDRVAAENFLQHAEHYTRLLGEAQREL 83


>gi|159044280|ref|YP_001533074.1| hypothetical protein Dshi_1731 [Dinoroseobacter shibae DFL 12]
 gi|157912040|gb|ABV93473.1| conserved hypothetical protein [Dinoroseobacter shibae DFL 12]
          Length = 203

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 50/80 (62%), Gaps = 7/80 (8%)

Query: 9  RSRGRGSNGGNGSFNRKNLNPLV-RNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDY 67
          +SR R  N      NR+++  +V R +DS+G + KVRGT Q I ++Y  LARDA  A D 
Sbjct: 5  KSRSRNKN------NRRSVGNIVNRVFDSSGPEGKVRGTPQQIIDKYLTLARDAQLANDR 58

Query: 68 VVAENHLQHAEHYNRIVSMA 87
          V  EN  QHAEHY R++S A
Sbjct: 59 VAVENFQQHAEHYTRMLSEA 78


>gi|23015678|ref|ZP_00055447.1| hypothetical protein Magn03010110 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 164

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 66/113 (58%), Gaps = 6/113 (5%)

Query: 34  YDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQ--- 90
           +DSNG + ++RG A  + E+Y  LARDA S GD V AEN+ QHAEHY R+++ AQ Q   
Sbjct: 50  FDSNGPEGRIRGNAHQVLEKYLSLARDASSQGDRVAAENYYQHAEHYFRVIN-AQNQNNG 108

Query: 91  -IQEKLQRDEQDDLLVKEQKERAQNALSEFE-ASPCPLIEEGKEPIFENSIQP 141
             ++++    +D  +  E ++     +   + A+P P+  EG++P     ++P
Sbjct: 109 RPRQQMPTPAEDQSMGGEGEDENGEEIQHRQVAAPAPVPGEGEQPDVVLPVEP 161


>gi|255263795|ref|ZP_05343137.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
 gi|255106130|gb|EET48804.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
          Length = 200

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 79/148 (53%), Gaps = 17/148 (11%)

Query: 2   RSVQQYKRSRGRGSNGGNGSFNR-KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           R+    + S+ R    GN + NR    N + R +DS+G + KVRGT Q I ++Y+ L RD
Sbjct: 20  RTTHHMRSSKSRSR--GNKNRNRPSGANIVNRVFDSSGPEGKVRGTPQQIIDKYNQLHRD 77

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKER--------- 111
           A  AGD V+ E + QHAEHY R+  +A+A  +++ +R+E D    + Q ER         
Sbjct: 78  AQLAGDRVLVEAYAQHAEHYTRM--LAEALREQEAKREEADRQNRERQAERDRERAGRQQ 135

Query: 112 ---AQNALSEFEASPCPLIEEGKEPIFE 136
              +Q+  +  EA   P+ +EG   + E
Sbjct: 136 AHESQHQSNVEEAKEQPVADEGDSGLVE 163


>gi|83951819|ref|ZP_00960551.1| hypothetical protein ISM_14690 [Roseovarius nubinhibens ISM]
 gi|83836825|gb|EAP76122.1| hypothetical protein ISM_14690 [Roseovarius nubinhibens ISM]
          Length = 163

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 52/80 (65%), Gaps = 2/80 (2%)

Query: 32  RNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQI 91
           R +DS+G + KVRGT Q I ++Y+ LARDA  AGD V  EN  QHAEHY R++  AQ   
Sbjct: 7   RVFDSSGPEGKVRGTPQQIIDKYNQLARDAQLAGDRVATENFQQHAEHYLRLLGAAQK-- 64

Query: 92  QEKLQRDEQDDLLVKEQKER 111
           ++  +R+EQ+    + Q ER
Sbjct: 65  EQDARREEQERQNRERQAER 84


>gi|254465567|ref|ZP_05078978.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
 gi|206686475|gb|EDZ46957.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
          Length = 202

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 52/78 (66%), Gaps = 2/78 (2%)

Query: 34  YDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQE 93
           +DS+G + KVRGT Q I ++Y+ LARDA  + D V AEN  QHAEHY R+++ AQ +I  
Sbjct: 2   FDSSGPEGKVRGTPQQIIDKYNQLARDAQLSNDRVAAENFQQHAEHYLRMLNEAQREID- 60

Query: 94  KLQRDEQDDLLVKEQKER 111
             +R+EQ+    + Q ER
Sbjct: 61  -ARREEQERQNRERQAER 77


>gi|126725346|ref|ZP_01741188.1| hypothetical protein RB2150_04058 [Rhodobacterales bacterium
           HTCC2150]
 gi|126704550|gb|EBA03641.1| hypothetical protein RB2150_04058 [Rhodobacterales bacterium
           HTCC2150]
          Length = 186

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/81 (46%), Positives = 51/81 (62%), Gaps = 6/81 (7%)

Query: 34  YDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQE 93
           +DS+G + KVRGT Q I E+Y+ LARDA  A D V  EN  QHAEHY R++  A   ++E
Sbjct: 2   FDSSGPEGKVRGTPQQIIEKYTQLARDAQLAHDRVATENFQQHAEHYTRLLGKA---VRE 58

Query: 94  KLQRDEQDDLLVKEQKERAQN 114
           +  R EQ +    + +ER QN
Sbjct: 59  QEARREQQEA---QHRERQQN 76


>gi|254474377|ref|ZP_05087763.1| conserved hypothetical protein [Ruegeria sp. R11]
 gi|214028620|gb|EEB69455.1| conserved hypothetical protein [Ruegeria sp. R11]
          Length = 220

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/87 (43%), Positives = 56/87 (64%), Gaps = 2/87 (2%)

Query: 25  KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
           +  N + R +DS+G + KVRGT Q I ++Y+ LARDA  + D V  EN  QHAEHY R++
Sbjct: 18  QGANVVNRVFDSSGPEGKVRGTPQQIIDKYNQLARDAQLSNDRVATENFQQHAEHYLRML 77

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKER 111
           + AQ +I+   +R+EQ+    + Q ER
Sbjct: 78  NEAQREIE--ARREEQERQNRERQAER 102


>gi|86138687|ref|ZP_01057260.1| hypothetical protein MED193_22606 [Roseobacter sp. MED193]
 gi|85824747|gb|EAQ44949.1| hypothetical protein MED193_22606 [Roseobacter sp. MED193]
          Length = 266

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 38/85 (44%), Positives = 55/85 (64%), Gaps = 2/85 (2%)

Query: 27  LNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSM 86
           +N + R +DS+G + KVRGT Q I ++Y+ L RDA  + D V AEN  QHAEHY R+++ 
Sbjct: 20  VNVVNRVFDSSGPEGKVRGTPQQIIDKYNQLTRDAQLSNDRVAAENFQQHAEHYLRLLNE 79

Query: 87  AQAQIQEKLQRDEQDDLLVKEQKER 111
           AQ +I    +R+EQ+    + Q ER
Sbjct: 80  AQREI--DARREEQERQNRERQAER 102


>gi|163743157|ref|ZP_02150539.1| hypothetical protein RG210_14690 [Phaeobacter gallaeciensis 2.10]
 gi|161383574|gb|EDQ07961.1| hypothetical protein RG210_14690 [Phaeobacter gallaeciensis 2.10]
          Length = 239

 Score = 65.5 bits (158), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 52/80 (65%), Gaps = 2/80 (2%)

Query: 32  RNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQI 91
           R +DS+G + KVRGT Q I ++Y+ LARDA  + D V  EN  QHAEHY R+++ AQ +I
Sbjct: 25  RVFDSSGPEGKVRGTPQQIIDKYNQLARDAQLSNDRVATENFQQHAEHYLRMLNEAQREI 84

Query: 92  QEKLQRDEQDDLLVKEQKER 111
               +R+EQ+    + Q ER
Sbjct: 85  D--ARREEQERQNRERQAER 102


>gi|163739711|ref|ZP_02147119.1| hypothetical protein RGBS107_17033 [Phaeobacter gallaeciensis
           BS107]
 gi|161386941|gb|EDQ11302.1| hypothetical protein RGBS107_17033 [Phaeobacter gallaeciensis
           BS107]
          Length = 214

 Score = 65.1 bits (157), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 51/78 (65%), Gaps = 2/78 (2%)

Query: 34  YDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQE 93
           +DS+G + KVRGT Q I ++Y+ LARDA  + D V  EN  QHAEHY R+++ AQ +I  
Sbjct: 2   FDSSGPEGKVRGTPQQIIDKYNQLARDAQLSNDRVATENFQQHAEHYLRMLNEAQREID- 60

Query: 94  KLQRDEQDDLLVKEQKER 111
             +R+EQ+    + Q ER
Sbjct: 61  -ARREEQERQNRERQAER 77


>gi|119383647|ref|YP_914703.1| hypothetical protein Pden_0896 [Paracoccus denitrificans PD1222]
 gi|119373414|gb|ABL69007.1| conserved hypothetical protein [Paracoccus denitrificans PD1222]
          Length = 262

 Score = 64.7 bits (156), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 36/79 (45%), Positives = 50/79 (63%), Gaps = 3/79 (3%)

Query: 28  NPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMA 87
           N + R +DS+G + KVRGT Q I E+Y  LARDA  + D V  ++ LQHAEHY R++  A
Sbjct: 20  NIVNRVFDSSGPEGKVRGTPQQIIEKYLTLARDAQLSNDRVAEQSFLQHAEHYTRLLGEA 79

Query: 88  ---QAQIQEKLQRDEQDDL 103
              QA+ Q +  ++  DDL
Sbjct: 80  QREQAERQSQQHQNRDDDL 98


>gi|84686942|ref|ZP_01014826.1| hypothetical protein 1099457000247_RB2654_04289 [Maritimibacter
          alkaliphilus HTCC2654]
 gi|84665139|gb|EAQ11619.1| hypothetical protein RB2654_04289 [Rhodobacterales bacterium
          HTCC2654]
          Length = 215

 Score = 64.7 bits (156), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 42/65 (64%)

Query: 30 LVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQA 89
          + R +DS+G + KVRGT Q I ++Y+ L+RDA    D V  EN  QHAEHY R++S AQ 
Sbjct: 22 INRVFDSSGPEGKVRGTPQQIIDKYTQLSRDAFLGNDRVAGENFQQHAEHYARLLSEAQK 81

Query: 90 QIQEK 94
            + K
Sbjct: 82 DAEAK 86


>gi|114797461|ref|YP_759359.1| hypothetical protein HNE_0630 [Hyphomonas neptunium ATCC 15444]
 gi|114737635|gb|ABI75760.1| conserved domain protein [Hyphomonas neptunium ATCC 15444]
          Length = 259

 Score = 64.7 bits (156), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 45/65 (69%), Gaps = 5/65 (7%)

Query: 21 SFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHY 80
          +FN  N     R+Y+S G DVK+RG+AQ + E+Y   ARDA ++GD +++E + Q AEHY
Sbjct: 18 AFNNPN-----RHYESVGPDVKIRGSAQQVLEKYLQYARDAQTSGDRILSEAYFQFAEHY 72

Query: 81 NRIVS 85
           RIV+
Sbjct: 73 QRIVA 77


>gi|149914651|ref|ZP_01903181.1| nucleoside triphosphate pyrophosphohydrolase [Roseobacter sp.
           AzwK-3b]
 gi|149811444|gb|EDM71279.1| nucleoside triphosphate pyrophosphohydrolase [Roseobacter sp.
           AzwK-3b]
          Length = 186

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 75/151 (49%), Gaps = 8/151 (5%)

Query: 32  RNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQA-- 89
           R ++S+G + KVRGT Q I ++Y+ LARDA    D V AEN  QHAEHY R++  AQ   
Sbjct: 7   RVFESSGPEGKVRGTPQQIIDKYNQLARDAQLGNDRVAAENFQQHAEHYLRMLGAAQKDQ 66

Query: 90  ----QIQEKLQRDEQDDLLVKEQKERAQNA-LSEFEASPCPLIEEGKEPI-FENSIQPKV 143
               + QE+  RD Q +    E+ +RA+    +E    P     E  E +   N+ QP +
Sbjct: 67  DSRREQQERENRDRQAERDRAERPDRAERPDRAERPDRPKRPDHEPAEAVDMANAPQPDL 126

Query: 144 EDVAFKTPDISREKDVSYKKVRRRRPLRPRV 174
           E           E   S K  + +RP +PR 
Sbjct: 127 EPAQDSDESSLVETPESQKAEKPKRPRKPRA 157


>gi|260426103|ref|ZP_05780082.1| conserved hypothetical protein [Citreicella sp. SE45]
 gi|260420595|gb|EEX13846.1| conserved hypothetical protein [Citreicella sp. SE45]
          Length = 241

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 51/147 (34%), Positives = 78/147 (53%), Gaps = 13/147 (8%)

Query: 32  RNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQI 91
           R +DS+G + KVRGT Q I ++Y+ LARDA  A D V AEN  QHAEHY R++S AQ ++
Sbjct: 25  RVFDSSGPEGKVRGTPQQIIDKYNQLARDAGLANDRVAAENFQQHAEHYMRMLSEAQREV 84

Query: 92  QEKLQRDEQDDLLVKEQ--KERAQ------NALSEFEASPCPLIEEGKEPIFENSIQPKV 143
            ++ ++ E+++   + Q  KER+       +   +  AS  P   E ++P  E   QP+ 
Sbjct: 85  DQRREQQERENRERQSQRDKERSDRDSQRPDRDDDTSASAQP---EQQQPSEEPKAQPEP 141

Query: 144 EDVAFKTPDISREKDVSYKKVRRRRPL 170
           +      P    E     +  +R  PL
Sbjct: 142 QAEPRSEPRA--EPRSESRSEKRADPL 166


>gi|297180851|gb|ADI17056.1| hypothetical protein [uncultured alpha proteobacterium
           HF0010_30A23]
          Length = 263

 Score = 62.4 bits (150), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 52/83 (62%), Gaps = 11/83 (13%)

Query: 11  RGRGSNGGNGSFNRKNLNP--------LVRN--YDSNGYDVKVRGTAQHIAERYSVLARD 60
           +G+G+N   G+ NR+   P          RN  +DSNG DV+VRG A  + ++YS LAR+
Sbjct: 24  QGKGNNMRQGN-NRRGRQPKQQKQGTIPTRNQVFDSNGPDVRVRGNAHQVYDKYSALARE 82

Query: 61  AMSAGDYVVAENHLQHAEHYNRI 83
           A +AG+++ AE + Q AEHY R+
Sbjct: 83  ATAAGNHIQAEAYYQFAEHYLRL 105


>gi|144897747|emb|CAM74611.1| conserved hypothetical protein [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 194

 Score = 61.2 bits (147), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 41/61 (67%)

Query: 25  KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
           +N+N   + +DSNG + ++RG A  + E+Y  LARDA S GD   AEN  QHAEHY R++
Sbjct: 48  RNINVRSQVFDSNGPEGRIRGNAHQVMEKYLGLARDAASQGDRHAAENFYQHAEHYFRLI 107

Query: 85  S 85
           +
Sbjct: 108 N 108


>gi|297181251|gb|ADI17445.1| hypothetical protein [uncultured Rhodospirillales bacterium
          HF0070_31K06]
          Length = 76

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%)

Query: 34 YDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHY 80
          +DSNG  V++RG A  + E+Y  +ARDA S+GD + AEN+ QHAEHY
Sbjct: 30 FDSNGPSVRIRGNASQVHEKYLAMARDASSSGDRIAAENYFQHAEHY 76


>gi|118588512|ref|ZP_01545921.1| hypothetical protein SIAM614_24562 [Stappia aggregata IAM 12614]
 gi|118439218|gb|EAV45850.1| hypothetical protein SIAM614_24562 [Stappia aggregata IAM 12614]
          Length = 202

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/44 (63%), Positives = 35/44 (79%)

Query: 49 HIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQ 92
          HIAE+Y  LARDA ++GD V++EN+ QHAEHY RIV+ AQ Q Q
Sbjct: 2  HIAEKYQQLARDAQASGDRVMSENYNQHAEHYLRIVAAAQPQQQ 45


>gi|294085500|ref|YP_003552260.1| hypothetical protein SAR116_1933 [Candidatus Puniceispirillum
          marinum IMCC1322]
 gi|292665075|gb|ADE40176.1| hypothetical protein SAR116_1933 [Candidatus Puniceispirillum
          marinum IMCC1322]
          Length = 181

 Score = 58.9 bits (141), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 44/67 (65%)

Query: 33 NYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQ 92
          +Y+SNG DVK+RG AQ + E+Y  LA DA S+G+ + AE + Q A+HY R+   A    +
Sbjct: 32 SYESNGPDVKLRGNAQQLHEKYIALAHDASSSGERIAAEAYSQFADHYFRLHQAAVGAAE 91

Query: 93 EKLQRDE 99
           K Q+++
Sbjct: 92 TKRQQEQ 98


>gi|297180643|gb|ADI16853.1| hypothetical protein [uncultured alpha proteobacterium
           HF0010_13E22]
          Length = 155

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 56/102 (54%), Gaps = 17/102 (16%)

Query: 33  NYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQ 92
           +Y+SNG DVK+RG AQ + E+Y  LA D+ +AG+ + AE + Q A+HY R+   A    +
Sbjct: 31  SYESNGPDVKLRGNAQQLNEKYLALAHDSAAAGERITAEAYTQFADHYFRLHQAAVDAAE 90

Query: 93  EKLQRDEQDDLLVKEQKERAQNALSEFEA-SPCPLIEEGKEP 133
           E+                RAQ+A  +  A +P P IEE  +P
Sbjct: 91  ER----------------RAQHAERQSRAEAPQPSIEEEAKP 116


>gi|54288340|gb|AAV31628.1| conserved hypothetical protein [uncultured alpha proteobacterium
          EBAC2C11]
          Length = 169

 Score = 58.2 bits (139), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 43/66 (65%)

Query: 34 YDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQE 93
          Y+SNG DVK+RG AQ + E+Y  LA DA ++G+ + AE + Q A+HY R+   A    + 
Sbjct: 33 YESNGPDVKLRGNAQQLHEKYLALAHDAATSGERISAEAYTQFADHYFRLHQAAVGVAES 92

Query: 94 KLQRDE 99
          K Q+D+
Sbjct: 93 KRQQDQ 98


>gi|84516319|ref|ZP_01003679.1| hypothetical protein SKA53_05273 [Loktanella vestfoldensis SKA53]
 gi|84510015|gb|EAQ06472.1| hypothetical protein SKA53_05273 [Loktanella vestfoldensis SKA53]
          Length = 146

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 39/57 (68%), Gaps = 2/57 (3%)

Query: 43 VRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDE 99
          +RGT Q I E+Y+ L RDA  + D V AEN  QHAEHY R+++ AQ ++ ++  RDE
Sbjct: 1  MRGTPQQIIEKYNQLHRDAQLSNDRVNAENFAQHAEHYTRLLAEAQREVDQR--RDE 55


>gi|126739406|ref|ZP_01755099.1| hypothetical protein RSK20926_20855 [Roseobacter sp. SK209-2-6]
 gi|126719506|gb|EBA16215.1| hypothetical protein RSK20926_20855 [Roseobacter sp. SK209-2-6]
          Length = 219

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 44/69 (63%), Gaps = 2/69 (2%)

Query: 43  VRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDD 102
           +RGT Q I ++Y+ LARDA  + D V  EN  QHAEHY R+++ AQ +I    +R+EQ+ 
Sbjct: 1   MRGTPQQIIDKYNQLARDAQLSNDRVATENFQQHAEHYLRMLTEAQREID--ARREEQER 58

Query: 103 LLVKEQKER 111
              + Q ER
Sbjct: 59  QNRERQAER 67


>gi|148555443|ref|YP_001263025.1| hypothetical protein Swit_2528 [Sphingomonas wittichii RW1]
 gi|148500633|gb|ABQ68887.1| hypothetical protein Swit_2528 [Sphingomonas wittichii RW1]
          Length = 269

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 57/124 (45%), Gaps = 16/124 (12%)

Query: 14  GSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENH 73
           GSNGG    NR               D + RG A  + E+Y  LARDA   GD V  E +
Sbjct: 24  GSNGGQDRGNR--------------IDNRARGNAAQLLEKYKALARDAQMQGDRVNTEYY 69

Query: 74  LQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNA--LSEFEASPCPLIEEGK 131
           LQ A+HY R++S ++++ +++  R  +D+      +E       +   E  P P    G+
Sbjct: 70  LQFADHYFRVLSESRSRFEDQQPRPRRDEFTGASDEEYGDEGDRIGADEQQPAPARAAGQ 129

Query: 132 EPIF 135
           E  F
Sbjct: 130 ERGF 133


>gi|297182758|gb|ADI18912.1| hypothetical protein [uncultured SAR11 cluster bacterium
           HF0010_09O16]
          Length = 137

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 49/75 (65%), Gaps = 5/75 (6%)

Query: 46  TAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKL---QRDEQDD 102
            A  + E+Y+ LAR+A+S GD +++EN+ QHA+H+ RI++  +  +Q K+    +D ++ 
Sbjct: 51  NAPKLIEKYNNLAREALSTGDKILSENYFQHADHFTRILN--EKGVQRKMSFKNKDLEEP 108

Query: 103 LLVKEQKERAQNALS 117
             V E +E  +N++S
Sbjct: 109 TDVNENRENKENSIS 123


>gi|297183694|gb|ADI19819.1| hypothetical protein [uncultured alpha proteobacterium EB000_37G09]
          Length = 179

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 45/68 (66%), Gaps = 1/68 (1%)

Query: 34  YDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRI-VSMAQAQIQ 92
           ++SNG + ++RG AQ + E+Y+ LA DA +AG+ + AE   Q A+HY RI  ++  A  Q
Sbjct: 33  FESNGPEGRLRGNAQQLYEKYTALANDANTAGERISAEACSQFADHYYRINQTIVMAAEQ 92

Query: 93  EKLQRDEQ 100
           ++  +DEQ
Sbjct: 93  QRRTQDEQ 100


>gi|307296976|ref|ZP_07576792.1| hypothetical protein SphchDRAFT_3929 [Sphingobium
          chlorophenolicum L-1]
 gi|306877502|gb|EFN08730.1| hypothetical protein SphchDRAFT_3929 [Sphingobium
          chlorophenolicum L-1]
          Length = 249

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 39/58 (67%)

Query: 40 DVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQR 97
          D + RG A  + E+Y  +ARDA  AGD V AE +LQ A+HY R+++  +A+ +E+ QR
Sbjct: 36 DSRARGNAAQLLEKYKNMARDAQMAGDRVNAEYYLQFADHYFRVLADNRARQEEQQQR 93


>gi|40062643|gb|AAR37564.1| conserved domain protein [uncultured marine bacterium 313]
          Length = 129

 Score = 52.8 bits (125), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 50/87 (57%), Gaps = 6/87 (6%)

Query: 46  TAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLV 105
           +A+ + E+YS LA++A+S+GD  ++EN+ QHA+H+ RI+      I +K  + + DD LV
Sbjct: 49  SAEKLFEKYSTLAKEALSSGDKTLSENYFQHADHFMRIIQ--DKDINQKQNKVQVDDKLV 106

Query: 106 KEQKERAQNALSEFEASPCPLIEEGKE 132
              K   +N+           IEE KE
Sbjct: 107 VRDKHLPENS----GVGQNKTIEEKKE 129


>gi|103488189|ref|YP_617750.1| hypothetical protein Sala_2712 [Sphingopyxis alaskensis RB2256]
 gi|98978266|gb|ABF54417.1| conserved hypothetical protein [Sphingopyxis alaskensis RB2256]
          Length = 273

 Score = 52.4 bits (124), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 38/59 (64%)

Query: 36 SNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEK 94
          +N  D + RG    + E+Y  LARDA  AGD V+ E +LQ A+HY R+VS  +A+ +EK
Sbjct: 37 ANRIDSRARGNGAQMIEKYRNLARDAQLAGDRVLTEYYLQFADHYFRVVSDFRARQEEK 95


>gi|94496669|ref|ZP_01303245.1| hypothetical protein SKA58_18232 [Sphingomonas sp. SKA58]
 gi|94424029|gb|EAT09054.1| hypothetical protein SKA58_18232 [Sphingomonas sp. SKA58]
          Length = 282

 Score = 52.4 bits (124), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 39/58 (67%)

Query: 40 DVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQR 97
          D + RG A  + E+Y  +ARDA  AGD V AE +LQ A+HY R+++  +A+ +E+ QR
Sbjct: 35 DNRARGNAAQLLEKYKNMARDAQMAGDRVNAEYYLQFADHYFRVLADNRARQEEQQQR 92


>gi|296775789|gb|ADH43044.1| hypothetical protein [uncultured SAR11 cluster alpha
           proteobacterium H17925_48B19]
          Length = 102

 Score = 51.2 bits (121), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 45/74 (60%), Gaps = 12/74 (16%)

Query: 36  SNGYDVKVRG------TAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQA 89
           SNG   K R        A  + E+Y+ LAR+A+S GD +++EN+LQH+EH++RI+     
Sbjct: 11  SNGSSFKRRHPGKNNQNAAKLVEKYNDLAREALSNGDKILSENYLQHSEHFSRIL----- 65

Query: 90  QIQEKLQRDEQDDL 103
            I ++  R+  D+L
Sbjct: 66  -ISQENSRNNSDNL 78


>gi|254420928|ref|ZP_05034652.1| hypothetical protein BBAL3_3238 [Brevundimonas sp. BAL3]
 gi|196187105|gb|EDX82081.1| hypothetical protein BBAL3_3238 [Brevundimonas sp. BAL3]
          Length = 299

 Score = 51.2 bits (121), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/41 (58%), Positives = 29/41 (70%)

Query: 50 IAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQ 90
          + ERY  LARDA S GD V+AEN+ QHAEHY R++   Q Q
Sbjct: 1  MYERYQQLARDASSGGDRVLAENYQQHAEHYYRVLRALQPQ 41


>gi|297183485|gb|ADI19616.1| hypothetical protein [uncultured SAR11 cluster bacterium
          HF0770_37D02]
          Length = 133

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 38/52 (73%), Gaps = 3/52 (5%)

Query: 36 SNGY---DVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
          SNG+   + +   +A+ + E+Y+ LA++AMS+GD  ++EN+ QHA+H+ RI+
Sbjct: 37 SNGHIRNNYRTAQSAEKLLEKYNALAKEAMSSGDKTLSENYFQHADHFMRII 88


>gi|294010052|ref|YP_003543512.1| hypothetical protein SJA_C1-00660 [Sphingobium japonicum UT26S]
 gi|292673382|dbj|BAI94900.1| hypothetical protein SJA_C1-00660 [Sphingobium japonicum UT26S]
          Length = 260

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 39/58 (67%)

Query: 40 DVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQR 97
          D + RG A  + E+Y  +ARD+  AGD V AE +LQ A+HY R+++  +A+ +E+ QR
Sbjct: 36 DSRARGNAAQLLEKYKNMARDSQMAGDRVNAEYYLQFADHYFRVLADNRARQEEQQQR 93


>gi|297182951|gb|ADI19099.1| hypothetical protein [uncultured alpha proteobacterium
           HF0070_34A12]
          Length = 155

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 69/134 (51%), Gaps = 24/134 (17%)

Query: 33  NYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQ 92
           +Y+SNG DVK+RG AQ + E+Y  LA DA +AG+ + AE + Q A+HY R+   A    +
Sbjct: 31  SYESNGPDVKLRGNAQQLNEKYLALAHDAAAAGERITAEAYTQFADHYFRLHQAAVDAAE 90

Query: 93  EKLQRDEQDDLLVKEQKERAQNALSEFEA-SPCPLIEEGKEPIFENSIQPKVE-DVAFKT 150
           E+                RAQ+A  +  A +P P IEE  +P      QP  E D A + 
Sbjct: 91  ER----------------RAQHAERQSRAEAPQPSIEEEAKP------QPDTEGDSAAEK 128

Query: 151 PDISREKDVSYKKV 164
            D +   D+S  K+
Sbjct: 129 ADGAEVVDLSPAKL 142


>gi|168203424|gb|ACA21559.1| hypothetical protein [Candidatus Pelagibacter ubique]
          Length = 136

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 36/54 (66%)

Query: 47  AQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQ 100
           A  + E+Y+ LAR+A+S GD +++EN+ QHA+H+ R++   +   + K   +E+
Sbjct: 52  ASKLIEKYNDLAREALSGGDKILSENYFQHADHFTRVLKEQENFKKNKFSEEEK 105


>gi|297181092|gb|ADI17291.1| hypothetical protein [uncultured alpha proteobacterium
           HF0070_17D04]
          Length = 155

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 69/134 (51%), Gaps = 24/134 (17%)

Query: 33  NYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQ 92
           +Y+SNG DVK+RG AQ + E+Y  LA DA +AG+ + AE + Q A+HY R+   A    +
Sbjct: 31  SYESNGPDVKLRGNAQQLNEKYLALAHDAAAAGERITAEAYTQFADHYFRLHQAAVDAAE 90

Query: 93  EKLQRDEQDDLLVKEQKERAQNALSEFEA-SPCPLIEEGKEPIFENSIQPKVE-DVAFKT 150
           E+                RAQ+A  +  A +P P IEE  +P      QP  E D A + 
Sbjct: 91  ER----------------RAQHAERQSRAEAPQPSIEEEAKP------QPDTESDSAAEK 128

Query: 151 PDISREKDVSYKKV 164
            D +   D+S  K+
Sbjct: 129 ADGAEVVDLSPAKL 142


>gi|56552407|ref|YP_163246.1| hypothetical protein ZMO1511 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241761551|ref|ZP_04759638.1| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|260753916|ref|YP_003226809.1| hypothetical protein Za10_1691 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|56543981|gb|AAV90135.1| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|241373859|gb|EER63392.1| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|258553279|gb|ACV76225.1| hypothetical protein Za10_1691 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 357

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 37/63 (58%)

Query: 36  SNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKL 95
           +N  D + RG A  + E+Y  LARD    GD V+ E +LQ A+HY RI++  + + +E  
Sbjct: 45  NNRIDNRARGNASQLHEKYKALARDMQLQGDRVMTEYYLQFADHYFRILNDNRLRYEEAR 104

Query: 96  QRD 98
            RD
Sbjct: 105 MRD 107


>gi|262277606|ref|ZP_06055399.1| conserved hypothetical protein [alpha proteobacterium HIMB114]
 gi|262224709|gb|EEY75168.1| conserved hypothetical protein [alpha proteobacterium HIMB114]
          Length = 140

 Score = 48.9 bits (115), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 33/44 (75%)

Query: 41 VKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
          V+  G A  + E+Y+ LA +A+++GD ++AEN+ QHA+H+ R++
Sbjct: 44 VRFNGNASKLFEKYNKLASEALASGDKILAENYFQHADHFARMM 87


>gi|326386586|ref|ZP_08208208.1| hypothetical protein Y88_2480 [Novosphingobium nitrogenifigens
          DSM 19370]
 gi|326208901|gb|EGD59696.1| hypothetical protein Y88_2480 [Novosphingobium nitrogenifigens
          DSM 19370]
          Length = 309

 Score = 48.9 bits (115), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 37 NGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQ 96
          N  D + RG A  + E+Y  LA+DA   GD V AE +LQ A+HY R+++  + + +E+ Q
Sbjct: 26 NRIDSRARGNAPQLLEKYRKLAQDAHLNGDRVQAEYYLQFADHYFRVIADTRLRQEEQRQ 85

Query: 97 R 97
          R
Sbjct: 86 R 86


>gi|83859676|ref|ZP_00953196.1| hypothetical protein OA2633_06744 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852035|gb|EAP89889.1| hypothetical protein OA2633_06744 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 159

 Score = 48.9 bits (115), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/46 (58%), Positives = 32/46 (69%), Gaps = 6/46 (13%)

Query: 57  LARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDD 102
           LARDA SAGD V+AEN+ QHAEHY RI+   Q       +RDE+DD
Sbjct: 3   LARDASSAGDRVMAENYYQHAEHYLRIMQANQP------KRDERDD 42


>gi|40062807|gb|AAR37691.1| hypothetical protein MBMO_EBAC750-02H05.9 [uncultured marine
          bacterium 440]
          Length = 132

 Score = 48.5 bits (114), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 32/45 (71%)

Query: 40 DVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
          + K   +A+ + E Y +LA++A+S GD ++ EN+LQH +H+ RIV
Sbjct: 43 NFKSNKSAEQLLESYKILAKEAISLGDKILEENYLQHIDHFERIV 87


>gi|254456044|ref|ZP_05069473.1| conserved hypothetical protein [Candidatus Pelagibacter sp.
           HTCC7211]
 gi|207083046|gb|EDZ60472.1| conserved hypothetical protein [Candidatus Pelagibacter sp.
           HTCC7211]
          Length = 144

 Score = 48.5 bits (114), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 37/56 (66%)

Query: 47  AQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDD 102
           A  + E+Y+ LAR+A S GD +++EN+ QHA+H+ RI++  + Q + +    + D+
Sbjct: 53  ASKLIEKYNDLAREASSNGDKILSENYFQHADHFTRILNEQENQRRARFSESKSDE 108


>gi|167041275|gb|ABZ06031.1| hypothetical protein ALOHA_HF4000005D21ctg1g36 [uncultured marine
          microorganism HF4000_005D21]
 gi|167045780|gb|ABZ10426.1| hypothetical protein ALOHA_HF4000APKG3108ctg1g37 [uncultured
          marine bacterium HF4000_APKG3108]
          Length = 147

 Score = 48.1 bits (113), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 32/39 (82%)

Query: 46 TAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
          +A+ + E+Y+ LA++A+++GD  ++EN+ QHA+H+ RI+
Sbjct: 49 SAEKLFEKYNALAKEALTSGDRTLSENYFQHADHFMRII 87


>gi|297182637|gb|ADI18795.1| hypothetical protein [uncultured SAR11 cluster bacterium
           HF4000_37C10]
          Length = 127

 Score = 48.1 bits (113), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 39/57 (68%), Gaps = 2/57 (3%)

Query: 46  TAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDD 102
           +A+ + E+Y+ LA++A+++GD  ++EN+ QHA+H+ RI+      I +K  R + DD
Sbjct: 50  SAEKLFEKYNTLAKEALTSGDKTLSENYFQHADHFVRIIE--NKNINQKQNRAQVDD 104


>gi|149185461|ref|ZP_01863777.1| hypothetical protein ED21_20589 [Erythrobacter sp. SD-21]
 gi|148830681|gb|EDL49116.1| hypothetical protein ED21_20589 [Erythrobacter sp. SD-21]
          Length = 219

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 37/58 (63%)

Query: 36 SNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQE 93
          +N  D + RG A  + ++Y  LA+DA   GD V AE +LQ A+HY R+++  +A+ +E
Sbjct: 25 ANRIDSRARGNAPQMLDKYKKLAQDAQHNGDRVQAEYYLQFADHYFRVIADNKARQEE 82


>gi|296282003|ref|ZP_06860001.1| hypothetical protein CbatJ_00195 [Citromicrobium bathyomarinum
          JL354]
          Length = 258

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 40/64 (62%), Gaps = 1/64 (1%)

Query: 36 SNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQA-QIQEK 94
          SN  D + RG A  + ++Y  LA+DA   GD V  E +LQ A+HY R+++  +A Q +++
Sbjct: 28 SNRIDSRARGNAPQLLDKYKKLAQDAQHNGDRVQTEYYLQFADHYFRVIADNKARQDEQR 87

Query: 95 LQRD 98
           +RD
Sbjct: 88 AKRD 91


>gi|296775658|gb|ADH42935.1| hypothetical protein [uncultured SAR11 cluster alpha
          proteobacterium H17925_23J24]
          Length = 118

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 35/44 (79%)

Query: 50 IAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQE 93
          I E+Y  LA++A+S+GD ++ EN+LQH++H+ R++S  + ++++
Sbjct: 56 IIEKYKNLAKEALSSGDKILHENYLQHSDHFARLLSEMEPKVKD 99


>gi|330813115|ref|YP_004357354.1| hypothetical protein SAR11G3_00140 [Candidatus Pelagibacter sp.
          IMCC9063]
 gi|327486210|gb|AEA80615.1| hypothetical protein SAR11G3_00140 [Candidatus Pelagibacter sp.
          IMCC9063]
          Length = 146

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 28/38 (73%)

Query: 47 AQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
          A  + ++Y  LA DA+S GD ++AE++ QHA+HY R++
Sbjct: 58 ATKMFDKYKTLANDALSVGDIILAESYFQHADHYARLL 95


>gi|87198311|ref|YP_495568.1| hypothetical protein Saro_0286 [Novosphingobium aromaticivorans DSM
           12444]
 gi|87133992|gb|ABD24734.1| conserved hypothetical protein [Novosphingobium aromaticivorans DSM
           12444]
          Length = 340

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 37/61 (60%)

Query: 37  NGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQ 96
           N  D + RG A  + E+Y  LA+DA   GD V AE +LQ A+HY R+++  + + +E+  
Sbjct: 62  NRIDSRARGNAPQLLEKYRKLAQDAHLNGDRVQAEYYLQFADHYFRVIADTRVRQEEQRA 121

Query: 97  R 97
           R
Sbjct: 122 R 122


>gi|332188228|ref|ZP_08389956.1| hypothetical protein SUS17_3393 [Sphingomonas sp. S17]
 gi|332011727|gb|EGI53804.1| hypothetical protein SUS17_3393 [Sphingomonas sp. S17]
          Length = 271

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 37/62 (59%)

Query: 36 SNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKL 95
           N  D + RG A  + E+Y  LA +A   GD V  E + Q A+HY R++S ++++ +E+ 
Sbjct: 33 GNRIDNRARGNANQLYEKYKNLAAEAQRQGDRVNTEYYWQFADHYFRVLSESRSRFEEQN 92

Query: 96 QR 97
          QR
Sbjct: 93 QR 94


>gi|85709575|ref|ZP_01040640.1| hypothetical protein NAP1_11858 [Erythrobacter sp. NAP1]
 gi|85688285|gb|EAQ28289.1| hypothetical protein NAP1_11858 [Erythrobacter sp. NAP1]
          Length = 212

 Score = 45.8 bits (107), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 35/57 (61%)

Query: 37 NGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQE 93
          N  D + RG A  + ++Y  LA+DA   GD V AE +LQ A+HY R+++  +A+  E
Sbjct: 25 NRIDSRARGNAPQLLDKYKKLAQDAQHNGDRVQAEYYLQFADHYFRVIADNKARQDE 81


>gi|85375682|ref|YP_459744.1| hypothetical protein ELI_14275 [Erythrobacter litoralis HTCC2594]
 gi|84788765|gb|ABC64947.1| hypothetical protein ELI_14275 [Erythrobacter litoralis HTCC2594]
          Length = 241

 Score = 43.1 bits (100), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 37/60 (61%), Gaps = 1/60 (1%)

Query: 40  DVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQA-QIQEKLQRD 98
           D + RG A  + ++Y  LA+DA   GD V  E +LQ A+HY R+++  +A Q + + +RD
Sbjct: 46  DSRARGNAPQLLDKYKKLAQDAQHNGDRVQMEYYLQFADHYFRVIADNKARQDEARAKRD 105


>gi|40062725|gb|AAR37630.1| hypothetical protein MBMO_EBAC000-62A03.2 [uncultured marine
          bacterium 438]
          Length = 158

 Score = 43.1 bits (100), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 35/53 (66%), Gaps = 4/53 (7%)

Query: 35 DSNGYDVKVRGTAQH----IAERYSVLARDAMSAGDYVVAENHLQHAEHYNRI 83
          +++ +  KV G   H    + E+Y+ LAR+A++  D +++EN+ QHA+H+ R+
Sbjct: 38 NNDNFQRKVPGRNNHNAVKLIEKYNDLAREALANEDKILSENYFQHADHFTRV 90


>gi|71083226|ref|YP_265945.1| hypothetical protein SAR11_0520 [Candidatus Pelagibacter ubique
          HTCC1062]
 gi|71062339|gb|AAZ21342.1| hypothetical protein SAR11_0520 [Candidatus Pelagibacter ubique
          HTCC1062]
          Length = 158

 Score = 43.1 bits (100), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 35/53 (66%), Gaps = 4/53 (7%)

Query: 35 DSNGYDVKVRGTAQH----IAERYSVLARDAMSAGDYVVAENHLQHAEHYNRI 83
          +++ +  KV G   H    + E+Y+ LAR+A++  D +++EN+ QHA+H+ R+
Sbjct: 38 NNDNFQRKVPGRNNHNAVKLIEKYNDLAREALANEDKILSENYFQHADHFTRV 90


>gi|91762344|ref|ZP_01264309.1| hypothetical protein PU1002_03726 [Candidatus Pelagibacter ubique
          HTCC1002]
 gi|91718146|gb|EAS84796.1| hypothetical protein PU1002_03726 [Candidatus Pelagibacter ubique
          HTCC1002]
          Length = 158

 Score = 43.1 bits (100), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 35/53 (66%), Gaps = 4/53 (7%)

Query: 35 DSNGYDVKVRGTAQH----IAERYSVLARDAMSAGDYVVAENHLQHAEHYNRI 83
          +++ +  KV G   H    + E+Y+ LAR+A++  D +++EN+ QHA+H+ R+
Sbjct: 38 NNDNFQRKVPGRNNHNAVKLIEKYNDLAREALANEDKILSENYFQHADHFTRV 90


>gi|296775699|gb|ADH42975.1| hypothetical protein [uncultured SAR11 cluster alpha
          proteobacterium H17925_38M03]
          Length = 129

 Score = 40.8 bits (94), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 25/31 (80%)

Query: 52 ERYSVLARDAMSAGDYVVAENHLQHAEHYNR 82
          ++Y  LA+DA S GD V+++N+LQHA+HY R
Sbjct: 58 QKYQQLAKDAQSNGDPVLSQNYLQHADHYLR 88


>gi|323489540|ref|ZP_08094767.1| GTPase engC [Planococcus donghaensis MPA1U2]
 gi|323396671|gb|EGA89490.1| GTPase engC [Planococcus donghaensis MPA1U2]
          Length = 298

 Score = 38.5 bits (88), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 58/120 (48%), Gaps = 10/120 (8%)

Query: 5   QQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSA 64
           ++Y + RGRG       F  + + PLV +Y     D ++ GT  H+ +R + L R  ++ 
Sbjct: 22  ERYTQCRGRGV------FRNRQITPLVGDYVDYKADNELEGTILHVYDRKNELVRPPIAN 75

Query: 65  GDYVV----AENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
            D  +    A+    H    +R ++  ++   + +    + DLL +E+KE+ Q  + ++E
Sbjct: 76  VDQAILVFSAKQPDFHPLLLDRFLTAIESHSIQPVICLTKMDLLKEEEKEKIQQYIKDYE 135


>gi|254454321|ref|ZP_05067758.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
 gi|198268727|gb|EDY92997.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
          Length = 138

 Score = 37.7 bits (86), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 27/40 (67%), Gaps = 2/40 (5%)

Query: 62  MSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQD 101
           M A D V +EN  QHAEHY R+++ AQ +I  K  R+EQ+
Sbjct: 1   MLARDSVNSENFAQHAEHYTRMLAEAQKEIDAK--REEQE 38


>gi|291223499|ref|XP_002731747.1| PREDICTED: ATP-binding cassette transporter sub-family C member
           9-like [Saccoglossus kowalevskii]
          Length = 1431

 Score = 36.6 bits (83), Expect = 2.3,   Method: Composition-based stats.
 Identities = 25/118 (21%), Positives = 53/118 (44%), Gaps = 27/118 (22%)

Query: 40  DVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEK----- 94
           DV V G   H+ E+ ++L          ++  + +QH EH N+++ M   QI +K     
Sbjct: 739 DVHVSG---HVMEK-AILGFLCEQQRTVILVTHQIQHLEHANQVLVMDNGQIIQKGTLRE 794

Query: 95  ------------------LQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPI 134
                              + + +D+L++K ++++ ++  S+      PL+EE + P+
Sbjct: 795 IRVHNRELYRQIISTISDSENETKDELVIKRKRKQVRSRKSKTSKKGSPLVEEERPPL 852


>gi|196232943|ref|ZP_03131792.1| TPR repeat-containing protein [Chthoniobacter flavus Ellin428]
 gi|196222921|gb|EDY17442.1| TPR repeat-containing protein [Chthoniobacter flavus Ellin428]
          Length = 413

 Score = 36.2 bits (82), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 45/102 (44%), Gaps = 17/102 (16%)

Query: 25  KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
           KNL PL +N+D + ++         IA    V+  D M+       E   QHA+H+    
Sbjct: 243 KNLLPLFKNHDRSRFE---------IACFSGVIRPDGMT-------EAFQQHADHWWNTA 286

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPL 126
           +M    + E L R E+ D+LV   +    N L  F   P P+
Sbjct: 287 AMDDGALAE-LVRSERVDILVDLSQHIIANRLLLFARQPAPV 327


>gi|116513793|ref|YP_812699.1| putative translation factor (SUA5) [Lactobacillus delbrueckii
           subsp. bulgaricus ATCC BAA-365]
 gi|116093108|gb|ABJ58261.1| translation factor SUA5 [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC BAA-365]
 gi|325125451|gb|ADY84781.1| Putative translation factor SUA5 family [Lactobacillus delbrueckii
           subsp. bulgaricus 2038]
          Length = 331

 Score = 36.2 bits (82), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 40/100 (40%), Gaps = 6/100 (6%)

Query: 106 KEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVR 165
           KE  ERA+  +  F   P  ++   KE     S+   +  VAF+ PD     D+  K   
Sbjct: 74  KEVPERAEKLIKHFWPGPLTILLLAKEGALPESVTGGLPTVAFRCPDDQLTHDLIAKLG- 132

Query: 166 RRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVD 205
                 P V P+A +  +P   T   V  +L    A  VD
Sbjct: 133 -----YPIVGPSANTSTKPSPTTAQHVYHDLKGKIAGIVD 167


>gi|104773787|ref|YP_618767.1| Sua5 family translation factor [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
 gi|103422868|emb|CAI97530.1| Putative translation factor (Sua5 family) [Lactobacillus
           delbrueckii subsp. bulgaricus ATCC 11842]
          Length = 331

 Score = 36.2 bits (82), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 40/100 (40%), Gaps = 6/100 (6%)

Query: 106 KEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVR 165
           KE  ERA+  +  F   P  ++   KE     S+   +  VAF+ PD     D+  K   
Sbjct: 74  KEVPERAEKLIKHFWPGPLTILLLAKEGALPESVTGGLPTVAFRCPDDQLTHDLIAKLG- 132

Query: 166 RRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVD 205
                 P V P+A +  +P   T   V  +L    A  VD
Sbjct: 133 -----YPIVGPSANTSTKPSPTTAQHVYHDLKGKIAGIVD 167


>gi|223939333|ref|ZP_03631213.1| Immunoglobulin I-set domain protein [bacterium Ellin514]
 gi|223892046|gb|EEF58527.1| Immunoglobulin I-set domain protein [bacterium Ellin514]
          Length = 928

 Score = 35.4 bits (80), Expect = 4.9,   Method: Composition-based stats.
 Identities = 14/30 (46%), Positives = 20/30 (66%)

Query: 10  SRGRGSNGGNGSFNRKNLNPLVRNYDSNGY 39
           S G G+NGG+G+ N  N + +V  +D NGY
Sbjct: 765 STGMGANGGDGTINDGNWHHVVHTFDRNGY 794


>gi|238021064|ref|ZP_04601490.1| hypothetical protein GCWU000324_00961 [Kingella oralis ATCC 51147]
 gi|237868044|gb|EEP69050.1| hypothetical protein GCWU000324_00961 [Kingella oralis ATCC 51147]
          Length = 397

 Score = 35.4 bits (80), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 38/70 (54%), Gaps = 1/70 (1%)

Query: 53  RYSVLARDAMSAGDYVVAENHLQHAEHYN-RIVSMAQAQIQEKLQRDEQDDLLVKEQKER 111
           R+ +LA  A++  DY  A  HL  A   N R+  +A+ Q++  L + +  D+L K +K  
Sbjct: 158 RHLLLAESALNQQDYDTANTHLTAAAQINPRLTRLARLQLRMALDKGDALDILDKTEKLH 217

Query: 112 AQNALSEFEA 121
              A++E EA
Sbjct: 218 RAGAMNETEA 227


>gi|159899052|ref|YP_001545299.1| TPR repeat-containing protein [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159892091|gb|ABX05171.1| TPR repeat-containing protein [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 798

 Score = 35.4 bits (80), Expect = 5.4,   Method: Composition-based stats.
 Identities = 33/124 (26%), Positives = 53/124 (42%), Gaps = 7/124 (5%)

Query: 15  SNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHL 74
           +N G  S  R    P  R Y  +   +   G  + IAE    LA  A+ AG Y +    L
Sbjct: 673 TNLGAISLQRGEFQPAQRYYQQSLQVLHQLGERESIAECLEGLAILAIQAGQYQLGAQRL 732

Query: 75  QHAEHYNRIVSMAQAQIQEKL------QRDEQDDLLVKEQKERAQNALSEFEASPCPLIE 128
              EH    +   +++ ++ L      Q ++Q DL +++Q  R Q +L   E+     + 
Sbjct: 733 IVVEHLRESIGAPRSEPEQALLAPWISQLEQQLDLGIRQQL-RQQTSLDRLESMIEQALN 791

Query: 129 EGKE 132
           EG E
Sbjct: 792 EGVE 795


>gi|268576973|ref|XP_002643468.1| Hypothetical protein CBG16126 [Caenorhabditis briggsae]
          Length = 222

 Score = 35.0 bits (79), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 41/76 (53%), Gaps = 5/76 (6%)

Query: 50  IAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDD--LLVKE 107
           + ERY  L+R+ M     +  E H Q + H  R V  AQ Q +  LQRD++DD    +++
Sbjct: 91  LLERY--LSRENMHTPSPIPLEYH-QQSHHSPRHVHFAQTQSRRPLQRDQRDDSAASIRK 147

Query: 108 QKERAQNALSEFEASP 123
           +  R+ + LS+   SP
Sbjct: 148 RLSRSCDHLSDHNFSP 163


>gi|149191190|ref|ZP_01869447.1| Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase
           component, eukaryotic type, alpha subunit [Vibrio
           shilonii AK1]
 gi|148834939|gb|EDL51919.1| Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase
           component, eukaryotic type, alpha subunit [Vibrio
           shilonii AK1]
          Length = 363

 Score = 35.0 bits (79), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (53%)

Query: 70  AENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASP 123
           +++ LQ A  Y  I  +    I   L  DEQ+ LLV+E K   + A++ + A+P
Sbjct: 271 SDSELQQAWDYEPIKRLKSYLIARSLWSDEQEQLLVQEAKTIVEEAVTRYLATP 324


>gi|260907582|ref|ZP_05915904.1| hypothetical protein BlinB_19757 [Brevibacterium linens BL2]
          Length = 1609

 Score = 35.0 bits (79), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 78/192 (40%), Gaps = 24/192 (12%)

Query: 5    QQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVL------- 57
            + Y R+ G G+         K LN LVR+       V+V+     +A     L       
Sbjct: 868  ELYARAAGEGAP--------KPLNLLVRSSSQGSSSVEVQRRVCVVAANSDTLNHLRDHT 919

Query: 58   ARDAMSAGDYVVAENHLQHAEHYNRI-VSMAQAQIQEKLQRDE-----QDDLLVKEQKER 111
             +  +S+GDY + ++ L      +R+ +S  Q  + E  +  E     +DD  +    +R
Sbjct: 920  TKAIISSGDYEL-DSTLAEKWDLDRVDISFDQTVVGEPTKHAEDRRMVRDDYPMLRSIDR 978

Query: 112  AQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLR 171
                   +E  PC  +       F++ I+   E +AF   D  + K++ Y+   RRR L 
Sbjct: 979  KAGRFGLYELIPCKTVTRRTTNDFDDVIEN--ESLAFAVADQRQGKEIYYRSTLRRRTLL 1036

Query: 172  PRVFPNAKSGNQ 183
              +  +  S N+
Sbjct: 1037 DYILQHTGSKNE 1048


>gi|301606699|ref|XP_002932974.1| PREDICTED: RING finger protein 214 [Xenopus (Silurana) tropicalis]
          Length = 787

 Score = 34.7 bits (78), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 27/46 (58%)

Query: 73  HLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSE 118
            L+H E  N+IV++   Q +EK Q D + DLL K   E  Q+AL E
Sbjct: 451 QLEHKELENKIVTLLAEQTKEKEQWDTELDLLKKLDNEMRQSALQE 496


Searching..................................................done


Results from round 2




>gi|254780876|ref|YP_003065289.1| hypothetical protein CLIBASIA_03865 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040553|gb|ACT57349.1| hypothetical protein CLIBASIA_03865 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 210

 Score =  255 bits (651), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 210/210 (100%), Positives = 210/210 (100%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD
Sbjct: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
           AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE
Sbjct: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120

Query: 121 ASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKS 180
           ASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKS
Sbjct: 121 ASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKS 180

Query: 181 GNQPVEATETIVPQELNSDNASSVDQDCKV 210
           GNQPVEATETIVPQELNSDNASSVDQDCKV
Sbjct: 181 GNQPVEATETIVPQELNSDNASSVDQDCKV 210


>gi|315122702|ref|YP_004063191.1| hypothetical protein CKC_04770 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496104|gb|ADR52703.1| hypothetical protein CKC_04770 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 208

 Score =  201 bits (510), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 141/210 (67%), Positives = 159/210 (75%), Gaps = 2/210 (0%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MRS QQYKRSRGRGS+G NG+F RKNLNPLVRNYDSNGYDVKVRGTAQHIAERYS LARD
Sbjct: 1   MRSGQQYKRSRGRGSSGSNGNFGRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSALARD 60

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
           A+SAGDYVVAENH QHAEHYNRIVS+AQAQIQEKLQRDEQ++LL KE +   QNA S FE
Sbjct: 61  AISAGDYVVAENHFQHAEHYNRIVSIAQAQIQEKLQRDEQENLLSKESRGHVQNAPSGFE 120

Query: 121 ASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKS 180
                 I+E KEP+F + IQP V D  FK P+ S EK    KKV RRR +RPRVF N K 
Sbjct: 121 D--NSTIKEQKEPLFSSDIQPAVGDEVFKAPEPSLEKKAPNKKVYRRRVVRPRVFHNNKI 178

Query: 181 GNQPVEATETIVPQELNSDNASSVDQDCKV 210
            N+P E T T V  +    N+ +VD+D  +
Sbjct: 179 NNKPAEETTTSVLLQSQEVNSETVDKDFTL 208


>gi|261220923|ref|ZP_05935204.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|260919507|gb|EEX86160.1| conserved hypothetical protein [Brucella ceti B1/94]
          Length = 155

 Score =  143 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 71/139 (51%), Positives = 89/139 (64%), Gaps = 8/139 (5%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR  QQ +R RGRG+N      NRK  NPL RNY+SNG DVK+RG AQHIAE+YS LARD
Sbjct: 3   MRPAQQNRRMRGRGNNN-----NRKGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARD 57

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
           A ++GD V+AEN+LQHAEHYNRI+  A AQ     QR+E  D    + +E         E
Sbjct: 58  AQASGDRVMAENYLQHAEHYNRIIMAAMAQQNIPYQREENFDSDGGDDEE---AGFIPAE 114

Query: 121 ASPCPLIEEGKEPIFENSI 139
           A+P P+   G +P+ E + 
Sbjct: 115 AAPQPVNGSGPQPVIEGTP 133


>gi|256253791|ref|ZP_05459327.1| hypothetical protein BcetB_05767 [Brucella ceti B1/94]
          Length = 144

 Score =  138 bits (346), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 66/130 (50%), Positives = 83/130 (63%), Gaps = 8/130 (6%)

Query: 10  SRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVV 69
            RGRG+N      NRK  NPL RNY+SNG DVK+RG AQHIAE+YS LARDA ++GD V+
Sbjct: 1   MRGRGNNN-----NRKGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARDAQASGDRVM 55

Query: 70  AENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEE 129
           AEN+LQHAEHYNRI+  A AQ     QR+E  D    + +E         EA+P P+   
Sbjct: 56  AENYLQHAEHYNRIIMAAMAQQNIPYQREENFDSDGGDDEE---AGFIPAEAAPQPVNGS 112

Query: 130 GKEPIFENSI 139
           G +P+ E + 
Sbjct: 113 GPQPVIEGTP 122


>gi|265982878|ref|ZP_06095613.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|264661470|gb|EEZ31731.1| conserved hypothetical protein [Brucella sp. 83/13]
          Length = 152

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 87/139 (62%), Gaps = 5/139 (3%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR  QQ +R   RG    N + NRK  NPL RNY+SNG DVK+RG AQHIAE+YS LARD
Sbjct: 3   MRPAQQNRRM--RGRGNNNNNNNRKGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARD 60

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
           A ++GD V+AEN+LQHAEHYNRI+  A AQ     QR+E  D    + +E         E
Sbjct: 61  AQASGDRVMAENYLQHAEHYNRIIMAAMAQQNIPYQREENFDSDGGDDEE---AGFIPAE 117

Query: 121 ASPCPLIEEGKEPIFENSI 139
           A+P P+   G +P+ E + 
Sbjct: 118 AAPQPVNGSGPQPVIEGTP 136


>gi|260755550|ref|ZP_05867898.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260675658|gb|EEX62479.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
          Length = 140

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 87/139 (62%), Gaps = 5/139 (3%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR  QQ +R   RG    N + NRK  NPL RNY+SNG DVK+RG AQHIAE+YS LARD
Sbjct: 3   MRPAQQNRRM--RGRGNNNNNNNRKGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARD 60

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
           A ++GD V+AEN+LQHAEHYNRI+  A AQ     QR+E  D    + +E         E
Sbjct: 61  AQASGDRVMAENYLQHAEHYNRIIMAAMAQQNIPYQREENFDSDGGDDEE---AGFIPAE 117

Query: 121 ASPCPLIEEGKEPIFENSI 139
           A+P P+   G +P+ E + 
Sbjct: 118 AAPQPVNGSGPQPVIEGTP 136


>gi|254717937|ref|ZP_05179748.1| hypothetical protein Bru83_00025 [Brucella sp. 83/13]
          Length = 150

 Score =  136 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 87/139 (62%), Gaps = 5/139 (3%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR  QQ +R R  G    N + NRK  NPL RNY+SNG DVK+RG AQHIAE+YS LARD
Sbjct: 1   MRPAQQNRRMR--GRGNNNNNNNRKGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARD 58

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
           A ++GD V+AEN+LQHAEHYNRI+  A AQ     QR+E  D    + +E         E
Sbjct: 59  AQASGDRVMAENYLQHAEHYNRIIMAAMAQQNIPYQREENFDSDGGDDEE---AGFIPAE 115

Query: 121 ASPCPLIEEGKEPIFENSI 139
           A+P P+   G +P+ E + 
Sbjct: 116 AAPQPVNGSGPQPVIEGTP 134


>gi|297247113|ref|ZP_06930831.1| conserved hypothetical protein [Brucella abortus bv. 5 str. B3196]
 gi|297174282|gb|EFH33629.1| conserved hypothetical protein [Brucella abortus bv. 5 str. B3196]
          Length = 148

 Score =  136 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 87/139 (62%), Gaps = 5/139 (3%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR  QQ +R R  G    N + NRK  NPL RNY+SNG DVK+RG AQHIAE+YS LARD
Sbjct: 3   MRPAQQNRRMR--GRGNNNNNNNRKGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARD 60

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
           A ++GD V+AEN+LQHAEHYNRI+  A AQ     QR+E  D    + +E         E
Sbjct: 61  AQASGDRVMAENYLQHAEHYNRIIMAAMAQQNIPYQREENFDSDGGDDEE---AGFIPAE 117

Query: 121 ASPCPLIEEGKEPIFENSI 139
           A+P P+   G +P+ E + 
Sbjct: 118 AAPQPVNGSGPQPVIEGTP 136


>gi|254690015|ref|ZP_05153269.1| hypothetical protein Babob68_07561 [Brucella abortus bv. 6 str.
           870]
          Length = 129

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 56/110 (50%), Positives = 72/110 (65%), Gaps = 3/110 (2%)

Query: 30  LVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQA 89
           L RNY+SNG DVK+RG AQHIAE+YS LARDA ++GD V+AEN+LQHAEHYNRI+  A A
Sbjct: 19  LSRNYESNGPDVKIRGNAQHIAEKYSALARDAQASGDRVMAENYLQHAEHYNRIIMAAMA 78

Query: 90  QIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSI 139
           Q     QR+E  D    + +E         EA+P P+   G +P+ E + 
Sbjct: 79  QQNIPYQREENFDSDGGDDEE---AGFIPAEAAPQPVNGSGPQPVIEGTP 125


>gi|261755578|ref|ZP_05999287.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|261745331|gb|EEY33257.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
          Length = 137

 Score =  135 bits (338), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 87/139 (62%), Gaps = 5/139 (3%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR  QQ +R   RG    N + NRK  NPL RNY+SNG DVK+RG AQHIAE+YS LARD
Sbjct: 3   MRPAQQNRRM--RGRGNNNNNNNRKGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARD 60

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
           A ++GD V+AEN+LQHAEHYNRI+  A AQ     QR+E  D    + +E         E
Sbjct: 61  AQASGDRVMAENYLQHAEHYNRIIMAAMAQQNIPYQREENFDSDGGDDEE---AGFIPAE 117

Query: 121 ASPCPLIEEGKEPIFENSI 139
           A+P P+   G +P+ E + 
Sbjct: 118 AAPQPVNGSGPQPVIEGTP 136


>gi|254704885|ref|ZP_05166713.1| hypothetical protein Bsuib36_13400 [Brucella suis bv. 3 str. 686]
          Length = 126

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 56/110 (50%), Positives = 72/110 (65%), Gaps = 3/110 (2%)

Query: 30  LVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQA 89
           L RNY+SNG DVK+RG AQHIAE+YS LARDA ++GD V+AEN+LQHAEHYNRI+  A A
Sbjct: 19  LSRNYESNGPDVKIRGNAQHIAEKYSALARDAQASGDRVMAENYLQHAEHYNRIIMAAMA 78

Query: 90  QIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSI 139
           Q     QR+E  D    + +E         EA+P P+   G +P+ E + 
Sbjct: 79  QQNIPYQREENFDSDGGDDEE---AGFIPAEAAPQPVNGSGPQPVIEGTP 125


>gi|261321455|ref|ZP_05960652.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261294145|gb|EEX97641.1| conserved hypothetical protein [Brucella ceti M644/93/1]
          Length = 159

 Score =  131 bits (328), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 87/139 (62%), Gaps = 5/139 (3%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR  QQ +R R  G    N + NRK  NPL RNY+SNG DVK+RG AQHIAE+YS LARD
Sbjct: 3   MRPAQQNRRMR--GRGNNNNNNNRKGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARD 60

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
           A ++GD V+AEN+LQHAEHYNRI+  A AQ     QR+E  D    + +E         E
Sbjct: 61  AQASGDRVMAENYLQHAEHYNRIIMAAMAQQNIPYQREENFDSDGGDDEE---AGFIPAE 117

Query: 121 ASPCPLIEEGKEPIFENSI 139
           A+P P+   G +P+ E + 
Sbjct: 118 AAPQPVNGSGPQPVIEGTP 136


>gi|254708863|ref|ZP_05170674.1| hypothetical protein BpinB_01103 [Brucella pinnipedialis B2/94]
 gi|261316355|ref|ZP_05955552.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261295578|gb|EEX99074.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
          Length = 162

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 71/164 (43%), Positives = 91/164 (55%), Gaps = 5/164 (3%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR  QQ +R R  G    N + NRK  NPL RNY+SNG DVK+RG AQHIAE+YS LARD
Sbjct: 3   MRPAQQNRRMR--GRGNNNNNNNRKGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARD 60

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
           A ++GD V+AEN+LQHAEHYNRI+  A AQ     QR+E  D    + +E         E
Sbjct: 61  AQASGDRVMAENYLQHAEHYNRIIMAAMAQQNIPYQREENFDSDGGDDEE---AGFIPAE 117

Query: 121 ASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKV 164
           A+P P+   G +P+ E +    V            E     ++ 
Sbjct: 118 AAPQPVNGSGPQPVIEGTPAEVVYGEENGEATKPGEGRQPRERE 161


>gi|260545989|ref|ZP_05821729.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260096096|gb|EEW79972.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
          Length = 164

 Score =  130 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 72/166 (43%), Positives = 92/166 (55%), Gaps = 5/166 (3%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR  QQ +R   RG    N + NRK  NPL RNY+SNG DVK+RG AQHIAE+YS LARD
Sbjct: 3   MRPAQQNRRM--RGRGNNNNNNNRKGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARD 60

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
           A ++GD V+AEN+LQHAEHYNRI+  A AQ     QR+E  D    + +E         E
Sbjct: 61  AQASGDRVMAENYLQHAEHYNRIIMAAMAQQNIPYQREENFDSDGGDDEE---AGFIPAE 117

Query: 121 ASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRR 166
           A+P P+   G +P+ E +    V            E     ++  R
Sbjct: 118 AAPQPVNGSGPQPVIEGTPAEVVYGEENGEATKPGEGRQPREREGR 163


>gi|265999303|ref|ZP_06111640.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|263093129|gb|EEZ17264.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
          Length = 166

 Score =  129 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 73/168 (43%), Positives = 93/168 (55%), Gaps = 5/168 (2%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR  QQ +R R  G    N + NRK  NPL RNY+SNG DVK+RG AQHIAE+YS LARD
Sbjct: 3   MRPAQQNRRMR--GRGNNNNNNNRKGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARD 60

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
           A ++GD V+AEN+LQHAEHYNRI+  A AQ     QR+E  D    + +E         E
Sbjct: 61  AQASGDRVMAENYLQHAEHYNRIIMAAMAQQNIPYQREENFDSDGGDDEE---AGFIPAE 117

Query: 121 ASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRR 168
           A+P P+   G +P+ E +    V            E     ++  R R
Sbjct: 118 AAPQPVNGSGPQPVIEGTPAEVVYGEENGEATKPGEGRQPREREGRDR 165


>gi|254713714|ref|ZP_05175525.1| hypothetical protein BcetM6_10225 [Brucella ceti M644/93/1]
          Length = 148

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 60/133 (45%), Positives = 78/133 (58%), Gaps = 6/133 (4%)

Query: 30  LVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQA 89
           L RNY+SNG DVK+RG AQHIAE+YS LARDA ++GD V+AEN+LQHAEHYNRI+  A A
Sbjct: 19  LSRNYESNGPDVKIRGNAQHIAEKYSALARDAQASGDRVMAENYLQHAEHYNRIIMAAMA 78

Query: 90  QIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV---EDV 146
           Q     QR+E  D    + +E         EA+P P+   G +P+ E +    V   E+ 
Sbjct: 79  QQNIPYQREENFDSDGGDDEE---AGFIPAEAAPQPVNGSGPQPVIEGTPAEVVYGEENG 135

Query: 147 AFKTPDISREKDV 159
               P   R+   
Sbjct: 136 EATKPGEGRQPRE 148


>gi|294851109|ref|ZP_06791782.1| conserved hypothetical protein [Brucella sp. NVSL 07-0026]
 gi|294819698|gb|EFG36697.1| conserved hypothetical protein [Brucella sp. NVSL 07-0026]
          Length = 154

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 60/139 (43%), Positives = 78/139 (56%), Gaps = 3/139 (2%)

Query: 30  LVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQA 89
           L RNY+SNG DVK+RG AQHIAE+YS LARDA ++GD V+AEN+LQHAEHYNRI+  A A
Sbjct: 19  LSRNYESNGPDVKIRGNAQHIAEKYSALARDAQASGDRVMAENYLQHAEHYNRIIMAAMA 78

Query: 90  QIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFK 149
           Q     QR+E  D    + +E         EA+P P+   G +P+ E +    V      
Sbjct: 79  QQNIPYQREENFDSDGGDDEE---AGFIPAEAAPQPVNGSGPQPVIEGTSAEVVYGEENG 135

Query: 150 TPDISREKDVSYKKVRRRR 168
                 E     ++  R R
Sbjct: 136 EATKPGEGRQPREREGRDR 154


>gi|225628070|ref|ZP_03786105.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|256059847|ref|ZP_05450034.1| hypothetical protein Bneo5_05782 [Brucella neotomae 5K33]
 gi|260562787|ref|ZP_05833273.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260567642|ref|ZP_05838112.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|261758810|ref|ZP_06002519.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|225616895|gb|EEH13942.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|260152803|gb|EEW87895.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260157160|gb|EEW92240.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|261738794|gb|EEY26790.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|326539583|gb|ADZ87798.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 263

 Score =  121 bits (302), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 87/139 (62%), Gaps = 5/139 (3%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR  QQ +R   RG    N + NRK  NPL RNY+SNG DVK+RG AQHIAE+YS LARD
Sbjct: 3   MRPAQQNRRM--RGRGNNNNNNNRKGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARD 60

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
           A ++GD V+AEN+LQHAEHYNRI+  A AQ     QR+E  D    + +E         E
Sbjct: 61  AQASGDRVMAENYLQHAEHYNRIIMAAMAQQNIPYQREENFDSDGGDDEE---AGFIPAE 117

Query: 121 ASPCPLIEEGKEPIFENSI 139
           A+P P+   G +P+ E + 
Sbjct: 118 AAPQPVNGSGPQPVIEGTP 136


>gi|237816232|ref|ZP_04595225.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|237788299|gb|EEP62514.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
          Length = 263

 Score =  121 bits (302), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 87/139 (62%), Gaps = 5/139 (3%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR  QQ +R R  G    N + NRK  NPL RNY+SNG DVK+RG AQHIAE+YS LARD
Sbjct: 3   MRPAQQNRRMR--GRGNNNNNNNRKGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARD 60

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
           A ++GD V+AEN+LQHAEHYNRI+  A AQ     QR+E  D    + +E         E
Sbjct: 61  AQASGDRVMAENYLQHAEHYNRIIMAAMAQQNIPYQREENFDSDGGDDEE---AGFIPAE 117

Query: 121 ASPCPLIEEGKEPIFENSI 139
           A+P P+   G +P+ E + 
Sbjct: 118 AAPQPVNGSGPQPVIEGTP 136


>gi|256045464|ref|ZP_05448352.1| hypothetical protein Bmelb1R_13276 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256158372|ref|ZP_05456270.1| hypothetical protein BcetM4_05925 [Brucella ceti M490/95/1]
 gi|260884574|ref|ZP_05896188.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261217698|ref|ZP_05931979.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261315088|ref|ZP_05954285.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261323816|ref|ZP_05963013.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261751017|ref|ZP_05994726.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|265987427|ref|ZP_06099984.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265991890|ref|ZP_06104447.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265996883|ref|ZP_06109440.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|260874102|gb|EEX81171.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260922787|gb|EEX89355.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261299796|gb|EEY03293.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261304114|gb|EEY07611.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261740770|gb|EEY28696.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|262551351|gb|EEZ07341.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|263002893|gb|EEZ15249.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|264659624|gb|EEZ29885.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
          Length = 261

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 87/139 (62%), Gaps = 5/139 (3%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR  QQ +R R  G    N + NRK  NPL RNY+SNG DVK+RG AQHIAE+YS LARD
Sbjct: 1   MRPAQQNRRMR--GRGNNNNNNNRKGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARD 58

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
           A ++GD V+AEN+LQHAEHYNRI+  A AQ     QR+E  D    + +E         E
Sbjct: 59  AQASGDRVMAENYLQHAEHYNRIIMAAMAQQNIPYQREENFDSDGGDDEE---AGFIPAE 115

Query: 121 ASPCPLIEEGKEPIFENSI 139
           A+P P+   G +P+ E + 
Sbjct: 116 AAPQPVNGSGPQPVIEGTP 134


>gi|189024938|ref|YP_001935706.1| hypothetical protein BAbS19_I17500 [Brucella abortus S19]
 gi|254731048|ref|ZP_05189626.1| hypothetical protein Babob42_07596 [Brucella abortus bv. 4 str.
           292]
 gi|260758773|ref|ZP_05871121.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260760497|ref|ZP_05872840.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|189020510|gb|ACD73232.1| hypothetical protein BAbS19_I17500 [Brucella abortus S19]
 gi|260669091|gb|EEX56031.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260670929|gb|EEX57750.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
          Length = 261

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 87/139 (62%), Gaps = 5/139 (3%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR  QQ +R R  G    N + NRK  NPL RNY+SNG DVK+RG AQHIAE+YS LARD
Sbjct: 1   MRPAQQNRRMR--GRGNNNNNNNRKGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARD 58

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
           A ++GD V+AEN+LQHAEHYNRI+  A AQ     QR+E  D    + +E         E
Sbjct: 59  AQASGDRVMAENYLQHAEHYNRIIMAAMAQQNIPYQREENFDSDGGDDEE---AGFIPAE 115

Query: 121 ASPCPLIEEGKEPIFENSI 139
           A+P P+   G +P+ E + 
Sbjct: 116 AAPQPVNGSGPQPVIEGTP 134


>gi|306842978|ref|ZP_07475612.1| cytoplasmic protein [Brucella sp. BO2]
 gi|306286906|gb|EFM58431.1| cytoplasmic protein [Brucella sp. BO2]
          Length = 263

 Score =  120 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 87/139 (62%), Gaps = 5/139 (3%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR  QQ +R R  G    N + NRK  NPL RNY+SNG DVK+RG AQHIAE+YS LARD
Sbjct: 3   MRPAQQNRRMR--GRGNNNNNNNRKGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARD 60

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
           A ++GD V+AEN+LQHAEHYNRI+  A AQ     QR+E  D    + +E         E
Sbjct: 61  AQASGDRVMAENYLQHAEHYNRIIMAAMAQQNIPYQREENFDSDGGDDEE---AGFIPAE 117

Query: 121 ASPCPLIEEGKEPIFENSI 139
           A+P P+   G +P+ E + 
Sbjct: 118 AAPQPVNGSGPQPVIEGTP 136


>gi|306844839|ref|ZP_07477422.1| cytoplasmic protein [Brucella sp. BO1]
 gi|306274771|gb|EFM56552.1| cytoplasmic protein [Brucella sp. BO1]
          Length = 261

 Score =  119 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 87/139 (62%), Gaps = 5/139 (3%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR  QQ +R R  G    N + NRK  NPL RNY+SNG DVK+RG AQHIAE+YS LARD
Sbjct: 1   MRPAQQNRRMR--GRGNNNNNNNRKGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARD 58

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
           A ++GD V+AEN+LQHAEHYNRI+  A AQ     QR+E  D    + +E         E
Sbjct: 59  AQASGDRVMAENYLQHAEHYNRIIMAAMAQQNIPYQREENFDSDGGDDEE---AGFIPAE 115

Query: 121 ASPCPLIEEGKEPIFENSI 139
           A+P P+   G +P+ E + 
Sbjct: 116 AAPQPVNGSGPQPVIEGTP 134


>gi|148559868|ref|YP_001259695.1| hypothetical protein BOV_1798 [Brucella ovis ATCC 25840]
 gi|148371125|gb|ABQ61104.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
          Length = 261

 Score =  118 bits (296), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 87/139 (62%), Gaps = 5/139 (3%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR  QQ +R R  G    N + NRK  NPL RNY+SNG DVK+RG AQHIAE+YS LARD
Sbjct: 1   MRPAQQNRRMR--GRGNNNNNNNRKGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARD 58

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
           A ++GD V+AEN+LQHAEHYNRI+  A AQ     QR+E  D    + +E         E
Sbjct: 59  AQASGDRVMAENYLQHAEHYNRIIMAAMAQQNIPYQREENFDSDGGDDEE---AGFIPAE 115

Query: 121 ASPCPLIEEGKEPIFENSI 139
           A+P P+   G +P+ E + 
Sbjct: 116 AAPQPVNGSGPQPVIEGTP 134


>gi|17986478|ref|NP_539112.1| putative cytoplasmic protein [Brucella melitensis bv. 1 str. 16M]
 gi|23502718|ref|NP_698845.1| hypothetical protein BR1865 [Brucella suis 1330]
 gi|161619783|ref|YP_001593670.1| hypothetical protein BCAN_A1909 [Brucella canis ATCC 23365]
 gi|163843891|ref|YP_001628295.1| hypothetical protein BSUIS_A1706 [Brucella suis ATCC 23445]
 gi|225853304|ref|YP_002733537.1| hypothetical protein BMEA_A1919 [Brucella melitensis ATCC 23457]
 gi|254694505|ref|ZP_05156333.1| hypothetical protein Babob3T_07564 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254700514|ref|ZP_05162342.1| hypothetical protein Bsuib55_06631 [Brucella suis bv. 5 str. 513]
 gi|254707600|ref|ZP_05169428.1| hypothetical protein BpinM_11671 [Brucella pinnipedialis
           M163/99/10]
 gi|254715936|ref|ZP_05177747.1| hypothetical protein BcetM_05797 [Brucella ceti M13/05/1]
 gi|256030389|ref|ZP_05444003.1| hypothetical protein BpinM2_07035 [Brucella pinnipedialis
           M292/94/1]
 gi|256258270|ref|ZP_05463806.1| hypothetical protein Babob9C_13178 [Brucella abortus bv. 9 str.
           C68]
 gi|256370265|ref|YP_003107776.1| hypothetical protein BMI_I1885 [Brucella microti CCM 4915]
 gi|260169298|ref|ZP_05756109.1| hypothetical protein BruF5_13260 [Brucella sp. F5/99]
 gi|261214821|ref|ZP_05929102.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|17982077|gb|AAL51376.1| hypothetical cytosolic protein [Brucella melitensis bv. 1 str. 16M]
 gi|23348733|gb|AAN30760.1| conserved hypothetical protein [Brucella suis 1330]
 gi|161336594|gb|ABX62899.1| Hypothetical protein BCAN_A1909 [Brucella canis ATCC 23365]
 gi|163674614|gb|ABY38725.1| Hypothetical protein BSUIS_A1706 [Brucella suis ATCC 23445]
 gi|225641669|gb|ACO01583.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457]
 gi|256000428|gb|ACU48827.1| hypothetical protein BMI_I1885 [Brucella microti CCM 4915]
 gi|260916428|gb|EEX83289.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|326409869|gb|ADZ66934.1| conserved hypothetical protein [Brucella melitensis M28]
          Length = 252

 Score =  118 bits (294), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 56/110 (50%), Positives = 72/110 (65%), Gaps = 3/110 (2%)

Query: 30  LVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQA 89
           L RNY+SNG DVK+RG AQHIAE+YS LARDA ++GD V+AEN+LQHAEHYNRI+  A A
Sbjct: 19  LSRNYESNGPDVKIRGNAQHIAEKYSALARDAQASGDRVMAENYLQHAEHYNRIIMAAMA 78

Query: 90  QIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSI 139
           Q     QR+E  D    + +E         EA+P P+   G +P+ E + 
Sbjct: 79  QQNIPYQREENFDSDGGDDEE---AGFIPAEAAPQPVNGSGPQPVIEGTP 125


>gi|62290726|ref|YP_222519.1| hypothetical protein BruAb1_1844 [Brucella abortus bv. 1 str.
           9-941]
 gi|82700639|ref|YP_415213.1| hypothetical protein BAB1_1869 [Brucella melitensis biovar Abortus
           2308]
 gi|254696130|ref|ZP_05157958.1| hypothetical protein Babob28_00052 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|62196858|gb|AAX75158.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616740|emb|CAJ11825.1| conserved hypothetical protein [Brucella melitensis biovar Abortus
           2308]
          Length = 252

 Score =  117 bits (293), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 56/110 (50%), Positives = 72/110 (65%), Gaps = 3/110 (2%)

Query: 30  LVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQA 89
           L RNY+SNG DVK+RG AQHIAE+YS LARDA ++GD V+AEN+LQHAEHYNRI+  A A
Sbjct: 19  LSRNYESNGPDVKIRGNAQHIAEKYSALARDAQASGDRVMAENYLQHAEHYNRIIMAAMA 78

Query: 90  QIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSI 139
           Q     QR+E  D    + +E         EA+P P+   G +P+ E + 
Sbjct: 79  QQNIPYQREENFDSDGGDDEE---AGFIPAEAAPQPVNGSGPQPVIEGTP 125


>gi|319409236|emb|CBI82880.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 88

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 45/85 (52%), Positives = 57/85 (67%)

Query: 7  YKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGD 66
           +  + R     N + NR+  NPL RNY+SNG DVK+RG AQ IA++Y  LARDA  AGD
Sbjct: 1  MRSQQNRRVRNRNNNNNRRGPNPLSRNYESNGPDVKIRGNAQQIADKYISLARDAQGAGD 60

Query: 67 YVVAENHLQHAEHYNRIVSMAQAQI 91
           V++EN+LQHAEHY RI+  A   I
Sbjct: 61 RVMSENYLQHAEHYLRIILAAVGHI 85


>gi|265993631|ref|ZP_06106188.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|262764612|gb|EEZ10533.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
          Length = 255

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 68/142 (47%), Positives = 85/142 (59%), Gaps = 5/142 (3%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR  QQ +R   RG    N + NRK  NPL RNY+SNG DVK+RG AQHIAE+YS LARD
Sbjct: 3   MRPAQQNRRM--RGRGNNNNNNNRKGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARD 60

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
           A ++GD V+AEN+LQHAEHYNRI+  A AQ     QR+E  D    + +E         E
Sbjct: 61  AQASGDRVMAENYLQHAEHYNRIIMAAMAQQNIPYQREENFDSDGGDDEE---AGFIPAE 117

Query: 121 ASPCPLIEEGKEPIFENSIQPK 142
           A+P P+IE     +       +
Sbjct: 118 AAPQPVIEGTPAEVVYGEENGE 139


>gi|195970144|ref|NP_386715.2| hypothetical protein SMc02434 [Sinorhizobium meliloti 1021]
 gi|307313051|ref|ZP_07592678.1| conserved hypothetical protein [Sinorhizobium meliloti BL225C]
 gi|307321058|ref|ZP_07600464.1| conserved hypothetical protein [Sinorhizobium meliloti AK83]
 gi|187904205|emb|CAC47188.2| Hypothetical protein SMc02434 [Sinorhizobium meliloti 1021]
 gi|306893333|gb|EFN24113.1| conserved hypothetical protein [Sinorhizobium meliloti AK83]
 gi|306899370|gb|EFN30004.1| conserved hypothetical protein [Sinorhizobium meliloti BL225C]
          Length = 214

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 67/181 (37%), Positives = 96/181 (53%), Gaps = 19/181 (10%)

Query: 29  PLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
           PL R YDS+G DVK+RGTAQHIAE+Y+ LARDA S+GD V+AEN+LQHAEHYNRI++ AQ
Sbjct: 31  PLTRTYDSSGPDVKIRGTAQHIAEKYAALARDAQSSGDRVIAENYLQHAEHYNRIIAAAQ 90

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNALSE----------------FEASPCPLIEEGKE 132
           AQ+Q++ QRDE+ D   ++  +R Q+ L +                       +   G +
Sbjct: 91  AQMQDRFQRDERQDYQDRDSADRDQDDLDQGYSEEMPVAPSAAAAPANEPQPVIDGSGPQ 150

Query: 133 PIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIV 192
           P+ E       E    +    S  +  S ++   R   +PR     ++G      T+   
Sbjct: 151 PVIEGMP---AEVAMEEEAQGSAGRSASRRRSTSRPRRQPRRGAQEEAGGDAQPETDGNT 207

Query: 193 P 193
           P
Sbjct: 208 P 208


>gi|153008373|ref|YP_001369588.1| hypothetical protein Oant_1038 [Ochrobactrum anthropi ATCC 49188]
 gi|151560261|gb|ABS13759.1| conserved hypothetical protein [Ochrobactrum anthropi ATCC 49188]
          Length = 263

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 72/163 (44%), Positives = 92/163 (56%), Gaps = 4/163 (2%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR  QQ +R RG   N  N + NRK  NPL RNY+SNG DVK+RG AQHIAE+YS LARD
Sbjct: 3   MRPAQQNRRMRG-RGNNNNNNNNRKGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARD 61

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
           A ++GD V+AEN+LQHAEHYNRI+  A AQ     QR+E  D    +     +   +   
Sbjct: 62  AQASGDRVMAENYLQHAEHYNRIIMAAMAQNPVPFQREETFDDDGADD---EEAGFTPVA 118

Query: 121 ASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKK 163
           A P P+   G +P+ E +    V       P  S E     ++
Sbjct: 119 AQPQPVNGSGPQPVIEGTPAEVVYGEDGGEPVKSGEGRQQPRE 161


>gi|256112204|ref|ZP_05453125.1| hypothetical protein Bmelb3E_05882 [Brucella melitensis bv. 3 str.
           Ether]
          Length = 253

 Score =  111 bits (276), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 68/142 (47%), Positives = 85/142 (59%), Gaps = 5/142 (3%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR  QQ +R R  G    N + NRK  NPL RNY+SNG DVK+RG AQHIAE+YS LARD
Sbjct: 1   MRPAQQNRRMR--GRGNNNNNNNRKGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARD 58

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
           A ++GD V+AEN+LQHAEHYNRI+  A AQ     QR+E  D    + +E         E
Sbjct: 59  AQASGDRVMAENYLQHAEHYNRIIMAAMAQQNIPYQREENFDSDGGDDEE---AGFIPAE 115

Query: 121 ASPCPLIEEGKEPIFENSIQPK 142
           A+P P+IE     +       +
Sbjct: 116 AAPQPVIEGTPAEVVYGEENGE 137


>gi|209883259|ref|YP_002287116.1| hypothetical protein OCAR_4100 [Oligotropha carboxidovorans OM5]
 gi|209871455|gb|ACI91251.1| conserved hypothetical protein [Oligotropha carboxidovorans OM5]
          Length = 229

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 62/167 (37%), Positives = 92/167 (55%), Gaps = 6/167 (3%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR+ Q   + R RG +GGN   NR+  NP+ R ++SNG D+K+RGTA HIAE+Y  LARD
Sbjct: 1   MRNGQNNNK-RMRGRSGGNHGNNRRGQNPMTRVFESNGPDIKIRGTASHIAEKYVQLARD 59

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKER--AQNALSE 118
           A S+GD V AEN+ QHAEHY R+++ AQ Q+++   + +Q      E  E    ++  S 
Sbjct: 60  ARSSGDPVAAENYYQHAEHYFRLIAAAQEQLRQSQPQQQQPPRAEGESSEDFSEEDNYSN 119

Query: 119 FEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVR 165
           F A P    +  +   F    Q +      + P   RE   + ++ +
Sbjct: 120 FGAEPGFAPQPQQ---FTQREQSQPYPQQREQPREYREPRENTRQQQ 163


>gi|239832944|ref|ZP_04681273.1| Retinitis pigmentosa 1-like 1 protein [Ochrobactrum intermedium LMG
           3301]
 gi|239825211|gb|EEQ96779.1| Retinitis pigmentosa 1-like 1 protein [Ochrobactrum intermedium LMG
           3301]
          Length = 263

 Score =  110 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 77/204 (37%), Positives = 102/204 (50%), Gaps = 6/204 (2%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR  QQ +R R  G    N + NRK  NPL RNY+SNG DVK+RG AQHIAE+YS LARD
Sbjct: 3   MRPAQQNRRMR--GRGNNNNNNNRKGPNPLSRNYESNGPDVKIRGNAQHIAEKYSALARD 60

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
           A ++GD V+AEN+LQHAEHYNRI+  A AQ     QR+E  D    + +E          
Sbjct: 61  AQASGDRVMAENYLQHAEHYNRIIMAAMAQNPVPFQREETFDDDGADDEEAVFTP----A 116

Query: 121 ASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKS 180
           A+  P+   G +P+ E +    V       P  S E     ++   R     R     + 
Sbjct: 117 AAQQPVNGSGPQPVIEGTPAEVVYGEESGEPVKSGEGRQQPRERDNRDRRLGRGRRPQRE 176

Query: 181 GNQPVEATETIVPQELNSDNASSV 204
                E ++   P++     A  V
Sbjct: 177 RFNADERSDEQSPEKQAQPEAEDV 200


>gi|316932077|ref|YP_004107059.1| hypothetical protein Rpdx1_0689 [Rhodopseudomonas palustris DX-1]
 gi|315599791|gb|ADU42326.1| hypothetical protein Rpdx1_0689 [Rhodopseudomonas palustris DX-1]
          Length = 234

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 59/167 (35%), Positives = 89/167 (53%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR+ Q  KR R R +N GN + NR+  NP+ R ++SNG D+K+RGTA HIAE+Y  LARD
Sbjct: 1   MRNGQNNKRLRNRNNNSGNNNNNRRGQNPMTRVFESNGPDIKIRGTASHIAEKYVQLARD 60

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
           A S+GD V AEN+ QHAEHY R+++ AQ Q ++   +   D+  +    +      S F 
Sbjct: 61  ARSSGDPVAAENYYQHAEHYFRLIAAAQEQFRQNQPQPRIDNDTLDNTDDGEDGEFSNFG 120

Query: 121 ASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRR 167
           A P  +  +  +P  +       +      P   R +     + + +
Sbjct: 121 AEPGLVPVQQPQPYQQREQPQPYQPREQPQPREHRPQPQFVPREQPQ 167


>gi|90422034|ref|YP_530404.1| hypothetical protein RPC_0510 [Rhodopseudomonas palustris BisB18]
 gi|90104048|gb|ABD86085.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB18]
          Length = 272

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 52/153 (33%), Positives = 80/153 (52%), Gaps = 7/153 (4%)

Query: 26  NLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVS 85
             NP+ R ++SNG D+K+RGTA H+AE+Y  LARDA S+GD V AEN+ QHAEHY R+++
Sbjct: 33  GQNPMTRVFESNGPDIKIRGTASHVAEKYVQLARDARSSGDPVAAENYYQHAEHYFRLIA 92

Query: 86  MAQAQIQEKLQRDEQDDLLVKEQKERAQ-NALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
            AQ Q ++ L +   D+ +  +  E     + S F A P  +      P+      P+  
Sbjct: 93  AAQEQFRQNLPQQRTDNEMQDDSGEFGDGESYSNFGAEPGLV------PVQPQPFVPREP 146

Query: 145 DVAFKTPDISREKDVSYKKVRRRRPLRPRVFPN 177
                     +++D    + R +R  R +  P 
Sbjct: 147 QQQRDQQPREQQRDAQPYQPREQREPREQQQPR 179


>gi|110635326|ref|YP_675534.1| hypothetical protein Meso_2997 [Mesorhizobium sp. BNC1]
 gi|110286310|gb|ABG64369.1| conserved hypothetical protein [Chelativorans sp. BNC1]
          Length = 275

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 58/142 (40%), Positives = 85/142 (59%), Gaps = 1/142 (0%)

Query: 9   RSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYV 68
           R + +         NRK  NPL R+Y+SNG DVK+RGTAQ IA++Y+ LARDA S+GD V
Sbjct: 28  RPQQQNRRMRGRGNNRKGPNPLTRSYESNGPDVKIRGTAQQIADKYATLARDAQSSGDRV 87

Query: 69  VAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIE 128
           +AEN+LQHAEHYNR+++ A AQ+Q +    +  +  + + +ER +    E +  P     
Sbjct: 88  MAENYLQHAEHYNRLIAAAMAQVQPQQNLRDFREDDLGDDEEREEREEHEAQGLPNGNGR 147

Query: 129 EGKEPIFENS-IQPKVEDVAFK 149
            G   I + S  QP ++ V  +
Sbjct: 148 AGASSINDGSGPQPVIDGVPAE 169


>gi|296116161|ref|ZP_06834779.1| hypothetical protein GXY_10204 [Gluconacetobacter hansenii ATCC
           23769]
 gi|295977267|gb|EFG84027.1| hypothetical protein GXY_10204 [Gluconacetobacter hansenii ATCC
           23769]
          Length = 172

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 50/148 (33%), Positives = 75/148 (50%), Gaps = 8/148 (5%)

Query: 5   QQYKRSRGR----GSNGGNGSFNRKNLNPLVRN--YDSNGYDVKVRGTAQHIAERYSVLA 58
              KR RGR    G + G G+ +     PL RN  +DSNG D++VRGTAQ + E+Y  L 
Sbjct: 1   MNIKRMRGRHHRSGGSNGGGTRHNNGQIPLNRNHVFDSNGPDLRVRGTAQQLFEKYLQLG 60

Query: 59  RDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSE 118
           RDA  AGD V+AE + QHAEHY RI++      Q+  Q  ++     ++++      +  
Sbjct: 61  RDASGAGDRVMAEAYFQHAEHYFRILNAMTQAAQQSQQERQERQATRQQRQ--PHTPIQN 118

Query: 119 FEASPCPLIEEGKEPIFENSIQPKVEDV 146
              +     EE        +I+P+ + V
Sbjct: 119 TTEADSESDEEENNESVAETIKPEPKPV 146


>gi|218660372|ref|ZP_03516302.1| hypothetical protein RetlI_12504 [Rhizobium etli IE4771]
          Length = 119

 Score =  108 bits (268), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 47/65 (72%), Positives = 57/65 (87%)

Query: 29  PLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
           PL R YDS+G DVK+RGTAQHIAE+Y+ LARDA S+GD V+AEN+LQHAEHYNRI++ AQ
Sbjct: 37  PLTRTYDSSGPDVKIRGTAQHIAEKYAQLARDAQSSGDRVMAENYLQHAEHYNRIIASAQ 96

Query: 89  AQIQE 93
           AQ+Q 
Sbjct: 97  AQMQS 101


>gi|92116089|ref|YP_575818.1| hypothetical protein Nham_0468 [Nitrobacter hamburgensis X14]
 gi|91798983|gb|ABE61358.1| conserved hypothetical protein [Nitrobacter hamburgensis X14]
          Length = 240

 Score =  108 bits (268), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 53/150 (35%), Positives = 79/150 (52%), Gaps = 3/150 (2%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR+ Q   +     +N  N + NR+  NP+ R ++SNG D+K+RGTA H+AE+Y  LARD
Sbjct: 1   MRNGQNNNKRMRNRNNSNNNNNNRRGQNPMTRVFESNGPDIKIRGTASHVAEKYVQLARD 60

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQD---DLLVKEQKERAQNALS 117
           A S+GD V AEN+ QHAEHY R+++ AQ Q ++   + +     D       +    + S
Sbjct: 61  ARSSGDPVAAENYYQHAEHYFRLIAAAQEQFRQSQPQQQPRIDVDTPDDAGGDDDSESYS 120

Query: 118 EFEASPCPLIEEGKEPIFENSIQPKVEDVA 147
            F A P  +  +      +   QP   D  
Sbjct: 121 NFGAEPGFVPVQQPRDHHQRDPQPFQRDQQ 150


>gi|49476055|ref|YP_034096.1| hypothetical protein BH13890 [Bartonella henselae str. Houston-1]
 gi|49238863|emb|CAF28154.1| hypothetical protein BH13890 [Bartonella henselae str. Houston-1]
          Length = 244

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 52/108 (48%), Positives = 70/108 (64%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR  Q  +      +N GN + NR+  NPL RNY+S+G DVK+RG AQ IA++Y  LARD
Sbjct: 1   MRPQQNRRARGRNNNNNGNSNNNRRGPNPLSRNYESSGPDVKIRGNAQQIADKYISLARD 60

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQ 108
           A  AGD V++EN+LQHAEHY RI+  A  Q  + ++RDE  D    ++
Sbjct: 61  AQGAGDRVMSENYLQHAEHYLRIILAAVGQTPQSVRRDENRDENNAQE 108


>gi|150397698|ref|YP_001328165.1| hypothetical protein Smed_2500 [Sinorhizobium medicae WSM419]
 gi|150029213|gb|ABR61330.1| conserved hypothetical protein [Sinorhizobium medicae WSM419]
          Length = 219

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 56/120 (46%), Positives = 77/120 (64%)

Query: 29  PLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
           PL R YDS+G DVK+RGTAQHIAE+Y+ LARDA S+GD V+AEN+LQHAEHYNRI++ AQ
Sbjct: 31  PLTRTYDSSGPDVKIRGTAQHIAEKYAALARDAQSSGDRVIAENYLQHAEHYNRIIAAAQ 90

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
           AQ+Q++ QRDE+ D   ++  +R      + +       E    P    +   + + V  
Sbjct: 91  AQMQDRFQRDERQDYQDRDSGDRDSADRDQDDMDQGYADEAPAAPPAAAAPASEPQPVID 150


>gi|209542326|ref|YP_002274555.1| hypothetical protein Gdia_0140 [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209530003|gb|ACI49940.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 144

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 50/142 (35%), Positives = 72/142 (50%), Gaps = 8/142 (5%)

Query: 5   QQYKRSRGRGSNGGNGSFN----RKNLNPLVRN--YDSNGYDVKVRGTAQHIAERYSVLA 58
              KR RGR    G  +      +    PL RN  +DSNG D+++RGTAQ + E+Y  L 
Sbjct: 1   MNMKRMRGRHHRSGGSNGGSIRQQNGQIPLNRNHVFDSNGPDLRIRGTAQQLFEKYLQLG 60

Query: 59  RDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQ-NALS 117
           RDA  +GD V+AE + QHAEHY RI++ A  Q  ++ Q+D Q+    +     A  N   
Sbjct: 61  RDASGSGDRVMAEAYFQHAEHYFRILN-AMTQAAQQNQQDRQERQPRQRPTAVADTNDGE 119

Query: 118 EFEASPCPLIEEGKEPIFENSI 139
             + +P     E  +P  E + 
Sbjct: 120 PGDDAPGEEPAEKGKPDVELAP 141


>gi|227823186|ref|YP_002827158.1| hypothetical protein NGR_c26550 [Sinorhizobium fredii NGR234]
 gi|227342187|gb|ACP26405.1| hypothetical protein NGR_c26550 [Sinorhizobium fredii NGR234]
          Length = 212

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 80/189 (42%), Positives = 101/189 (53%), Gaps = 18/189 (9%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNL--NPLVRNYDSNGYDVKVRGTAQHIAERYSVLA 58
           MR  QQ KR RGR +N GN + N      NPL R YDS+G DVK+RGTAQHIAE+YS LA
Sbjct: 1   MRPGQQNKRGRGRNNNNGNNNNNNNRKGSNPLTRTYDSSGPDVKIRGTAQHIAEKYSALA 60

Query: 59  RDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLL-------------- 104
           RDA S+GD V+AEN+LQHAEHYNRI++ AQAQ+Q++ QR+E+ D                
Sbjct: 61  RDAQSSGDRVIAENYLQHAEHYNRIIAAAQAQMQDRFQREERQDYQDRDIDRDQDDLDQV 120

Query: 105 -VKEQKERAQNALSEFEASPCPLI-EEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK 162
             +     AQ A +     P P+I   G +P+ E        D                 
Sbjct: 121 YAEPAPAAAQPAAAPTAGEPQPVIDGSGPQPVIEGMPAEVAMDEETSAASGRSASRRRSA 180

Query: 163 KVRRRRPLR 171
              RR+P R
Sbjct: 181 SRPRRQPRR 189


>gi|86747198|ref|YP_483694.1| hypothetical protein RPB_0071 [Rhodopseudomonas palustris HaA2]
 gi|86570226|gb|ABD04783.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2]
          Length = 244

 Score =  105 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 59/177 (33%), Positives = 90/177 (50%), Gaps = 9/177 (5%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLN--PLVRNYDSNGYDVKVRGTAQHIAERYSVLA 58
           MR+ Q  KR R R S     + N       P+ R ++SNG D+K+RGTA H+AE+Y  LA
Sbjct: 1   MRNGQNNKRLRNRNSGSNTNNNNNNRRGQNPMTRVFESNGPDIKIRGTASHVAEKYVQLA 60

Query: 59  RDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKL-QRDEQDDLLVKEQKERAQNALS 117
           RDA S+GD V AEN+ QHAEHY R+++ AQ Q ++   Q+  + D  + E  +  ++  S
Sbjct: 61  RDARSSGDPVAAENYYQHAEHYFRLIAAAQEQFRQNQPQQAPRIDNDMSENDDDGESDYS 120

Query: 118 EFEASPCPLIEEGKEPIFENSIQPKVED-----VAFKTPDISREKDVSYKKVRRRRP 169
            F A P  L+   ++P      +P+ +         + P     +       R  +P
Sbjct: 121 NFGAEPG-LVPVQQQPQSFQPREPREQPQFQPREPREQPQPREHRPQPQFTPRVEQP 176


>gi|49474611|ref|YP_032653.1| hypothetical protein BQ11000 [Bartonella quintana str. Toulouse]
 gi|49240115|emb|CAF26561.1| hypothetical protein BQ11000 [Bartonella quintana str. Toulouse]
          Length = 246

 Score =  105 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 55/108 (50%), Positives = 75/108 (69%), Gaps = 1/108 (0%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR  QQ +R+RGR +N    + NR+  NPL RNY+S+G DVK+RG AQ IA++Y  LARD
Sbjct: 1   MRP-QQNRRARGRNNNNNGNNNNRRGPNPLSRNYESSGPDVKIRGNAQQIADKYISLARD 59

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQ 108
           A  AGD V++EN+LQHAEHY RI+  A  Q  + ++RDE  D   +++
Sbjct: 60  AQGAGDRVMSENYLQHAEHYLRIILAAVGQTPQSVRRDENRDENNEQE 107


>gi|218507329|ref|ZP_03505207.1| hypothetical protein RetlB5_06790 [Rhizobium etli Brasil 5]
          Length = 236

 Score =  104 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 52/103 (50%), Positives = 74/103 (71%)

Query: 29  PLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
           PL R YDS+G DVK+RGTAQHIAE+Y+ LARDA S+GD V+AEN+LQHAEHYNRI++ AQ
Sbjct: 37  PLTRTYDSSGPDVKIRGTAQHIAEKYAQLARDAQSSGDRVMAENYLQHAEHYNRIIASAQ 96

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGK 131
           AQ+QE+ QRD++ +   ++  +R  + +   +     ++    
Sbjct: 97  AQMQERFQRDDRGEYNDRDAADRDSDDIDANDNDGDDVVVVQP 139


>gi|163735801|ref|ZP_02143230.1| hypothetical protein RLO149_00600 [Roseobacter litoralis Och 149]
 gi|161390887|gb|EDQ15227.1| hypothetical protein RLO149_00600 [Roseobacter litoralis Och 149]
          Length = 183

 Score =  104 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 56/186 (30%), Positives = 86/186 (46%), Gaps = 18/186 (9%)

Query: 16  NGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQ 75
            G     + +  N + R +DS+G + KVRGT Q I E+Y+ L RDA  + D V AEN  Q
Sbjct: 11  KGNRNRSSNQGGNVVNRVFDSSGPEGKVRGTPQQIIEKYNQLTRDAQLSNDRVAAENFQQ 70

Query: 76  HAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIF 135
           HAEHY R++S AQ +I  + +  E+ +   + +++R +    E +A+    + E      
Sbjct: 71  HAEHYTRMLSEAQREIDARREEQERQNRERQAERDRERAERQERDAANAAAVVE------ 124

Query: 136 ENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQE 195
               QP VE    +      E   S  K +R    +PR         +P  AT+   P  
Sbjct: 125 ----QPVVEAPEQEVESGLVETPESQPKPKRAPRRKPRA--------KPAPATDESTPPA 172

Query: 196 LNSDNA 201
              D+A
Sbjct: 173 SGGDDA 178


>gi|86359338|ref|YP_471230.1| hypothetical protein RHE_CH03754 [Rhizobium etli CFN 42]
 gi|86283440|gb|ABC92503.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 242

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 53/103 (51%), Positives = 74/103 (71%)

Query: 29  PLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
           PL R YDS+G DVK+RGTAQHIAE+Y+ LARDA S+GD V+AEN+LQHAEHYNRI++ AQ
Sbjct: 37  PLTRTYDSSGPDVKIRGTAQHIAEKYAQLARDAQSSGDRVIAENYLQHAEHYNRIIASAQ 96

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGK 131
           AQ+QE+ QRD++ D   ++  +R  + +   +     ++    
Sbjct: 97  AQMQERFQRDDRSDFNERDAVDRDSDEIDTSDNDGDDVVVVQP 139


>gi|85713814|ref|ZP_01044804.1| hypothetical protein NB311A_04719 [Nitrobacter sp. Nb-311A]
 gi|85699718|gb|EAQ37585.1| hypothetical protein NB311A_04719 [Nitrobacter sp. Nb-311A]
          Length = 233

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 60/186 (32%), Positives = 91/186 (48%), Gaps = 7/186 (3%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR+ Q   +     +N  N + NR+  NP+ R ++SNG D+K+RGTA H+AE+Y  LARD
Sbjct: 1   MRNGQNNNKRMRNRNNNNNNNNNRRGQNPMTRVFESNGPDIKIRGTASHVAEKYVQLARD 60

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQ--DDLLVKEQKERAQNALSE 118
           A S+GD V AEN+ QHAEHY R+++ AQ Q ++   + +   D    +E  +      S 
Sbjct: 61  ARSSGDPVAAENYYQHAEHYFRLIAAAQEQFRQSQPQQQPRIDVDATEEAGDDDGENYSN 120

Query: 119 FEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNA 178
           F A P  +  +      +   QP   D         RE       ++          P+ 
Sbjct: 121 FGAEPGFVPVQQPRDQQQREAQPYQRDQQ-----QPREYRQPQPAIQPADNGGVDRLPSF 175

Query: 179 KSGNQP 184
            +G+QP
Sbjct: 176 ITGSQP 181


>gi|163868959|ref|YP_001610188.1| hypothetical protein Btr_1955 [Bartonella tribocorum CIP 105476]
 gi|161018635|emb|CAK02193.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 247

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 53/109 (48%), Positives = 70/109 (64%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR  Q  +      +N GN + NR+  NPL RNY+S+G DVK+RG AQ IA++Y  LARD
Sbjct: 1   MRPQQNRRVRGRNNNNNGNNNNNRRGPNPLSRNYESSGPDVKIRGNAQQIADKYISLARD 60

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQK 109
           A  AGD V++EN+LQHAEHY RI+  A  Q+ +  +RDE  D     Q+
Sbjct: 61  AQGAGDRVMSENYLQHAEHYLRIILAAAGQMSQSARRDENRDDENNGQE 109


>gi|240851093|ref|YP_002972494.1| hypothetical protein Bgr_16640 [Bartonella grahamii as4aup]
 gi|240268216|gb|ACS51804.1| hypothetical protein Bgr_16640 [Bartonella grahamii as4aup]
          Length = 247

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 52/108 (48%), Positives = 72/108 (66%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR  Q  +      +N GN + NR+  NPL RNY+S+G DVK+RG AQ IA++Y  LARD
Sbjct: 1   MRPQQNRRVRGRNNNNNGNNNNNRRGPNPLSRNYESSGPDVKIRGNAQQIADKYISLARD 60

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQ 108
           A  AGD V++EN+LQHAEHY RI+  A  Q+ + ++RDE  D   +++
Sbjct: 61  AQGAGDRVMSENYLQHAEHYLRIILAAAGQMSQSVRRDENRDENNEQE 108


>gi|307942492|ref|ZP_07657841.1| putative cytoplasmic protein [Roseibium sp. TrichSKD4]
 gi|307774313|gb|EFO33525.1| putative cytoplasmic protein [Roseibium sp. TrichSKD4]
          Length = 280

 Score =  103 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 69/234 (29%), Positives = 102/234 (43%), Gaps = 29/234 (12%)

Query: 2   RSVQQYKRSR-GRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           R +++  R R G  SN       RK  NPL R Y+SNG DVK+RGTAQH+A++Y  LARD
Sbjct: 19  RYLRENGRMRPGNQSNKRMRGRGRKGPNPLTRTYESNGPDVKIRGTAQHVADKYQQLARD 78

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQ-------------------------EKL 95
           A ++GD V+ EN+LQHAEHY RI++ AQ Q Q                         E+ 
Sbjct: 79  AQASGDRVMGENYLQHAEHYLRIIAAAQPQQQPSQFHRQDGEEGAEQTANGSGGANGERQ 138

Query: 96  QRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE---DVAFKTPD 152
           + +  +     E+ ERA+       A    + E+  +P  E+          +      D
Sbjct: 139 RPERGERSERTERPERAERTERANGAGADVVGEDSPQPFIESMPTIDPAGQVNGQTSNAD 198

Query: 153 ISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQ 206
           ++   +   +  + RR  R       KS  Q    +E    +    D    V +
Sbjct: 199 VAEASEDGEEVEKPRRRARVARGRPRKSEAQDEAVSEDAPVEAKAEDGEEPVKK 252


>gi|241206500|ref|YP_002977596.1| hypothetical protein Rleg_3814 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860390|gb|ACS58057.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 252

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 56/142 (39%), Positives = 80/142 (56%), Gaps = 10/142 (7%)

Query: 29  PLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
           PL R YDS+G DVK+RGTAQHIAE+Y+ LARDA S+GD V+AEN+LQHAEHYNRI++ AQ
Sbjct: 36  PLTRTYDSSGPDVKIRGTAQHIAEKYAQLARDAQSSGDRVIAENYLQHAEHYNRIIASAQ 95

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASP----------CPLIEEGKEPIFENS 138
           AQ+QE+ QRD++ +   ++  +R  + +   +              P      +P     
Sbjct: 96  AQMQERFQRDDRGEYNDRDGADRDGDDMDNNDNENDNDGDDVVIVQPPQSRPHQPQQSRQ 155

Query: 139 IQPKVEDVAFKTPDISREKDVS 160
            QP+ +         +      
Sbjct: 156 HQPQAQPKPVAAQAPAPAPQSE 177


>gi|84503527|ref|ZP_01001578.1| hypothetical protein OB2597_03469 [Oceanicola batsensis HTCC2597]
 gi|84388017|gb|EAQ01065.1| hypothetical protein OB2597_03469 [Oceanicola batsensis HTCC2597]
          Length = 189

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 47/159 (29%), Positives = 84/159 (52%), Gaps = 3/159 (1%)

Query: 27  LNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSM 86
            N + R +DS+G + KVRGT Q I ++Y+ LARDA   GD V  EN  QHAEHY R++  
Sbjct: 19  GNIVNRVFDSSGPEGKVRGTPQQIIDKYNQLARDAQLGGDRVATENFQQHAEHYLRMLGS 78

Query: 87  AQAQIQEKLQRDEQDDLLV--KEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
           AQ + +++ ++ + ++     +  +ERA+   S+ + +   +   G +P   ++     E
Sbjct: 79  AQKEQEKQREQQDAENRKRQSERDRERAKQDSSDQQEAEQSVPGGGDQPDVIDASGNDSE 138

Query: 145 DVAFKTPDISREKDVSYK-KVRRRRPLRPRVFPNAKSGN 182
               +TP+ +R        K +R    +PR   ++ +G+
Sbjct: 139 SGLVETPEEARSGSEEPASKPKRSYNRKPRAKKDSGNGD 177


>gi|27375331|ref|NP_766860.1| hypothetical protein blr0220 [Bradyrhizobium japonicum USDA 110]
 gi|27348467|dbj|BAC45485.1| blr0220 [Bradyrhizobium japonicum USDA 110]
          Length = 262

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 60/176 (34%), Positives = 89/176 (50%), Gaps = 8/176 (4%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR+ Q  +R     +   N + NR+  NP+ R Y+SNG D+K+RGTA HIAE+Y  LARD
Sbjct: 1   MRNGQNKQRM---RNRNNNNNNNRRGQNPMTRVYESNGPDIKIRGTASHIAEKYLQLARD 57

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQ-RDEQDDLLVKEQKERAQNALSEF 119
           A S+GD V AEN+ QHAEHY R+++ AQ Q ++  Q R ++      +  E      S F
Sbjct: 58  ARSSGDPVAAENYYQHAEHYFRLIAAAQEQFRQNQQPRGDEPISSNSDDGEDDGENFSNF 117

Query: 120 EASPCPLIEEGKEPIF----ENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLR 171
              P  + +  ++  F    +        D   +    S ++D    +  R R  R
Sbjct: 118 GQEPGFVPQPQQQQPFMRDRDGQRDHHQRDHQQRDNQPSYQRDNQQPREHRERDHR 173


>gi|330994786|ref|ZP_08318708.1| hypothetical protein SXCC_04673 [Gluconacetobacter sp. SXCC-1]
 gi|329758047|gb|EGG74569.1| hypothetical protein SXCC_04673 [Gluconacetobacter sp. SXCC-1]
          Length = 245

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 47/128 (36%), Positives = 67/128 (52%), Gaps = 6/128 (4%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFN----RKNLNPLVRN--YDSNGYDVKVRGTAQHIAERY 54
           +R +   KR RGR +  G  +           PL RN  +DSNG D++VRGTAQ + E+Y
Sbjct: 53  LRQLMNMKRMRGRHNRSGGSNGGSVRHNNGQIPLNRNHVFDSNGPDLRVRGTAQQLFEKY 112

Query: 55  SVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQN 114
             L RDA S GD V+AE + QHAEHY RI++      Q+  Q  ++     ++Q +    
Sbjct: 113 LQLGRDASSTGDRVMAEAYFQHAEHYFRILNAMTQAAQQSQQERQERMNNGRQQPQPRPV 172

Query: 115 ALSEFEAS 122
           A +   A 
Sbjct: 173 ADNRQPAE 180


>gi|192289042|ref|YP_001989647.1| hypothetical protein Rpal_0612 [Rhodopseudomonas palustris TIE-1]
 gi|192282791|gb|ACE99171.1| conserved hypothetical protein [Rhodopseudomonas palustris TIE-1]
          Length = 231

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 59/167 (35%), Positives = 90/167 (53%), Gaps = 2/167 (1%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR+ Q  KR R   +NGGN + NR+  NP+ R ++SNG D+K+RGTA HIAE+Y  LARD
Sbjct: 1   MRNGQNNKRLRN-RNNGGNNNNNRRGQNPMTRVFESNGPDIKIRGTASHIAEKYVQLARD 59

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
           A S+GD V AEN+ QHAEHY R+++ AQ Q ++   +    D    +  + ++   S F 
Sbjct: 60  ARSSGDPVAAENYYQHAEHYFRLIAAAQEQFRQNQPQPR-IDNDTLDNDDDSEGDFSNFG 118

Query: 121 ASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRR 167
           A P  +  +  +P  +       +      P   R +     + + +
Sbjct: 119 AEPGLVPVQQPQPYQQREQPQPYQPREQPQPREHRPQPQFVPREQPQ 165


>gi|115522192|ref|YP_779103.1| hypothetical protein RPE_0162 [Rhodopseudomonas palustris BisA53]
 gi|115516139|gb|ABJ04123.1| conserved hypothetical protein [Rhodopseudomonas palustris BisA53]
          Length = 251

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 47/154 (30%), Positives = 74/154 (48%), Gaps = 3/154 (1%)

Query: 26  NLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVS 85
             NP+ R ++SNG D+K+RGTA H+AE+Y  LARDA S+GD V AEN+ QHAEHY R+++
Sbjct: 31  GQNPMTRVFESNGPDIKIRGTASHVAEKYVQLARDARSSGDPVAAENYYQHAEHYFRLIA 90

Query: 86  MAQA--QIQEKLQRDEQDDLLVKEQKERAQNA-LSEFEASPCPLIEEGKEPIFENSIQPK 142
            AQ   +  +  Q+   D  +  +  E       S F A P  +    +          +
Sbjct: 91  AAQEQFRQNQPQQQQRLDSDMADDSGEFGDGETYSNFGAEPGLVPIPPQPQPQMPPQPRE 150

Query: 143 VEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFP 176
             +   ++      +     + + R    P+  P
Sbjct: 151 PREHREQSYQPREHRPQPQYQPQPRIQPEPQPQP 184


>gi|222087301|ref|YP_002545838.1| hypothetical protein Arad_4126 [Agrobacterium radiobacter K84]
 gi|221724749|gb|ACM27905.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 234

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 53/77 (68%), Positives = 65/77 (84%)

Query: 28  NPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMA 87
           NPL R YDS+G DVK+RGTAQHIAE+Y+ LARDA S+GD V+AEN+LQHAEHYNRI++ A
Sbjct: 36  NPLTRTYDSSGPDVKIRGTAQHIAEKYATLARDAQSSGDRVMAENYLQHAEHYNRIIASA 95

Query: 88  QAQIQEKLQRDEQDDLL 104
           QAQ+QE+ QRDE  +  
Sbjct: 96  QAQMQERFQRDEHQNPN 112


>gi|209551098|ref|YP_002283015.1| hypothetical protein Rleg2_3522 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536854|gb|ACI56789.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 244

 Score =  101 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 51/78 (65%), Positives = 65/78 (83%)

Query: 29  PLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
           PL R YDS+G DVK+RGTAQHIAE+Y+ LARDA S+GD V+AEN+LQHAEHYNRI++ AQ
Sbjct: 38  PLTRTYDSSGPDVKIRGTAQHIAEKYAQLARDAQSSGDRVIAENYLQHAEHYNRIIASAQ 97

Query: 89  AQIQEKLQRDEQDDLLVK 106
           AQ+QE+ QRD++ +    
Sbjct: 98  AQMQERFQRDDRGEYDRD 115


>gi|116254017|ref|YP_769855.1| hypothetical protein RL4280 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115258665|emb|CAK09769.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 255

 Score =  101 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 56/142 (39%), Positives = 80/142 (56%), Gaps = 10/142 (7%)

Query: 29  PLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
           PL R YDS+G DVK+RGTAQHIAE+Y+ LARDA S+GD V+AEN+LQHAEHYNRI++ AQ
Sbjct: 39  PLTRTYDSSGPDVKIRGTAQHIAEKYAQLARDAQSSGDRVIAENYLQHAEHYNRIIASAQ 98

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASP----------CPLIEEGKEPIFENS 138
           AQ+QE+ QRD++ +   ++  +R  + +   +              P      +P     
Sbjct: 99  AQMQERFQRDDRGEYNDRDGADRDGDDMDNNDNENDNDGDDVVIVQPPQSRPHQPQQSRQ 158

Query: 139 IQPKVEDVAFKTPDISREKDVS 160
            QP+ +         +      
Sbjct: 159 HQPQAQPKPVAAQAPAPAPQSE 180


>gi|39933685|ref|NP_945961.1| hypothetical protein RPA0608 [Rhodopseudomonas palustris CGA009]
 gi|39647531|emb|CAE26052.1| conserved unknown protein [Rhodopseudomonas palustris CGA009]
          Length = 231

 Score =  101 bits (251), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 59/167 (35%), Positives = 91/167 (54%), Gaps = 2/167 (1%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR+ Q  KR R   +NGGN + NR+  NP+ R ++SNG D+K+RGTA HIAE+Y  LARD
Sbjct: 1   MRNGQNNKRLRN-RNNGGNNNNNRRGQNPMTRVFESNGPDIKIRGTASHIAEKYVQLARD 59

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
           A S+GD V AEN+ QHAEHY R+++ AQ Q ++   +   D+  +    + ++   S F 
Sbjct: 60  ARSSGDPVAAENYYQHAEHYFRLIAAAQEQFRQNQPQPRTDNDTLDNDDD-SEGDFSNFG 118

Query: 121 ASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRR 167
           A P  +  +  +P  +       +      P   R +     + + +
Sbjct: 119 AEPGLVPVQQPQPYQQREQPQPYQPREQPQPREHRPQPQFVPREQPQ 165


>gi|91974577|ref|YP_567236.1| hypothetical protein RPD_0095 [Rhodopseudomonas palustris BisB5]
 gi|91681033|gb|ABE37335.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB5]
          Length = 241

 Score =  101 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 57/174 (32%), Positives = 90/174 (51%), Gaps = 5/174 (2%)

Query: 1   MRSVQQYKR---SRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVL 57
           MR+ Q  KR        +N  N + NR+  NP+ R ++SNG D+K+RGTA H+AE+Y  L
Sbjct: 1   MRNGQNNKRLRNRNSGSNNNNNNNNNRRGQNPMTRVFESNGPDIKIRGTASHVAEKYVQL 60

Query: 58  ARDAMSAGDYVVAENHLQHAEHYNRIVSMAQA-QIQEKLQRDEQDDLLVKEQKERAQNAL 116
           ARDA S+GD V AEN+ QHAEHY R+++ AQ    Q + Q+ ++ D  + +  +  +   
Sbjct: 61  ARDARSSGDPVAAENYYQHAEHYFRLIAAAQEQFRQNQPQQQQRVDNDMSDNDDEGEADY 120

Query: 117 SEFEASPCPL-IEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRP 169
           S F A P  + +++      E     + +    + P     +       R  +P
Sbjct: 121 SNFGAEPGLVPVQQQPYQPREQPRAEQPQFAPREQPQPREHRPQPQFTPRAEQP 174


>gi|259418952|ref|ZP_05742869.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
 gi|259345174|gb|EEW57028.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
          Length = 279

 Score =  101 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 46/174 (26%), Positives = 77/174 (44%), Gaps = 7/174 (4%)

Query: 25  KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
              N + R +DS+G + KVRGT Q I ++Y+ LARDA    D V  EN  QHAEHY R++
Sbjct: 83  NGANVVNRVFDSSGPEGKVRGTPQQIIDKYNQLARDAQLGNDRVATENFQQHAEHYLRML 142

Query: 85  SMAQAQIQEKLQRDEQDDLLV--KEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQ-- 140
           + AQ +I+ K +  E+ +     +  +ERA+    +   +      +G +P   +  +  
Sbjct: 143 NEAQREIEAKREEQERQNRERQAERDRERAERLERQEREAAEVAAGDGPQPEIADPREAA 202

Query: 141 ---PKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETI 191
              P+ +    +TP+       +    +          P A    +  EA    
Sbjct: 203 PQVPQDDSGLVETPEGKTADPEAAPAKKAPARKPRSRKPAAPKDGETGEAKPEA 256


>gi|75674573|ref|YP_316994.1| hypothetical protein Nwi_0375 [Nitrobacter winogradskyi Nb-255]
 gi|74419443|gb|ABA03642.1| conserved hypothetical protein [Nitrobacter winogradskyi Nb-255]
          Length = 231

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 60/186 (32%), Positives = 89/186 (47%), Gaps = 9/186 (4%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR+ Q   +     +   N + NR+  NP+ R ++SNG D+K+RGTA H+AE+Y  LARD
Sbjct: 1   MRNGQNNNKRM--RNRNNNNNNNRRGQNPMTRVFESNGPDIKIRGTASHVAEKYLQLARD 58

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQ--DDLLVKEQKERAQNALSE 118
           A S+GD V AEN+ QHAEHY R+++ AQ Q ++   + +   D     E  E    + S 
Sbjct: 59  ARSSGDPVAAENYYQHAEHYFRLIAAAQEQFRQSQPQQQPRIDVEATDEAGEDDSESFSN 118

Query: 119 FEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNA 178
           F A P  +  +          QP   D         RE       ++          P+ 
Sbjct: 119 FGAEPGFVPVQQPRDHHHREAQPYQRDQQ-----QPREYRQPQPVIQPADNGGVDRLPSF 173

Query: 179 KSGNQP 184
            +G+QP
Sbjct: 174 ITGSQP 179


>gi|329113399|ref|ZP_08242180.1| Hypothetical protein APO_0164 [Acetobacter pomorum DM001]
 gi|326697224|gb|EGE48884.1| Hypothetical protein APO_0164 [Acetobacter pomorum DM001]
          Length = 143

 Score =   99 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 46/134 (34%), Positives = 69/134 (51%), Gaps = 2/134 (1%)

Query: 8   KRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDY 67
           +  R  GSNG +   N +        +DS+G DV+VRGTAQ + E+Y  L RD+  +GD 
Sbjct: 9   RHHRSNGSNGSSRQLNGQIPMNRNHVFDSHGPDVRVRGTAQQLFEKYLQLGRDSTGSGDR 68

Query: 68  VVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQ--KERAQNALSEFEASPCP 125
           V AE + QHAEHY RI++      Q+  Q   +     +++   +  ++     E +P P
Sbjct: 69  VAAEGYFQHAEHYFRIMNAMAQAAQQSQQERAERLAARQQRAVAQTNEDGEDRQENAPQP 128

Query: 126 LIEEGKEPIFENSI 139
            I+E  EP  E S 
Sbjct: 129 DIQEESEPQPELSE 142


>gi|254472278|ref|ZP_05085678.1| hypothetical Cytosolic Protein [Pseudovibrio sp. JE062]
 gi|211958561|gb|EEA93761.1| hypothetical Cytosolic Protein [Pseudovibrio sp. JE062]
          Length = 220

 Score = 99.6 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 47/141 (33%), Positives = 70/141 (49%), Gaps = 3/141 (2%)

Query: 30  LVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQA 89
           + R Y+SNG DVK+RGTA HIAE+Y  LARDA ++GD V +EN+ QHAEHY RIV+ AQ 
Sbjct: 1   MTRTYESNGPDVKIRGTALHIAEKYQQLARDAQASGDRVTSENYYQHAEHYQRIVAAAQP 60

Query: 90  QIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFE-NSIQPKVEDVAF 148
           Q  +      + +         A N  +  E     +     +P+   ++ QP +E    
Sbjct: 61  QNSQSAAPSARAEEEAAPAVVEAPNGAAASE--EQDVAVASTQPVIGLDTPQPFIEASPV 118

Query: 149 KTPDISREKDVSYKKVRRRRP 169
              +    +  +       +P
Sbjct: 119 VEENAEAAEAPAAGDEEDDKP 139


>gi|319781347|ref|YP_004140823.1| hypothetical protein Mesci_1616 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167235|gb|ADV10773.1| hypothetical protein Mesci_1616 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 315

 Score = 99.6 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 53/122 (43%), Positives = 76/122 (62%), Gaps = 7/122 (5%)

Query: 25  KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
           K  NPL RNY+SNG DVK+RG+AQ IAE+Y+ LARD+ S+GD V+AEN+LQHAEHYNRI+
Sbjct: 33  KGPNPLTRNYESNGPDVKIRGSAQQIAEKYATLARDSHSSGDRVMAENYLQHAEHYNRII 92

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLI-------EEGKEPIFEN 137
           + AQAQ+  +  +  +DD      ++R     S   ++    +         G +P+ E 
Sbjct: 93  AAAQAQMPIQNTQQNRDDFDDDGDEDRDDFDNSGNNSNAASDVQIPVVNHGAGPQPVIEG 152

Query: 138 SI 139
           + 
Sbjct: 153 TP 154


>gi|254461412|ref|ZP_05074828.1| conserved hypothetical protein [Rhodobacterales bacterium HTCC2083]
 gi|206678001|gb|EDZ42488.1| conserved hypothetical protein [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 191

 Score = 99.2 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 45/167 (26%), Positives = 78/167 (46%)

Query: 7   YKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGD 66
            + S+ R          +   N   R +DS+G + KVRGT Q I ++Y  LARD+  +GD
Sbjct: 1   MRSSKPRSRKNNRNRPQQNGGNIPNRVFDSSGPEGKVRGTPQQIIDKYQQLARDSQLSGD 60

Query: 67  YVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPL 126
            V  EN  QHAEHY R++S AQ +I E+ ++ E+++   + +++R +       A     
Sbjct: 61  RVATENFSQHAEHYLRMLSAAQKEIDERREQQERENRERQAERDRERAERDAERAEREAA 120

Query: 127 IEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPR 173
             + +  + E       +    ++   +    V   + + RR   PR
Sbjct: 121 QAKEQPVVAEAVSGEGAQPDVIESAPAADSGLVETPESKPRRQRTPR 167


>gi|13472968|ref|NP_104535.1| hypothetical protein mll3431 [Mesorhizobium loti MAFF303099]
 gi|14023716|dbj|BAB50321.1| mll3431 [Mesorhizobium loti MAFF303099]
          Length = 318

 Score = 99.2 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 56/121 (46%), Positives = 78/121 (64%), Gaps = 2/121 (1%)

Query: 25  KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
           K  NPL RNY+SNG DVK+RG+AQ IAE+Y+ LARDA S+GD V+AEN+LQHAEHYNRI+
Sbjct: 31  KGPNPLTRNYESNGPDVKIRGSAQQIAEKYATLARDAQSSGDRVMAENYLQHAEHYNRII 90

Query: 85  SMAQAQ--IQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPK 142
           + AQAQ  IQ   Q  +  D    E ++  +NA +    +    + + + P+  +   P+
Sbjct: 91  AAAQAQMPIQNVQQNRDDFDDDGDEDRDDFENAGNNGAGNGGNTVSDPQIPVINHGAGPQ 150

Query: 143 V 143
            
Sbjct: 151 P 151


>gi|319404696|emb|CBI78298.1| conserved hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 243

 Score = 98.8 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 42/78 (53%), Positives = 56/78 (71%)

Query: 30  LVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQA 89
           L RNY+SNG DVK+RG AQ IA++Y  LARDA  AGD V++EN+LQHAEHY RI+  A  
Sbjct: 26  LSRNYESNGPDVKIRGNAQQIADKYISLARDAQGAGDSVMSENYLQHAEHYLRIILAAND 85

Query: 90  QIQEKLQRDEQDDLLVKE 107
           Q+    +RDE ++   ++
Sbjct: 86  QMSYSHKRDENNEQECED 103


>gi|299132855|ref|ZP_07026050.1| conserved hypothetical protein [Afipia sp. 1NLS2]
 gi|298592992|gb|EFI53192.1| conserved hypothetical protein [Afipia sp. 1NLS2]
          Length = 228

 Score = 98.8 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 52/163 (31%), Positives = 84/163 (51%), Gaps = 7/163 (4%)

Query: 29  PLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
           P+ R ++SNG D+K+RGTA HIAE+Y  LARDA S+GD V AEN+ QHAEHY R+++ AQ
Sbjct: 28  PMTRVFESNGPDIKIRGTASHIAEKYVQLARDARSSGDPVAAENYYQHAEHYFRLIAAAQ 87

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNA-LSEFEASPCPLIEEGKEPIFENSIQPKVEDVA 147
            Q+++   + +Q  L     ++  ++   S F A P    +  +   F    QP+     
Sbjct: 88  EQLRQNQPQQQQPRLDNDLGEDAGEDDNYSNFGAEPGFAPQPQQ---FAPREQPQPSYAP 144

Query: 148 FKTPDI---SREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEA 187
            + P        ++    +++ +        P+  +G  P  A
Sbjct: 145 REQPQPREYREPRENRQPQIQPQETGAVDRLPSFITGGAPQPA 187


>gi|90420191|ref|ZP_01228099.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335525|gb|EAS49275.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 366

 Score = 98.5 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 62/95 (65%), Positives = 69/95 (72%), Gaps = 10/95 (10%)

Query: 1   MRSVQQYK-RSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLAR 59
           MR  QQ K R RGRG         RK  NPL R Y+SNG DVK+RGTAQHIAE+YS LAR
Sbjct: 23  MRPGQQQKNRMRGRG---------RKGPNPLSRGYESNGPDVKIRGTAQHIAEKYSTLAR 73

Query: 60  DAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEK 94
           DA  AGD V+AEN+LQHAEHYNRIV+ AQAQ Q +
Sbjct: 74  DASGAGDRVMAENYLQHAEHYNRIVAAAQAQFQPR 108


>gi|327193410|gb|EGE60310.1| hypothetical protein RHECNPAF_1600042 [Rhizobium etli CNPAF512]
          Length = 236

 Score = 98.5 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 57/143 (39%), Positives = 83/143 (58%), Gaps = 22/143 (15%)

Query: 29  PLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
           PL R YDS+G DVK+RGTAQHIAE+Y+ LARDA S+GD V+AEN+LQHAEHYNRI++ AQ
Sbjct: 37  PLTRTYDSSGPDVKIRGTAQHIAEKYAQLARDAQSSGDRVMAENYLQHAEHYNRIIASAQ 96

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGK----------------- 131
           AQ+QE+ QRD++ +   ++  +R  + +   +     ++                     
Sbjct: 97  AQMQERFQRDDRGEYNDRDASDRDSDDIDANDNDGDDVVVVQPPQSRQHQPQAQPQPAPA 156

Query: 132 -----EPIFENSIQPKVEDVAFK 149
                E I     QP++E +  +
Sbjct: 157 AAPQPEVIDGTGPQPEIEGIPAE 179


>gi|190893589|ref|YP_001980131.1| hypothetical protein RHECIAT_CH0004022 [Rhizobium etli CIAT 652]
 gi|190698868|gb|ACE92953.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 236

 Score = 98.5 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 57/143 (39%), Positives = 83/143 (58%), Gaps = 22/143 (15%)

Query: 29  PLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
           PL R YDS+G DVK+RGTAQHIAE+Y+ LARDA S+GD V+AEN+LQHAEHYNRI++ AQ
Sbjct: 37  PLTRTYDSSGPDVKIRGTAQHIAEKYAQLARDAQSSGDRVMAENYLQHAEHYNRIIASAQ 96

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGK----------------- 131
           AQ+QE+ QRD++ +   ++  +R  + +   +     ++                     
Sbjct: 97  AQMQERFQRDDRGEYNDRDAADRDSDDIDANDNDGDDVVVVQPPQSRQHQPQAQPQPAPA 156

Query: 132 -----EPIFENSIQPKVEDVAFK 149
                E I     QP++E +  +
Sbjct: 157 AAPQPEVIDGTGPQPEIEGIPAE 179


>gi|159186053|ref|NP_356473.2| hypothetical protein Atu4176 [Agrobacterium tumefaciens str. C58]
 gi|159141187|gb|AAK89258.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 261

 Score = 98.5 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 68/130 (52%), Positives = 85/130 (65%), Gaps = 6/130 (4%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLN------PLVRNYDSNGYDVKVRGTAQHIAERY 54
           MR  QQ KR RGRGSN  N      N        PL R YDS+G DVK+RGTAQHIAE+Y
Sbjct: 1   MRPGQQNKRGRGRGSNNNNNGGGNNNNFNRKGGNPLTRTYDSSGPDVKIRGTAQHIAEKY 60

Query: 55  SVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQN 114
           + LARDA S+GD V+AEN+LQHAEHYNRI++ AQAQ+QE+ QRD++ +    +  E   N
Sbjct: 61  TALARDAQSSGDRVIAENYLQHAEHYNRIIASAQAQMQERFQRDDRGEYNAADGDEMDMN 120

Query: 115 ALSEFEASPC 124
              +   +P 
Sbjct: 121 DGDDNFVAPQ 130


>gi|310816143|ref|YP_003964107.1| hypothetical protein EIO_1685 [Ketogulonicigenium vulgare Y25]
 gi|308754878|gb|ADO42807.1| conserved hypothetical protein [Ketogulonicigenium vulgare Y25]
          Length = 209

 Score = 98.1 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 44/160 (27%), Positives = 70/160 (43%)

Query: 7   YKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGD 66
            + S+ R     N +      N + R +DS+G D KVRGT Q I E+Y+ L RDA  +GD
Sbjct: 1   MRSSKSRSRGNKNRNNRPFGGNIINRVFDSSGPDGKVRGTPQQIIEKYNQLHRDAQLSGD 60

Query: 67  YVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPL 126
            V AEN  QHAEHY R+++ AQ ++    +  EQ +   + +++R + +           
Sbjct: 61  RVNAENFAQHAEHYTRMLAEAQREVDRAREEAEQANRDRQAERDRERASRQRQGGDAPQE 120

Query: 127 IEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRR 166
             E  E    +    ++            E  V+      
Sbjct: 121 AGEPAEFAIVDLGDDEIAMTNANEAQPEAEPYVAPVTQEP 160


>gi|23015678|ref|ZP_00055447.1| hypothetical protein Magn03010110 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 164

 Score = 97.7 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 48/154 (31%), Positives = 78/154 (50%), Gaps = 15/154 (9%)

Query: 3   SVQQYKRSRGRGSNGGNGSFNRKNLNPL-----------VRNYDSNGYDVKVRGTAQHIA 51
           S+   +RSRGRG NGG G                      + +DSNG + ++RG A  + 
Sbjct: 8   SLNPKQRSRGRGPNGGGGGKKHGGGGGGGGGGGGGIPNRNQVFDSNGPEGRIRGNAHQVL 67

Query: 52  ERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSM---AQAQIQEKLQRDEQDDLLVKEQ 108
           E+Y  LARDA S GD V AEN+ QHAEHY R+++       + ++++    +D  +  E 
Sbjct: 68  EKYLSLARDASSQGDRVAAENYYQHAEHYFRVINAQNQNNGRPRQQMPTPAEDQSMGGEG 127

Query: 109 KERAQNALSEFE-ASPCPLIEEGKEPIFENSIQP 141
           ++     +   + A+P P+  EG++P     ++P
Sbjct: 128 EDENGEEIQHRQVAAPAPVPGEGEQPDVVLPVEP 161


>gi|149914651|ref|ZP_01903181.1| nucleoside triphosphate pyrophosphohydrolase [Roseobacter sp.
           AzwK-3b]
 gi|149811444|gb|EDM71279.1| nucleoside triphosphate pyrophosphohydrolase [Roseobacter sp.
           AzwK-3b]
          Length = 186

 Score = 97.7 bits (241), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 49/157 (31%), Positives = 77/157 (49%), Gaps = 8/157 (5%)

Query: 27  LNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSM 86
            N + R ++S+G + KVRGT Q I ++Y+ LARDA    D V AEN  QHAEHY R++  
Sbjct: 2   GNIVNRVFESSGPEGKVRGTPQQIIDKYNQLARDAQLGNDRVAAENFQQHAEHYLRMLGA 61

Query: 87  AQAQIQEKLQRDEQDDLLVKEQKERAQN-------ALSEFEASPCPLIEEGKEPI-FENS 138
           AQ     + ++ E+++   + +++RA+          +E    P     E  E +   N+
Sbjct: 62  AQKDQDSRREQQERENRDRQAERDRAERPDRAERPDRAERPDRPKRPDHEPAEAVDMANA 121

Query: 139 IQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVF 175
            QP +E           E   S K  + +RP +PR  
Sbjct: 122 PQPDLEPAQDSDESSLVETPESQKAEKPKRPRKPRAK 158


>gi|148258774|ref|YP_001243359.1| hypothetical protein BBta_7607 [Bradyrhizobium sp. BTAi1]
 gi|146410947|gb|ABQ39453.1| hypothetical protein BBta_7607 [Bradyrhizobium sp. BTAi1]
          Length = 284

 Score = 97.7 bits (241), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 59/149 (39%), Positives = 83/149 (55%), Gaps = 4/149 (2%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR+ Q  KR R    N GN + NR+  NPL R ++SNG D+K+RGTA H+AE+Y  LARD
Sbjct: 1   MRNGQNNKRMR--NRNSGNNNNNRRGQNPLTRVFESNGPDIKIRGTASHVAEKYVQLARD 58

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKL-QRDEQDDLLVKEQKERAQNALSEF 119
           A S+GD V AEN+ QHAEHY R+++ AQ Q ++   Q+    D L  +  +    + S F
Sbjct: 59  ARSSGDPVAAENYYQHAEHYFRLIAAAQEQFRQNQPQQPRNTDDLTVDDLDDEGESFSHF 118

Query: 120 EASPCPLIEE-GKEPIFENSIQPKVEDVA 147
              P  +  +   +P      Q +  D  
Sbjct: 119 GQEPGFVPAQPQPQPFMREGGQRERGDNQ 147


>gi|319407660|emb|CBI81308.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 235

 Score = 97.7 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 46/98 (46%), Positives = 60/98 (61%)

Query: 26  NLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVS 85
           + NPL RNY+SNG DVK+RG AQ IA++Y  LARDA  AGD V++EN+LQHAEHY RI+ 
Sbjct: 22  SPNPLSRNYESNGPDVKIRGNAQQIADKYISLARDAQGAGDRVMSENYLQHAEHYLRIIL 81

Query: 86  MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASP 123
            A  Q+    +RDE ++   +E               P
Sbjct: 82  AAADQMSYSHKRDENNEQECEEISAEENTREDNNNERP 119


>gi|121602492|ref|YP_988580.1| hypothetical protein BARBAKC583_0247 [Bartonella bacilliformis
           KC583]
 gi|120614669|gb|ABM45270.1| conserved hypothetical protein [Bartonella bacilliformis KC583]
          Length = 216

 Score = 96.5 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 50/168 (29%), Positives = 80/168 (47%), Gaps = 1/168 (0%)

Query: 30  LVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQA 89
           L RNY+SNG D+KVRG AQ IA++Y  L+ DA  AGD V++EN+LQHAEHY RI+  A  
Sbjct: 26  LSRNYESNGPDIKVRGNAQQIADKYISLSYDAQGAGDRVMSENYLQHAEHYLRIILAAAG 85

Query: 90  QIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPI-FENSIQPKVEDVAF 148
           Q+  + QRDE  +   ++ K             P    +  ++    +   +P+    A 
Sbjct: 86  QMPPQNQRDENLEQECEDGKTDGTKKEELNGEKPVSYAQVPRKNDRRKGREKPQQNGDAS 145

Query: 149 KTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQEL 196
           +   ++       +    ++P   +    A+      E  +T+V    
Sbjct: 146 EIHTVADANGSLEQPPVAKKPPAVKKAHLAEFSESEDEEIDTVVSLPS 193


>gi|114768930|ref|ZP_01446556.1| hypothetical protein OM2255_04350 [alpha proteobacterium HTCC2255]
 gi|114549847|gb|EAU52728.1| hypothetical protein OM2255_04350 [alpha proteobacterium HTCC2255]
          Length = 169

 Score = 96.5 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 41/132 (31%), Positives = 69/132 (52%), Gaps = 5/132 (3%)

Query: 24  RKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRI 83
           +   N + R +DS+G + +VRGT Q I ++Y  LA DAM AGD +  EN LQH+EHY+R+
Sbjct: 18  QNPGNVINRVFDSSGPEGRVRGTPQQIIDKYQSLASDAMLAGDRIAHENFLQHSEHYSRL 77

Query: 84  VSMAQAQIQEKLQRDEQDDLLVKE-----QKERAQNALSEFEASPCPLIEEGKEPIFENS 138
           + +AQ ++  K ++ ++      +       E   N+    E     ++E  +  I  N 
Sbjct: 78  LVVAQKELDAKREQQQKQHENRSQNNSTANDETQLNSSIGDEVVISEVLENDQAEIKSNE 137

Query: 139 IQPKVEDVAFKT 150
           ++PK +    K 
Sbjct: 138 LEPKNKRRPVKK 149


>gi|255263795|ref|ZP_05343137.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
 gi|255106130|gb|EET48804.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
          Length = 200

 Score = 96.5 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 45/168 (26%), Positives = 79/168 (47%), Gaps = 4/168 (2%)

Query: 2   RSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDA 61
           R+    + S+ R S G          N + R +DS+G + KVRGT Q I ++Y+ L RDA
Sbjct: 20  RTTHHMRSSKSR-SRGNKNRNRPSGANIVNRVFDSSGPEGKVRGTPQQIIDKYNQLHRDA 78

Query: 62  MSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEA 121
             AGD V+ E + QHAEHY R+++ A  + + K +  ++ +   + +++R +    +   
Sbjct: 79  QLAGDRVLVEAYAQHAEHYTRMLAEALREQEAKREEADRQNRERQAERDRERAGRQQAHE 138

Query: 122 SPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRP 169
           S      E  +   E  +  + +    +TP+   +     K   R  P
Sbjct: 139 SQHQSNVEEAK---EQPVADEGDSGLVETPEAQPKPRKPRKPRTRTSP 183


>gi|260467162|ref|ZP_05813340.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259029086|gb|EEW30384.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 317

 Score = 96.1 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 56/130 (43%), Positives = 77/130 (59%), Gaps = 5/130 (3%)

Query: 25  KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
           K  NPL RNY+SNG DVK+RG+AQ IAE+Y+ LARDA S+GD V+AEN+LQHAEHYNRI+
Sbjct: 31  KGPNPLTRNYESNGPDVKIRGSAQQIAEKYATLARDAQSSGDRVMAENYLQHAEHYNRII 90

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFE-----NSI 139
           + AQAQ+  +  +  +DD      ++R +   +            G EP           
Sbjct: 91  AAAQAQMPIQNVQQNRDDFDDDGDEDRDEFDNAGSGNGAGNGGNVGSEPQVPVINHGAGP 150

Query: 140 QPKVEDVAFK 149
           QP +E +  +
Sbjct: 151 QPVIEGMPAE 160


>gi|319406183|emb|CBI79820.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 239

 Score = 96.1 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 51/176 (28%), Positives = 82/176 (46%), Gaps = 7/176 (3%)

Query: 30  LVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQA 89
           L RNY+SNG D+K+RG AQ +A++Y  LARDA  AGD V++EN+LQHAEHY RI+  A  
Sbjct: 27  LSRNYESNGPDIKIRGNAQQVADKYISLARDAQGAGDRVMSENYLQHAEHYLRIILAATD 86

Query: 90  QIQEKLQRDEQDDLLVKE-------QKERAQNALSEFEASPCPLIEEGKEPIFENSIQPK 142
           Q+    +RDE ++   +E       +++      S  E +    I   K+   + +    
Sbjct: 87  QVSYSHKRDENNEQECEETSAEENTREDNNNERSSLQEQTSKNGIGRKKQGKEKYTSDAL 146

Query: 143 VEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
            E++     +   ++ V       ++P R       +          T+V      
Sbjct: 147 NENLQADKAEQQEQQTVEEGAEAPKQPRRLTRRRKIRVSETLSSKKSTVVSDVAGE 202


>gi|296447417|ref|ZP_06889342.1| conserved hypothetical protein [Methylosinus trichosporium OB3b]
 gi|296255037|gb|EFH02139.1| conserved hypothetical protein [Methylosinus trichosporium OB3b]
          Length = 318

 Score = 96.1 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 49/84 (58%), Positives = 59/84 (70%), Gaps = 9/84 (10%)

Query: 1  MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
          MR  Q  KR RGR         NRK  NPL R+Y+SNG DVK+RGTAQHIAE+Y  LARD
Sbjct: 1  MRPGQ-NKRIRGRS--------NRKGPNPLTRSYESNGPDVKIRGTAQHIAEKYLQLARD 51

Query: 61 AMSAGDYVVAENHLQHAEHYNRIV 84
          A S+ D ++AE+ LQHAEHY R++
Sbjct: 52 AQSSSDTIMAESLLQHAEHYFRLI 75


>gi|167644953|ref|YP_001682616.1| hypothetical protein Caul_0988 [Caulobacter sp. K31]
 gi|167347383|gb|ABZ70118.1| conserved hypothetical protein [Caulobacter sp. K31]
          Length = 373

 Score = 95.8 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 46/91 (50%), Positives = 59/91 (64%), Gaps = 1/91 (1%)

Query: 1  MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYD-VKVRGTAQHIAERYSVLAR 59
          MR  +  KR RGR + GG GS  +   +   R +DSNG + VKVRG AQ + E+Y  LAR
Sbjct: 1  MRDFKGMKRQRGRNNRGGAGSGGKPQQHNANRAFDSNGPEGVKVRGAAQSVYEKYQQLAR 60

Query: 60 DAMSAGDYVVAENHLQHAEHYNRIVSMAQAQ 90
          DA S+GD V+AEN+LQHAEHY R++   Q  
Sbjct: 61 DATSSGDRVLAENYLQHAEHYFRVLRAIQPN 91


>gi|254512270|ref|ZP_05124337.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11]
 gi|221535981|gb|EEE38969.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11]
          Length = 192

 Score = 95.4 bits (235), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 49/165 (29%), Positives = 78/165 (47%)

Query: 9   RSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYV 68
           RS    S   N        N + R +DS+G + KVRGT Q I ++Y+ LARDA  + D V
Sbjct: 2   RSSKSRSRAKNNRNRPSGGNVVNRVFDSSGPEGKVRGTPQQIIDKYNQLARDAQLSNDRV 61

Query: 69  VAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIE 128
            AEN  QHAEHY R++S AQ +++ + +  E+ +   + +++R +    E EA+      
Sbjct: 62  AAENFQQHAEHYLRMLSEAQREMEARREEQERQNRERQAERDRERAERQEREAARQADPA 121

Query: 129 EGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPR 173
           E  +P   +         +        +        R+ +P RPR
Sbjct: 122 EAPQPDVVDFGNEAAAPESGLVETPESKGAEPEATERKEKPRRPR 166


>gi|85705324|ref|ZP_01036423.1| hypothetical protein ROS217_17687 [Roseovarius sp. 217]
 gi|85670197|gb|EAQ25059.1| hypothetical protein ROS217_17687 [Roseovarius sp. 217]
          Length = 228

 Score = 95.0 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 45/165 (27%), Positives = 68/165 (41%), Gaps = 2/165 (1%)

Query: 12  GRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAE 71
            +       + NR   N + R +DS+G + KVRGT Q I E+Y+ LARDA  +GD V  E
Sbjct: 4   SKSRQRNKPNRNRTVGNVVNRVFDSSGPEGKVRGTPQQIIEKYNQLARDAQLSGDRVATE 63

Query: 72  NHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGK 131
           N  QHAEHY R++  AQ +   + +  E+ +   +  ++R +        +      +  
Sbjct: 64  NFQQHAEHYLRLLGEAQKEQDARREEQERYNRDRQTDRDRERGDRPAGRDADEGDRPQPY 123

Query: 132 EPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFP 176
           E       QP V            E   S  +    R   P    
Sbjct: 124 ES--AALSQPDVIGGFEDRDSGLVETPESKPQAEPVRRSEPSRRH 166


>gi|222149909|ref|YP_002550866.1| hypothetical protein Avi_3953 [Agrobacterium vitis S4]
 gi|221736891|gb|ACM37854.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 294

 Score = 95.0 bits (234), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 74/178 (41%), Positives = 99/178 (55%), Gaps = 4/178 (2%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNR----KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSV 56
           MR  QQ KRSRGR S G N +       K  NPL R YDS+G DVK+RGTAQHIAE+Y  
Sbjct: 1   MRPGQQNKRSRGRSSGGSNNNNGNNFNRKGSNPLTRTYDSSGPDVKIRGTAQHIAEKYMA 60

Query: 57  LARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNAL 116
           LARD+ S+GD V+AEN+LQHAEHYNRI++ AQAQ+QE++ RD++D               
Sbjct: 61  LARDSHSSGDRVMAENYLQHAEHYNRIIAAAQAQMQERVHRDDRDYNDRDGSDMDGDEGD 120

Query: 117 SEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRV 174
           +  +    P  E   +       + + E    + P+ +  +D   +  R  RP R   
Sbjct: 121 NGLDRGYQPQPEMPVQQPRIQQERVQPERAQQERPERTERQDRPERAERAERPERAER 178


>gi|148260025|ref|YP_001234152.1| hypothetical protein Acry_1016 [Acidiphilium cryptum JF-5]
 gi|326403019|ref|YP_004283100.1| hypothetical protein ACMV_08710 [Acidiphilium multivorum AIU301]
 gi|146401706|gb|ABQ30233.1| hypothetical protein Acry_1016 [Acidiphilium cryptum JF-5]
 gi|325049880|dbj|BAJ80218.1| hypothetical protein ACMV_08710 [Acidiphilium multivorum AIU301]
          Length = 143

 Score = 95.0 bits (234), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 42/121 (34%), Positives = 60/121 (49%), Gaps = 4/121 (3%)

Query: 24  RKNLNPLVRN--YDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYN 81
           +    PL RN  +DSNG + +VRGTAQ + ++Y  L RDA  AGD V+AE++ QHAEHY 
Sbjct: 22  QSGGTPLNRNHVFDSNGPEQRVRGTAQQLYDKYQQLGRDASGAGDRVLAESYFQHAEHYF 81

Query: 82  RIVSMAQAQIQEKL--QRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSI 139
           RI+S      Q         + D    E ++ A+   +       P  E  + PI     
Sbjct: 82  RIISAMNQAAQAPHGNGHSRRGDAQPAEAQDEAELVEAAPGLGEQPPTEAREIPISAAPP 141

Query: 140 Q 140
           +
Sbjct: 142 E 142


>gi|58038519|ref|YP_190483.1| hypothetical protein GOX0029 [Gluconobacter oxydans 621H]
 gi|58000933|gb|AAW59827.1| Hypothetical protein GOX0029 [Gluconobacter oxydans 621H]
          Length = 150

 Score = 95.0 bits (234), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 49/148 (33%), Positives = 69/148 (46%), Gaps = 3/148 (2%)

Query: 7   YKRSRGRGSNGGNGSFNRKNLN-PLVRN--YDSNGYDVKVRGTAQHIAERYSVLARDAMS 63
            KR RGR    G+G     N   PL RN  +DSNG D++VRGTAQ + E+Y  L RDA  
Sbjct: 1   MKRIRGRHHRAGSGPSRSSNAQTPLNRNHVFDSNGPDLRVRGTAQQLFEKYLQLGRDATG 60

Query: 64  AGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASP 123
            GD ++AE + QHAEHY RI++      ++  Q   +     +   E  +    E     
Sbjct: 61  TGDRILAEAYFQHAEHYFRILNAMNQAAEKSQQERTERQQQRQRAYEDRREPRGERSEEE 120

Query: 124 CPLIEEGKEPIFENSIQPKVEDVAFKTP 151
            P  E+  E   E S +   +    +  
Sbjct: 121 QPSQEQDAEHNAERSSEDDQDHRTAEVE 148


>gi|296533066|ref|ZP_06895710.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957]
 gi|296266610|gb|EFH12591.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957]
          Length = 140

 Score = 94.6 bits (233), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 42/104 (40%), Positives = 60/104 (57%), Gaps = 2/104 (1%)

Query: 22  FNRKNLNPLVRN--YDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEH 79
           F + N  P+ RN  +DSNG D+++RGTAQ + E+Y  L RDA  AGD V+AE++ QHAEH
Sbjct: 21  FRQNNHQPMNRNHVFDSNGPDMRLRGTAQQLFEKYLQLGRDATGAGDRVMAESYFQHAEH 80

Query: 80  YNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASP 123
           Y RI++      Q +  R  Q+     E  + +  A +E    P
Sbjct: 81  YFRILNAMAQAAQAQAPRRPQNGAEGGEGGDASSEAQAEMNGQP 124


>gi|258542230|ref|YP_003187663.1| hypothetical protein APA01_11350 [Acetobacter pasteurianus IFO
           3283-01]
 gi|256633308|dbj|BAH99283.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01]
 gi|256636367|dbj|BAI02336.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03]
 gi|256639420|dbj|BAI05382.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07]
 gi|256642476|dbj|BAI08431.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22]
 gi|256645531|dbj|BAI11479.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26]
 gi|256648584|dbj|BAI14525.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32]
 gi|256651637|dbj|BAI17571.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654628|dbj|BAI20555.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12]
          Length = 143

 Score = 94.6 bits (233), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 47/136 (34%), Positives = 69/136 (50%), Gaps = 5/136 (3%)

Query: 9   RSRGRGSNGGNGSFNRKNLNPL---VRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAG 65
           R+R   SNG NGS  + N          +DS+G DV+VRGTAQ + E+Y  L RD+  +G
Sbjct: 7   RTRNHRSNGSNGSSRQLNGQIPMNRNHVFDSHGPDVRVRGTAQQLFEKYLQLGRDSTGSG 66

Query: 66  DYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQ--KERAQNALSEFEASP 123
           D V AE + QHAEHY RI++      Q+  Q   +     +++   +  +   +  +  P
Sbjct: 67  DRVAAEGYFQHAEHYFRIMNAMAQAAQQSQQERAERLAARQQRAVAQANEEGENRQDQDP 126

Query: 124 CPLIEEGKEPIFENSI 139
            P + E  EP  E S 
Sbjct: 127 QPDVREESEPQPELSE 142


>gi|220920163|ref|YP_002495464.1| hypothetical protein Mnod_0114 [Methylobacterium nodulans ORS 2060]
 gi|219944769|gb|ACL55161.1| conserved hypothetical protein [Methylobacterium nodulans ORS 2060]
          Length = 311

 Score = 94.2 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 57/168 (33%), Positives = 78/168 (46%), Gaps = 1/168 (0%)

Query: 10  SRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVV 69
            R   +    G    K  NPL R Y+SNG DVK+RGTAQHIAE+Y+ LARDA + GD V+
Sbjct: 1   MRPNQNRRMRGRNRNKGPNPLTRAYESNGPDVKIRGTAQHIAEKYAQLARDAQANGDPVM 60

Query: 70  AENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEE 129
           AEN+ QH EHY RI++ A  Q +++            E+ E      + + A P      
Sbjct: 61  AENYFQHGEHYQRIIAAANEQYRQQFGGFRPS-FEEDEEGEDEAPQTNGYAAGPENRGGN 119

Query: 130 GKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPN 177
           G  P      +  V+      P  +R +         R+  R   F N
Sbjct: 120 GYTPNGYGQAEDYVDPSQQPQPYETRGERDDRPARFDRQQDRRDRFQN 167


>gi|126736397|ref|ZP_01752139.1| hypothetical protein RCCS2_01359 [Roseobacter sp. CCS2]
 gi|126714218|gb|EBA11087.1| hypothetical protein RCCS2_01359 [Roseobacter sp. CCS2]
          Length = 184

 Score = 94.2 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 38/115 (33%), Positives = 66/115 (57%)

Query: 25  KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
              N + R +DS+G D KVRGT Q I E+Y+ L RDA+ +GD V AEN  QHAEHY R++
Sbjct: 32  SGGNIINRVFDSSGPDGKVRGTPQQIIEKYNQLHRDAVLSGDRVDAENFAQHAEHYTRLL 91

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSI 139
           + AQ +++ K +  E+ +   + +++R +    + + +      +  +P   ++ 
Sbjct: 92  AEAQREVEAKREEQEEQNRQRQAERDRERQDRLKAQEAAANDPSQSDQPDVVDAA 146


>gi|56697310|ref|YP_167676.1| hypothetical protein SPO2459 [Ruegeria pomeroyi DSS-3]
 gi|56679047|gb|AAV95713.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3]
          Length = 236

 Score = 93.8 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 52/169 (30%), Positives = 81/169 (47%), Gaps = 3/169 (1%)

Query: 25  KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
              N + R +DS+G + KVRGT Q I E+Y+ LARDA  A D V AEN  QHAEHY R++
Sbjct: 43  SGGNVVNRVFDSSGPEGKVRGTPQQIIEKYNQLARDAQLANDRVAAENFQQHAEHYLRLL 102

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
           S AQ +I  + +  E+ +   + +++R + A  +   S  P          +  +     
Sbjct: 103 SEAQREIDARREEQERQNRERQAERDR-ERAERQDRDSIAPAPVADPSSAPQPDVLDLGG 161

Query: 145 DVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVP 193
             A +      E   S  + R+RR   PR   +A + ++  E  +   P
Sbjct: 162 SDAGEEASGLVETPESKGESRKRR--APRAEEDAPASDEAGEQPKKKTP 208


>gi|159044280|ref|YP_001533074.1| hypothetical protein Dshi_1731 [Dinoroseobacter shibae DFL 12]
 gi|157912040|gb|ABV93473.1| conserved hypothetical protein [Dinoroseobacter shibae DFL 12]
          Length = 203

 Score = 93.8 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 54/203 (26%), Positives = 76/203 (37%), Gaps = 25/203 (12%)

Query: 10  SRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVV 69
            R   S   N +  R   N + R +DS+G + KVRGT Q I ++Y  LARDA  A D V 
Sbjct: 1   MRSSKSRSRNKNNRRSVGNIVNRVFDSSGPEGKVRGTPQQIIDKYLTLARDAQLANDRVA 60

Query: 70  AENHLQHAEHYNRIVSMA---------------------QAQIQEKLQRDEQDDLLVKEQ 108
            EN  QHAEHY R++S A                     +    E+  R +         
Sbjct: 61  VENFQQHAEHYTRMLSEAMREQEARQEQQAQQAQNQQKSRGDRNERGDRGQSGQGGQGGD 120

Query: 109 KERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRR 168
           +     + S+   +P P   E K P    S    + D    T     E   S    + R 
Sbjct: 121 QPSQGQSRSDPGDAPQPETAEAKPPETGASDVIDLGDG--DTDTGLVETPESKPARKPR- 177

Query: 169 PLRPRVFPNAKSGNQPVEATETI 191
             R R     ++  +  EA+   
Sbjct: 178 -TRSRRKKTDEAPAETAEASSET 199


>gi|197104292|ref|YP_002129669.1| hypothetical protein PHZ_c0826 [Phenylobacterium zucineum HLK1]
 gi|196477712|gb|ACG77240.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 316

 Score = 93.4 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 46/132 (34%), Positives = 62/132 (46%), Gaps = 4/132 (3%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYD-VKVRGTAQHIAERYSVLAR 59
           MR  +  KR          G           R +DSNG D VKVRG AQH+ E+Y  LAR
Sbjct: 1   MRDFKGMKRQ---RGRNRGGGGGGNKPQNANRAFDSNGPDGVKVRGNAQHVFEKYQQLAR 57

Query: 60  DAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEF 119
           DA S+GD V+AEN+LQHAEHY R++   Q Q                +     ++  ++ 
Sbjct: 58  DATSSGDRVLAENYLQHAEHYFRLLRAIQPQRPAAEILGRDQFASGYDIDFEDESVQAQA 117

Query: 120 EASPCPLIEEGK 131
           EA+      +G 
Sbjct: 118 EAADESAESQGD 129


>gi|83951819|ref|ZP_00960551.1| hypothetical protein ISM_14690 [Roseovarius nubinhibens ISM]
 gi|83836825|gb|EAP76122.1| hypothetical protein ISM_14690 [Roseovarius nubinhibens ISM]
          Length = 163

 Score = 93.1 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 39/127 (30%), Positives = 63/127 (49%)

Query: 27  LNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSM 86
            N   R +DS+G + KVRGT Q I ++Y+ LARDA  AGD V  EN  QHAEHY R++  
Sbjct: 2   GNVTNRVFDSSGPEGKVRGTPQQIIDKYNQLARDAQLAGDRVATENFQQHAEHYLRLLGA 61

Query: 87  AQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDV 146
           AQ +   + +  E+ +   + +++R +   ++      P          E+++    E  
Sbjct: 62  AQKEQDARREEQERQNRERQAERDRDRGDQNQQGGDTQPQAGGDDHAAGESTLVETPESQ 121

Query: 147 AFKTPDI 153
               P+ 
Sbjct: 122 PEAQPEA 128


>gi|260433482|ref|ZP_05787453.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260417310|gb|EEX10569.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 192

 Score = 93.1 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 53/174 (30%), Positives = 81/174 (46%), Gaps = 6/174 (3%)

Query: 9   RSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYV 68
           RS    S   N        N + R +DS+G + KVRGT Q I ++Y+ LARDA  A D V
Sbjct: 2   RSSKSRSRAKNNRNRPSGGNVVNRVFDSSGPEGKVRGTPQQIIDKYNQLARDAQLANDRV 61

Query: 69  VAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIE 128
            AEN  QHAEHY R++S AQ +I  +    E+ +   + +++R +    E EA+      
Sbjct: 62  AAENFQQHAEHYLRLLSEAQREIDARRDEQERQNRERQAERDRERAERQEREAARRADPA 121

Query: 129 EGKEPIF------ENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFP 176
           E  +P          + +  + +      D +   +   K  RR R  +P+  P
Sbjct: 122 ETPQPDVLDLGGNAEAPESGLVETPESRSDAAEAPEPKEKPARRPRGRKPKAAP 175


>gi|323138798|ref|ZP_08073862.1| hypothetical protein Met49242DRAFT_3250 [Methylocystis sp. ATCC
          49242]
 gi|322395946|gb|EFX98483.1| hypothetical protein Met49242DRAFT_3250 [Methylocystis sp. ATCC
          49242]
          Length = 294

 Score = 93.1 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 42/65 (64%), Positives = 52/65 (80%)

Query: 20 GSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEH 79
          G   RK  NPL R+Y+SNG DVK+RGTAQHIAE+Y  LARDA S+GD ++AE+ LQHAEH
Sbjct: 3  GRSGRKGPNPLTRSYESNGPDVKIRGTAQHIAEKYLQLARDAQSSGDTIMAESLLQHAEH 62

Query: 80 YNRIV 84
          Y R++
Sbjct: 63 YFRLI 67


>gi|260426103|ref|ZP_05780082.1| conserved hypothetical protein [Citreicella sp. SE45]
 gi|260420595|gb|EEX13846.1| conserved hypothetical protein [Citreicella sp. SE45]
          Length = 241

 Score = 92.7 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 47/149 (31%), Positives = 76/149 (51%), Gaps = 7/149 (4%)

Query: 27  LNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSM 86
            N + R +DS+G + KVRGT Q I ++Y+ LARDA  A D V AEN  QHAEHY R++S 
Sbjct: 20  GNVVNRVFDSSGPEGKVRGTPQQIIDKYNQLARDAGLANDRVAAENFQQHAEHYMRMLSE 79

Query: 87  AQAQIQEKLQRDEQDDLLVKEQK-----ERAQNALSEFEASPCPLIEEGKEPIFENSIQP 141
           AQ ++ ++ ++ E+++   + Q+     +R        + +      E ++P  E   QP
Sbjct: 80  AQREVDQRREQQERENRERQSQRDKERSDRDSQRPDRDDDTSASAQPEQQQPSEEPKAQP 139

Query: 142 KVEDVAFKTPDISREKDVSYKKVRRRRPL 170
           + +      P    E     +  +R  PL
Sbjct: 140 EPQAEPRSEPRA--EPRSESRSEKRADPL 166


>gi|312115443|ref|YP_004013039.1| hypothetical protein Rvan_2729 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220572|gb|ADP71940.1| hypothetical protein Rvan_2729 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 286

 Score = 92.3 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 63/191 (32%), Positives = 91/191 (47%), Gaps = 6/191 (3%)

Query: 11  RGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVA 70
           +G+ S  G     RK  N + RNY+S+G DVK+RGTA HIAE+Y+ LARDAM++GD V A
Sbjct: 11  QGQQSRRGRNRGGRKPQNSISRNYESSGPDVKIRGTAMHIAEKYTSLARDAMASGDSVAA 70

Query: 71  ENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEG 130
           EN+LQHAEHYNRI+  AQAQ     Q           Q   +++  S+ +        + 
Sbjct: 71  ENYLQHAEHYNRIILAAQAQNPGGEQPVNGGSGRFGAQDAYSRDFDSDDDDDGEDFAPQQ 130

Query: 131 K--EPIFENSIQPKVE----DVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQP 184
           +  +P+  N    + E        + P+ +   +   +  R  R  RP   P      QP
Sbjct: 131 QRFQPLERNERAERPERNERPERVERPERAPRPERIERPERVERAERPERVPAYNQHQQP 190

Query: 185 VEATETIVPQE 195
                     +
Sbjct: 191 QPYIPQNAFPQ 201


>gi|182677817|ref|YP_001831963.1| hypothetical protein Bind_0824 [Beijerinckia indica subsp. indica
          ATCC 9039]
 gi|182633700|gb|ACB94474.1| conserved hypothetical protein [Beijerinckia indica subsp. indica
          ATCC 9039]
          Length = 345

 Score = 91.9 bits (226), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 53/96 (55%), Positives = 65/96 (67%), Gaps = 8/96 (8%)

Query: 1  MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
          MR  Q  KR RGR +N       RK  NPL R+Y+SNG DVK+RGTA HI E+Y  LARD
Sbjct: 1  MRPGQ-NKRMRGRPNN-------RKGPNPLTRSYESNGPDVKIRGTAHHIGEKYLQLARD 52

Query: 61 AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQ 96
          A SAGD V+AE++LQHAEHY R+++ AQ   Q+   
Sbjct: 53 AQSAGDPVMAESYLQHAEHYFRLIAAAQQAQQQAAN 88


>gi|16125129|ref|NP_419693.1| hypothetical protein CC_0876 [Caulobacter crescentus CB15]
 gi|221233857|ref|YP_002516293.1| cytosolic protein [Caulobacter crescentus NA1000]
 gi|13422137|gb|AAK22861.1| hypothetical protein CC_0876 [Caulobacter crescentus CB15]
 gi|220963029|gb|ACL94385.1| hypothetical cytosolic protein [Caulobacter crescentus NA1000]
          Length = 370

 Score = 91.9 bits (226), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 43/91 (47%), Positives = 56/91 (61%), Gaps = 3/91 (3%)

Query: 1  MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYD-VKVRGTAQHIAERYSVLAR 59
          MR  +  KR   RG N   G+  +   +   R +DSNG + VKVRG AQ + E+Y  LAR
Sbjct: 1  MRDFKGMKRQ--RGRNNRGGNGGKPQQHNANRAFDSNGPEGVKVRGAAQSVYEKYQQLAR 58

Query: 60 DAMSAGDYVVAENHLQHAEHYNRIVSMAQAQ 90
          DA S+GD V+AEN+LQHAEHY R++   Q  
Sbjct: 59 DASSSGDRVLAENYLQHAEHYFRVLRAIQPN 89


>gi|146337701|ref|YP_001202749.1| hypothetical protein BRADO0569 [Bradyrhizobium sp. ORS278]
 gi|146190507|emb|CAL74506.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 279

 Score = 91.5 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 52/162 (32%), Positives = 80/162 (49%), Gaps = 1/162 (0%)

Query: 29  PLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
           PL R ++SNG D+K+RGTA H+AE+Y  LARDA S+GD V AEN+ QHAEHY R+++ AQ
Sbjct: 27  PLTRVFESNGPDIKIRGTASHVAEKYVQLARDARSSGDPVAAENYYQHAEHYFRLIAAAQ 86

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEE-GKEPIFENSIQPKVEDVA 147
            Q ++   +    D L  +  +    + S F   P  +  +   +P   +  Q +  D  
Sbjct: 87  EQFRQNQPQPRNTDDLTVDDLDDDGESFSNFGQEPGFVQPQPQAQPFVRDGGQRERGDNQ 146

Query: 148 FKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATE 189
                  ++     +    R+P   R     +   +P E  E
Sbjct: 147 QPYQRDQQQPREHREAREHRQPREHREPREPREHREPRENRE 188


>gi|209965907|ref|YP_002298822.1| hypothetical protein RC1_2635 [Rhodospirillum centenum SW]
 gi|209959373|gb|ACJ00010.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 133

 Score = 90.8 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 36/77 (46%), Positives = 47/77 (61%)

Query: 32  RNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQI 91
           + +DSNG DV++RG A  I E+Y  LARDA ++GD V AEN+LQHAEHY RI+     Q 
Sbjct: 31  QTFDSNGPDVRIRGNAFQIYEKYQALARDAQASGDRVAAENYLQHAEHYYRIICQINEQE 90

Query: 92  QEKLQRDEQDDLLVKEQ 108
             + Q   + D     Q
Sbjct: 91  SRQRQGGARGDGNGHAQ 107


>gi|254440171|ref|ZP_05053665.1| hypothetical protein OA307_5041 [Octadecabacter antarcticus 307]
 gi|198255617|gb|EDY79931.1| hypothetical protein OA307_5041 [Octadecabacter antarcticus 307]
          Length = 238

 Score = 90.4 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 46/178 (25%), Positives = 75/178 (42%), Gaps = 13/178 (7%)

Query: 26  NLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVS 85
             N + R +DS+G + KVRGT Q I E+Y+ L RD++ A D V +EN  QHAEHY R+++
Sbjct: 61  GGNIVNRVFDSSGPEGKVRGTPQQIVEKYTQLHRDSLLARDSVNSENFAQHAEHYTRLLA 120

Query: 86  MAQAQIQEKLQRDEQDDLLV-------------KEQKERAQNALSEFEASPCPLIEEGKE 132
            AQ +I  K +  E+ +                +  +ER     ++ EA+          
Sbjct: 121 EAQKEIDAKREEQEKHNRERQIEQDKQNRERQAERDRERDARMKAQEEAAAAAPAPAPAA 180

Query: 133 PIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATET 190
                 +   VE         S   +   +  ++RR  +P+  P+      P      
Sbjct: 181 APAPVLVPAPVEQPVQIEDGDSGLVETPEEAPKKRRTRKPKTRPDEPPEGGPASEAAE 238


>gi|295690767|ref|YP_003594460.1| cytosolic protein [Caulobacter segnis ATCC 21756]
 gi|295432670|gb|ADG11842.1| cytosolic protein [Caulobacter segnis ATCC 21756]
          Length = 372

 Score = 90.0 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 43/91 (47%), Positives = 56/91 (61%), Gaps = 3/91 (3%)

Query: 1  MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYD-VKVRGTAQHIAERYSVLAR 59
          MR  +  KR R  G N   G+  +   +   R +DSNG + VKVRG AQ + E+Y  LAR
Sbjct: 1  MRDFKGMKRQR--GRNNRGGNGGKPQQHNANRAFDSNGPEGVKVRGAAQSVYEKYQQLAR 58

Query: 60 DAMSAGDYVVAENHLQHAEHYNRIVSMAQAQ 90
          DA S+GD V+AEN+LQHAEHY R++   Q  
Sbjct: 59 DASSSGDRVLAENYLQHAEHYFRVLRAIQPN 89


>gi|110680312|ref|YP_683319.1| hypothetical protein RD1_3125 [Roseobacter denitrificans OCh 114]
 gi|109456428|gb|ABG32633.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114]
          Length = 187

 Score = 90.0 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 47/154 (30%), Positives = 76/154 (49%), Gaps = 2/154 (1%)

Query: 16  NGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQ 75
            G     N +  N + R +DS+G + KVRGT Q I E+Y+ L RDA  + D V AEN  Q
Sbjct: 11  KGNRNRSNNQGGNVVNRVFDSSGPEGKVRGTPQQIIEKYNQLTRDAQLSNDRVAAENFQQ 70

Query: 76  HAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIF 135
           HAEHY R++S AQ +I  +  R+EQ+    + Q ER +      E          ++   
Sbjct: 71  HAEHYTRMLSEAQREIDAR--REEQERQNRERQAERDRERAERQEREAANAAAAAEQQQA 128

Query: 136 ENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRP 169
             + + + +    +TP+   +   + ++  R +P
Sbjct: 129 TETPEQEADSGLVETPESQPKPKRAPRRKPRAKP 162


>gi|149204048|ref|ZP_01881016.1| hypothetical protein RTM1035_11020 [Roseovarius sp. TM1035]
 gi|149142490|gb|EDM30535.1| hypothetical protein RTM1035_11020 [Roseovarius sp. TM1035]
          Length = 246

 Score = 90.0 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 49/160 (30%), Positives = 70/160 (43%), Gaps = 2/160 (1%)

Query: 12  GRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAE 71
            +       + NR   N + R +DS+G + KVRGT Q I E+Y+ LARDA  AGD V  E
Sbjct: 4   SKSRQRNKPNRNRTVGNVVNRVFDSSGPEGKVRGTPQQIIEKYNQLARDAQLAGDRVATE 63

Query: 72  NHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGK 131
           N  QHAEHY R++S AQ +   +  R+EQ+      Q++R ++             E+  
Sbjct: 64  NFQQHAEHYLRLLSEAQKEQDAR--REEQERFNRDRQQDRDRDRPERSGGRESDEGEQPV 121

Query: 132 EPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLR 171
                   QP V     +      E   S  +    R   
Sbjct: 122 SQDPAAQAQPDVIGSYDERDIGLVETPESKPQPEPSRRRA 161


>gi|99080784|ref|YP_612938.1| hypothetical protein TM1040_0943 [Ruegeria sp. TM1040]
 gi|99037064|gb|ABF63676.1| conserved hypothetical protein [Ruegeria sp. TM1040]
          Length = 236

 Score = 90.0 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 45/176 (25%), Positives = 79/176 (44%), Gaps = 2/176 (1%)

Query: 25  KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
              N + R +DS+G + KVRGT Q I ++Y+ LARDA    D V  EN  QHAEHY R++
Sbjct: 38  NGANVVNRVFDSSGPEGKVRGTPQQIIDKYNQLARDAQLGNDRVATENFQQHAEHYLRML 97

Query: 85  SMAQAQIQEKLQRDEQDDLLV--KEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPK 142
           + AQ +I+ K +  E+ +     +  +ERA+    +   +      +G +P   +  +  
Sbjct: 98  NEAQREIEAKREEQERQNRERQAERDRERAERLERQEREAAEAAAGDGPQPEIADPREAP 157

Query: 143 VEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
           V++    +  +   +  + +         P   P ++    P E        E  +
Sbjct: 158 VQEAQDDSGLVETPEGKTSEGEATPAKKAPARKPRSRKPAAPKEGENGEAKPEAEA 213


>gi|315500226|ref|YP_004089029.1| cytosolic protein [Asticcacaulis excentricus CB 48]
 gi|315418238|gb|ADU14878.1| cytosolic protein [Asticcacaulis excentricus CB 48]
          Length = 318

 Score = 89.6 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 52/131 (39%), Positives = 63/131 (48%), Gaps = 10/131 (7%)

Query: 7   YKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDV-KVRGTAQHIAERYSVLARDAMSAG 65
            KR R R            N N   R Y+SNG D  KVRG AQ I E+Y  LARDA S+G
Sbjct: 1   MKRQRSRNRKPSG------NQNNPNRAYESNGPDGAKVRGNAQTIYEKYQQLARDANSSG 54

Query: 66  DYVVAENHLQHAEHYNRIVSMAQAQ--IQEKLQRDE-QDDLLVKEQKERAQNALSEFEAS 122
           D V+AEN+LQHAEHY R++   Q Q  + E LQRD         E  +           +
Sbjct: 55  DRVLAENYLQHAEHYFRLIRQMQPQRPVSEFLQRDPFSTGFDFDEDLDTEIETTETEGET 114

Query: 123 PCPLIEEGKEP 133
                 EG +P
Sbjct: 115 AESEGGEGDQP 125


>gi|217978068|ref|YP_002362215.1| hypothetical protein Msil_1908 [Methylocella silvestris BL2]
 gi|217503444|gb|ACK50853.1| conserved hypothetical protein [Methylocella silvestris BL2]
          Length = 345

 Score = 89.2 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 70/185 (37%), Positives = 96/185 (51%), Gaps = 14/185 (7%)

Query: 1   MRSVQQYK-RSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLAR 59
           MR  Q  K R RGR +N      NRK  NPL R+Y+S+G DVK+RGTA HI E+Y  LAR
Sbjct: 1   MRPGQNNKQRMRGRPNN------NRKGPNPLTRSYESSGPDVKIRGTAHHIGEKYLQLAR 54

Query: 60  DAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEK--LQRDEQDDLLVKEQKERAQNALS 117
           DA S+GD V AE++LQHAEHY R++++AQAQ Q     QR   D +  +   +    AL 
Sbjct: 55  DAQSSGDPVTAESYLQHAEHYFRLIALAQAQQQGASGYQRQPGDAMAEEIDGDDDFAALP 114

Query: 118 EFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVR-----RRRPLRP 172
           +  ASP       +            + VA +    +  +D   +  R      R+   P
Sbjct: 115 DRFASPIERFAAPQPAFAPQPPGGGPQPVADRPFYPTNGQDRQPQAPRVAPYQERQQQEP 174

Query: 173 RVFPN 177
           R +P+
Sbjct: 175 RAYPD 179


>gi|319899310|ref|YP_004159407.1| hypothetical protein BARCL_1165 [Bartonella clarridgeiae 73]
 gi|319403278|emb|CBI76837.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 233

 Score = 88.8 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 42/85 (49%), Positives = 58/85 (68%)

Query: 30  LVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQA 89
           L RNY+SNG DVK+RG AQ IA++Y  LARDA  AGD V++EN+LQHAEHY RI+  A  
Sbjct: 28  LSRNYESNGPDVKIRGNAQQIADKYIGLARDAQGAGDRVMSENYLQHAEHYLRIILAAAD 87

Query: 90  QIQEKLQRDEQDDLLVKEQKERAQN 114
           Q+ +  + +++ +    E+  R  N
Sbjct: 88  QMSQSHKNEQECEETSAEENIRGGN 112


>gi|254474377|ref|ZP_05087763.1| conserved hypothetical protein [Ruegeria sp. R11]
 gi|214028620|gb|EEB69455.1| conserved hypothetical protein [Ruegeria sp. R11]
          Length = 220

 Score = 88.4 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 43/155 (27%), Positives = 75/155 (48%), Gaps = 1/155 (0%)

Query: 25  KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
           +  N + R +DS+G + KVRGT Q I ++Y+ LARDA  + D V  EN  QHAEHY R++
Sbjct: 18  QGANVVNRVFDSSGPEGKVRGTPQQIIDKYNQLARDAQLSNDRVATENFQQHAEHYLRML 77

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEE-GKEPIFENSIQPKV 143
           + AQ +I+ + +  E+ +   + +++R +    E +        E   +P   +      
Sbjct: 78  NEAQREIEARREEQERQNRERQAERDRERQERLERQEREAASRGEDAPQPDVVDPRDSDD 137

Query: 144 EDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNA 178
           +     TP+ +  +  S  +   +    P   P A
Sbjct: 138 DSGLVDTPEQAAAEQPSADQGEAKPQKAPSRKPRA 172


>gi|89054299|ref|YP_509750.1| hypothetical protein Jann_1808 [Jannaschia sp. CCS1]
 gi|88863848|gb|ABD54725.1| hypothetical protein Jann_1808 [Jannaschia sp. CCS1]
          Length = 224

 Score = 88.1 bits (216), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 35/94 (37%), Positives = 55/94 (58%)

Query: 7   YKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGD 66
            + S+ R  + GN + N    N + R +DS+G + KVRGT Q I ++Y+ L RDA  + D
Sbjct: 1   MRSSKNRSRSKGNRNRNGSMGNIVNRVFDSSGPEGKVRGTPQQIVDKYNQLTRDAQLSND 60

Query: 67  YVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQ 100
            V AE+  QHAEHY R+++ A  + + K  + + 
Sbjct: 61  RVAAESFQQHAEHYTRMLAQALREQEAKQAQHQA 94


>gi|54288340|gb|AAV31628.1| conserved hypothetical protein [uncultured alpha proteobacterium
           EBAC2C11]
          Length = 169

 Score = 87.3 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 58/109 (53%), Gaps = 1/109 (0%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR  Q  KR R RG  G N   +    N    +Y+SNG DVK+RG AQ + E+Y  LA D
Sbjct: 1   MRQPQNAKRGRSRGRRGNNNGGHNHVPN-RNTSYESNGPDVKLRGNAQQLHEKYLALAHD 59

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQK 109
           A ++G+ + AE + Q A+HY R+   A    + K Q+D+   L     K
Sbjct: 60  AATSGERISAEAYTQFADHYFRLHQAAVGVAESKRQQDQVGTLDADVSK 108


>gi|163759875|ref|ZP_02166959.1| hypothetical protein HPDFL43_16631 [Hoeflea phototrophica DFL-43]
 gi|162282833|gb|EDQ33120.1| hypothetical protein HPDFL43_16631 [Hoeflea phototrophica DFL-43]
          Length = 232

 Score = 87.3 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 71/175 (40%), Positives = 95/175 (54%), Gaps = 5/175 (2%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR  QQ KR R  G +G N + NRK  NPL R YDS+G DVKVRGTAQH+AE+Y  LARD
Sbjct: 1   MRPGQQNKRGR--GRSGNNNNGNRKGQNPLSRTYDSSGPDVKVRGTAQHVAEKYMNLARD 58

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
           A S+GD V+AEN+LQHAEHYNRI+  AQAQ+QE++QRD+        Q +   +   +  
Sbjct: 59  AQSSGDRVMAENYLQHAEHYNRIIMTAQAQLQERMQRDDNQPQSRDSQDQDQDDDDRDSS 118

Query: 121 ASPCPLIEEG---KEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRP 172
                  +E    ++P  E   +    D   +      ++             +P
Sbjct: 119 DDRGNGGQEQRAERQPRQERGNRRDRGDRPERQSRKPDQEAQDQPTAYDPDAPQP 173


>gi|154252201|ref|YP_001413025.1| hypothetical protein Plav_1749 [Parvibaculum lavamentivorans DS-1]
 gi|154156151|gb|ABS63368.1| conserved hypothetical protein [Parvibaculum lavamentivorans DS-1]
          Length = 248

 Score = 86.1 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 65/204 (31%), Positives = 88/204 (43%), Gaps = 13/204 (6%)

Query: 1   MRSVQQY-KRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLAR 59
           MR  Q   KRSRGRG      S N        R YDSNG DVKVRGTA  + E+Y  LAR
Sbjct: 1   MRQGQNNAKRSRGRGRKPQQHSAN--------RAYDSNGPDVKVRGTAATVCEKYQQLAR 52

Query: 60  DAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEF 119
           DA+SAGD V AEN+ QHAEHY R++   Q   + + ++         E +E ++N     
Sbjct: 53  DAISAGDRVTAENYYQHAEHYYRLLMATQQGQEGQQRQQSSLGYRPDEDEE-SENEGDYT 111

Query: 120 EASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPN-A 178
              P P      +P  +   Q +  +   + P+ +     +           PR     A
Sbjct: 112 PDGPQP--RHRGQPWHQQEGQQRHNNNGGQHPNQTNGGHNNNGSQNNGSQNAPRHDDRSA 169

Query: 179 KSGNQPVEATETIVPQELNSDNAS 202
           +S     EA +    Q    D   
Sbjct: 170 QSSGDGDEAADRAALQASGQDEGQ 193


>gi|126462318|ref|YP_001043432.1| hypothetical protein Rsph17029_1550 [Rhodobacter sphaeroides ATCC
           17029]
 gi|126103982|gb|ABN76660.1| conserved hypothetical protein [Rhodobacter sphaeroides ATCC 17029]
          Length = 275

 Score = 85.7 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 40/140 (28%), Positives = 61/140 (43%), Gaps = 3/140 (2%)

Query: 27  LNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSM 86
            N + R +DS+G + KVRGT   I E+Y  LARDA  + D V AEN LQHAEHY R++  
Sbjct: 19  GNIVNRVFDSSGPEGKVRGTPAQIIEKYLFLARDAQLSNDRVAAENFLQHAEHYTRLLGE 78

Query: 87  AQAQI---QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV 143
           AQ ++   QE  + + Q +      + +  +                 +   +   QP+ 
Sbjct: 79  AQRELAAEQENRRSEHQQNQGGASHQGQGGSPSQPGNHRHERGDRPRDDRREDRQDQPRA 138

Query: 144 EDVAFKTPDISREKDVSYKK 163
           E           + + S   
Sbjct: 139 EREPRPEAAPPAKPETSDSS 158


>gi|119383647|ref|YP_914703.1| hypothetical protein Pden_0896 [Paracoccus denitrificans PD1222]
 gi|119373414|gb|ABL69007.1| conserved hypothetical protein [Paracoccus denitrificans PD1222]
          Length = 262

 Score = 85.7 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 50/97 (51%)

Query: 24  RKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRI 83
           R   N + R +DS+G + KVRGT Q I E+Y  LARDA  + D V  ++ LQHAEHY R+
Sbjct: 16  RSLGNIVNRVFDSSGPEGKVRGTPQQIIEKYLTLARDAQLSNDRVAEQSFLQHAEHYTRL 75

Query: 84  VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
           +  AQ +  E+  +  Q+             + +   
Sbjct: 76  LGEAQREQAERQSQQHQNRDDDLHDGNGQTASENGNG 112


>gi|86138687|ref|ZP_01057260.1| hypothetical protein MED193_22606 [Roseobacter sp. MED193]
 gi|85824747|gb|EAQ44949.1| hypothetical protein MED193_22606 [Roseobacter sp. MED193]
          Length = 266

 Score = 85.4 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 40/174 (22%), Positives = 73/174 (41%)

Query: 25  KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
             +N + R +DS+G + KVRGT Q I ++Y+ L RDA  + D V AEN  QHAEHY R++
Sbjct: 18  NGVNVVNRVFDSSGPEGKVRGTPQQIIDKYNQLTRDAQLSNDRVAAENFQQHAEHYLRLL 77

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
           + AQ +I  + +  E+ +   + +++R +    E +       +  ++       Q    
Sbjct: 78  NEAQREIDARREEQERQNRERQAERDRERAERLERQEREATANQAAQQQPSRQQGQQPQP 137

Query: 145 DVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
             +               +       +P V     + +   E +  +   E   
Sbjct: 138 GHSSGERQSDVAATQPAARQDPASAPQPEVIDPRDTTSNAPEGSGLVETPESKG 191


>gi|302381614|ref|YP_003817437.1| hypothetical protein Bresu_0499 [Brevundimonas subvibrioides ATCC
           15264]
 gi|302192242|gb|ADK99813.1| conserved hypothetical protein [Brevundimonas subvibrioides ATCC
           15264]
          Length = 360

 Score = 85.4 bits (209), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 60/199 (30%), Positives = 93/199 (46%), Gaps = 10/199 (5%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYD-VKVRGTAQHIAERYSVLAR 59
           MR  +  KR RGR    G GS    N     R++DS G + +KVRG AQ + ERY  LAR
Sbjct: 1   MRDFKGMKRQRGRNRKPGGGSGGNANAANPNRSWDSQGPENIKVRGNAQTVYERYQQLAR 60

Query: 60  DAMSAGDYVVAENHLQHAEHYNRIVSMAQAQ--IQEKLQRDEQDDLLVKEQKERAQNALS 117
           DA S+GD V+AEN+LQHAEHY R++   Q Q  + E   R+  +     + ++      +
Sbjct: 61  DAGSSGDRVLAENYLQHAEHYFRVLRALQPQRPVSEIAARELSNQGYDIDFEDETGAQAA 120

Query: 118 EFEASPCPLIEEGKEPIFENSIQPKVEDVAFKT-------PDISREKDVSYKKVRRRRPL 170
            F A+        ++    ++   +      +        P  ++++D +  + R   P 
Sbjct: 121 AFLAAQQAADRIQQQSDARDAEAAQGSQQPREQREWTPRPPRENQDRDQTQNRDREWTPR 180

Query: 171 RPRVFPNAKSGNQPVEATE 189
            PR   + + G QP    E
Sbjct: 181 PPRETRDGQEGGQPRAEGE 199


>gi|332558340|ref|ZP_08412662.1| hypothetical protein RSWS8N_04775 [Rhodobacter sphaeroides WS8N]
 gi|332276052|gb|EGJ21367.1| hypothetical protein RSWS8N_04775 [Rhodobacter sphaeroides WS8N]
          Length = 275

 Score = 85.4 bits (209), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 40/140 (28%), Positives = 61/140 (43%), Gaps = 3/140 (2%)

Query: 27  LNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSM 86
            N + R +DS+G + KVRGT   I E+Y  LARDA  + D V AEN LQHAEHY R++  
Sbjct: 19  GNIVNRVFDSSGPEGKVRGTPAQIIEKYLFLARDAQLSNDRVAAENFLQHAEHYTRLLGE 78

Query: 87  AQAQI---QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV 143
           AQ ++   QE  + + Q +      + +  +                 +   +   QP+ 
Sbjct: 79  AQRELAAEQENRRSEHQQNQGGASHQGQGGSPSQPGNHRHERGDRPRDDRREDRQDQPRA 138

Query: 144 EDVAFKTPDISREKDVSYKK 163
           E           + + S   
Sbjct: 139 EREPRPEAAPPAKPETSDSS 158


>gi|288956984|ref|YP_003447325.1| hypothetical protein AZL_001430 [Azospirillum sp. B510]
 gi|288909292|dbj|BAI70781.1| hypothetical protein AZL_001430 [Azospirillum sp. B510]
          Length = 145

 Score = 85.0 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 45/64 (70%)

Query: 32  RNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQI 91
           + +DSNG DV++RG A  + E+Y  LARDAMS+GD V AEN+LQHAEHY RI++  Q   
Sbjct: 42  QTFDSNGPDVRIRGNAWQVQEKYQALARDAMSSGDRVQAENYLQHAEHYLRIINQIQESE 101

Query: 92  QEKL 95
             + 
Sbjct: 102 NRQR 105


>gi|221639321|ref|YP_002525583.1| hypothetical protein RSKD131_1222 [Rhodobacter sphaeroides KD131]
 gi|221160102|gb|ACM01082.1| Hypothetical Protein RSKD131_1222 [Rhodobacter sphaeroides KD131]
          Length = 275

 Score = 85.0 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 40/140 (28%), Positives = 61/140 (43%), Gaps = 3/140 (2%)

Query: 27  LNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSM 86
            N + R +DS+G + KVRGT   I E+Y  LARDA  + D V AEN LQHAEHY R++  
Sbjct: 19  GNIVNRVFDSSGPEGKVRGTPAQIIEKYLFLARDAQLSNDRVAAENFLQHAEHYTRLLGE 78

Query: 87  AQAQI---QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV 143
           AQ ++   QE  + + Q +      + +  +                 +   +   QP+ 
Sbjct: 79  AQRELATEQENRRSEHQQNQGGASHQGQGGSPSQPGNHRHERGDRPRDDRREDRQDQPRA 138

Query: 144 EDVAFKTPDISREKDVSYKK 163
           E           + + S   
Sbjct: 139 EREPRPEAAPPAKPETSDSS 158


>gi|89070963|ref|ZP_01158189.1| hypothetical protein OG2516_03478 [Oceanicola granulosus HTCC2516]
 gi|89043470|gb|EAR49684.1| hypothetical protein OG2516_03478 [Oceanicola granulosus HTCC2516]
          Length = 165

 Score = 84.6 bits (207), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 46/164 (28%), Positives = 74/164 (45%)

Query: 34  YDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQE 93
           +DS+G D KVRGT Q I ++Y+ L RDA  AGD V AEN  QHAEHY R+++ A  ++ +
Sbjct: 2   FDSSGPDGKVRGTPQQIIDKYNQLHRDAQLAGDRVDAENFAQHAEHYTRMLAEATKEVDQ 61

Query: 94  KLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDI 153
           K +  E+ +   + +++R +    + +         G++P             A   P  
Sbjct: 62  KREEQERQNRERQAERDRERAERLKAQEQASNESGSGEQPDTSGGSDLVDTPEARNEPPQ 121

Query: 154 SREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELN 197
            +  +   KK RR R  +         GN      +   P+   
Sbjct: 122 PKGDEPPAKKPRRSRARKKPADDGQSPGNPSPNDGQDSAPEAAE 165


>gi|332716894|ref|YP_004444360.1| hypothetical protein AGROH133_13062 [Agrobacterium sp. H13-3]
 gi|325063579|gb|ADY67269.1| hypothetical protein AGROH133_13062 [Agrobacterium sp. H13-3]
          Length = 268

 Score = 84.6 bits (207), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 60/151 (39%), Positives = 87/151 (57%), Gaps = 9/151 (5%)

Query: 29  PLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQ 88
           PL R YDS+G DVK+RGTAQHIAE+Y+ LARDA SAGD V+AEN+LQHAEHYNRI++ AQ
Sbjct: 36  PLTRTYDSSGPDVKIRGTAQHIAEKYATLARDAQSAGDRVIAENYLQHAEHYNRIIATAQ 95

Query: 89  AQIQEKLQRDEQDDLLVKEQKER---------AQNALSEFEASPCPLIEEGKEPIFENSI 139
           AQ+QE+ QRD++ +    +  +           Q    + E    P  +E +E    +  
Sbjct: 96  AQMQERFQRDDRGEYNASDADDMDMNDGDDGAPQQQFEQPERVQQPERQERQERTERSEP 155

Query: 140 QPKVEDVAFKTPDISREKDVSYKKVRRRRPL 170
           + +  +   +     R+         R++P+
Sbjct: 156 RQERRERPDRRERQERQPRQPQASDERQQPV 186


>gi|148555443|ref|YP_001263025.1| hypothetical protein Swit_2528 [Sphingomonas wittichii RW1]
 gi|148500633|gb|ABQ68887.1| hypothetical protein Swit_2528 [Sphingomonas wittichii RW1]
          Length = 269

 Score = 84.2 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 32/101 (31%), Positives = 51/101 (50%), Gaps = 2/101 (1%)

Query: 37  NGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQ 96
           N  D + RG A  + E+Y  LARDA   GD V  E +LQ A+HY R++S ++++ +++  
Sbjct: 33  NRIDNRARGNAAQLLEKYKALARDAQMQGDRVNTEYYLQFADHYFRVLSESRSRFEDQQP 92

Query: 97  RDEQDDLLVKEQKERAQNA--LSEFEASPCPLIEEGKEPIF 135
           R  +D+      +E       +   E  P P    G+E  F
Sbjct: 93  RPRRDEFTGASDEEYGDEGDRIGADEQQPAPARAAGQERGF 133


>gi|297180851|gb|ADI17056.1| hypothetical protein [uncultured alpha proteobacterium
           HF0010_30A23]
          Length = 263

 Score = 84.2 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 35/131 (26%), Positives = 58/131 (44%), Gaps = 1/131 (0%)

Query: 3   SVQQYKRSRGRGSNGGNGSFNRKNLNPL-VRNYDSNGYDVKVRGTAQHIAERYSVLARDA 61
             +     +G    G      ++   P   + +DSNG DV+VRG A  + ++YS LAR+A
Sbjct: 24  QGKGNNMRQGNNRRGRQPKQQKQGTIPTRNQVFDSNGPDVRVRGNAHQVYDKYSALAREA 83

Query: 62  MSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEA 121
            +AG+++ AE + Q AEHY R+   A         R    +   +   E  ++ L     
Sbjct: 84  TAAGNHIQAEAYYQFAEHYLRLHLAATVMGGGNNNRRGGGNPKDQFPPEALEDPLIFRPD 143

Query: 122 SPCPLIEEGKE 132
            P P     ++
Sbjct: 144 MPEPQERNEQQ 154


>gi|77463463|ref|YP_352967.1| hypothetical protein RSP_6078 [Rhodobacter sphaeroides 2.4.1]
 gi|77387881|gb|ABA79066.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1]
          Length = 275

 Score = 84.2 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 40/140 (28%), Positives = 61/140 (43%), Gaps = 3/140 (2%)

Query: 27  LNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSM 86
            N + R +DS+G + KVRGT   I E+Y  LARDA  + D V AEN LQHAEHY R++  
Sbjct: 19  GNIVNRVFDSSGPEGKVRGTPAQIIEKYLFLARDAQLSNDRVAAENFLQHAEHYTRLLGE 78

Query: 87  AQAQI---QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV 143
           AQ ++   QE  + + Q +      + +  +                 +   +   QP+ 
Sbjct: 79  AQRELAAEQENRRSEHQQNQGGASHQGQGGSPSQPGNHRHERGDRPRDDRREDRQDQPRA 138

Query: 144 EDVAFKTPDISREKDVSYKK 163
           E           + + S   
Sbjct: 139 EREPRPEAAPPAKPETSDSS 158


>gi|297181251|gb|ADI17445.1| hypothetical protein [uncultured Rhodospirillales bacterium
          HF0070_31K06]
          Length = 76

 Score = 84.2 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 30/72 (41%), Positives = 43/72 (59%)

Query: 9  RSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYV 68
          R           + NR+N +   + +DSNG  V++RG A  + E+Y  +ARDA S+GD +
Sbjct: 5  RQNHGSKRSRGRNSNRRNGSSRNQTFDSNGPSVRIRGNASQVHEKYLAMARDASSSGDRI 64

Query: 69 VAENHLQHAEHY 80
           AEN+ QHAEHY
Sbjct: 65 AAENYFQHAEHY 76


>gi|300025032|ref|YP_003757643.1| hypothetical protein Hden_3531 [Hyphomicrobium denitrificans ATCC
          51888]
 gi|299526853|gb|ADJ25322.1| conserved hypothetical protein [Hyphomicrobium denitrificans ATCC
          51888]
          Length = 320

 Score = 83.8 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 41/70 (58%), Positives = 58/70 (82%)

Query: 25 KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
          K+ NPL+R+++S+G DVK+RGT  HIAE+Y  LARDA+S+GD V+AEN+LQHAEHYNRI+
Sbjct: 21 KSQNPLMRSFESSGPDVKIRGTPSHIAEKYVSLARDALSSGDPVLAENYLQHAEHYNRII 80

Query: 85 SMAQAQIQEK 94
             + Q+ ++
Sbjct: 81 LSYREQMAQQ 90


>gi|298292696|ref|YP_003694635.1| hypothetical protein Snov_2727 [Starkeya novella DSM 506]
 gi|296929207|gb|ADH90016.1| conserved hypothetical protein [Starkeya novella DSM 506]
          Length = 353

 Score = 83.4 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 53/112 (47%), Positives = 71/112 (63%)

Query: 7   YKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGD 66
            + S  +    G  + NR++ NPL R Y+SNG DVKVRGTAQHI E+Y  LARDA ++GD
Sbjct: 1   MRNSNQQKRMRGRNNNNRRSQNPLTRVYESNGPDVKVRGTAQHIVEKYQQLARDAQASGD 60

Query: 67  YVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSE 118
            V AEN+LQHAEHY RI++ AQAQ   + Q  ++ D    E++     A  +
Sbjct: 61  PVAAENYLQHAEHYYRIIAAAQAQFGVQGQPFQRSDEDDFEEEGEEAGAEGQ 112


>gi|260576767|ref|ZP_05844752.1| conserved hypothetical protein [Rhodobacter sp. SW2]
 gi|259021019|gb|EEW24330.1| conserved hypothetical protein [Rhodobacter sp. SW2]
          Length = 250

 Score = 83.0 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 44/163 (26%), Positives = 69/163 (42%), Gaps = 20/163 (12%)

Query: 21  SFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHY 80
           +  R   N + R +DS+G D KVRGT Q I E+Y  LARDA  + D V AEN  QHAEHY
Sbjct: 13  NRPRTIGNIVNRVFDSSGPDGKVRGTPQQIIEKYLFLARDAQLSNDRVAAENFNQHAEHY 72

Query: 81  NRIVSMAQAQIQEK--------------------LQRDEQDDLLVKEQKERAQNALSEFE 120
            R+++ AQ ++  +                     QRD QD    +  ++R        +
Sbjct: 73  TRMLAEAQRELAAEQEQRQPQQQQPQQQGNPNQNQQRDRQDRGDYRPDQQRNDQRNDRND 132

Query: 121 ASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKK 163
             P     +G +P        ++        +    +  + ++
Sbjct: 133 QRPERDDRDGDQPYLRQPEAFELIPDDSGLVETPESRHSTPRR 175


>gi|114569199|ref|YP_755879.1| hypothetical protein Mmar10_0648 [Maricaulis maris MCS10]
 gi|114339661|gb|ABI64941.1| conserved hypothetical protein [Maricaulis maris MCS10]
          Length = 250

 Score = 83.0 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 45/109 (41%), Positives = 58/109 (53%), Gaps = 9/109 (8%)

Query: 7   YKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGD 66
            KR RGRG         RK  N   R+Y+SNG +VK+RG A  I ++Y  LARDA  AGD
Sbjct: 1   MKRQRGRG---------RKPGNSANRSYESNGPEVKIRGNASQIYDKYMQLARDASLAGD 51

Query: 67  YVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNA 115
            V AEN  QHAEHY RIV + Q +       D   +  + ++ +  Q  
Sbjct: 52  RVRAENLFQHAEHYLRIVQLNQPKRDPNQDDDNNGNDSLDDEDDGQQFG 100


>gi|163743157|ref|ZP_02150539.1| hypothetical protein RG210_14690 [Phaeobacter gallaeciensis 2.10]
 gi|161383574|gb|EDQ07961.1| hypothetical protein RG210_14690 [Phaeobacter gallaeciensis 2.10]
          Length = 239

 Score = 83.0 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 42/178 (23%), Positives = 76/178 (42%), Gaps = 1/178 (0%)

Query: 26  NLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVS 85
             N + R +DS+G + KVRGT Q I ++Y+ LARDA  + D V  EN  QHAEHY R+++
Sbjct: 19  GANVVNRVFDSSGPEGKVRGTPQQIIDKYNQLARDAQLSNDRVATENFQQHAEHYLRMLN 78

Query: 86  MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVED 145
            AQ +I  + +  E+ +   + +++R +    E +        +      +  +    + 
Sbjct: 79  EAQREIDARREEQERQNRERQAERDRERAERLERQEREAGSRSDDPAAAPQPEVMDPRDS 138

Query: 146 VAFKTPDISREKDVSYKKVRRRRPLRPR-VFPNAKSGNQPVEATETIVPQELNSDNAS 202
                   + E           +P +P+   P ++         E     E   D+ +
Sbjct: 139 NGDSGLVETPESRDQAAAEGDSKPQKPQARKPRSRKPKAEGGKAEGGKADESKGDDTA 196


>gi|46202827|ref|ZP_00052536.2| hypothetical protein Magn03006972 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 196

 Score = 83.0 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 53/156 (33%), Positives = 78/156 (50%), Gaps = 4/156 (2%)

Query: 20  GSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEH 79
           G    K  NPL R+Y+SNG DVK+RGTAQHIA++Y+ LARDA+++GD + AEN+ QH EH
Sbjct: 3   GRNRPKGPNPLTRSYESNGPDVKIRGTAQHIADKYAQLARDALASGDPIAAENYFQHGEH 62

Query: 80  YNRIVSMAQ----AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIF 135
           Y RI++ AQ     Q+ +   R+  D+    + +          +A+       G+E   
Sbjct: 63  YFRIITSAQEPGRPQVTQGYARNGFDEDEDGDDEGVQWPGAPATKAAARGYGYGGEEYDP 122

Query: 136 ENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLR 171
               QP            +   D + +   R R  R
Sbjct: 123 AQQPQPFERHDFDNRQQRNDRNDRNQRFQGRDRNDR 158


>gi|254293184|ref|YP_003059207.1| hypothetical protein Hbal_0816 [Hirschia baltica ATCC 49814]
 gi|254041715|gb|ACT58510.1| conserved hypothetical protein [Hirschia baltica ATCC 49814]
          Length = 180

 Score = 83.0 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 43/108 (39%), Positives = 58/108 (53%), Gaps = 9/108 (8%)

Query: 7   YKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGD 66
            KR RGRG         RK  N   R+ +SNG +VK+RG+A  I E+Y   ARDA +AGD
Sbjct: 1   MKRQRGRG---------RKPNNSGNRSLESNGPEVKIRGSASQIYEKYVQYARDAQTAGD 51

Query: 67  YVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQN 114
            V AEN  QHAEHY RI+     + + + Q +  D     + +E  + 
Sbjct: 52  RVKAENLFQHAEHYYRIMQANMPKDRPQHQNNRDDAEQSSDAEETTEA 99


>gi|329847924|ref|ZP_08262952.1| hypothetical protein ABI_09930 [Asticcacaulis biprosthecum C19]
 gi|328842987|gb|EGF92556.1| hypothetical protein ABI_09930 [Asticcacaulis biprosthecum C19]
          Length = 377

 Score = 82.7 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 44/90 (48%), Positives = 54/90 (60%), Gaps = 6/90 (6%)

Query: 1  MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDV-KVRGTAQHIAERYSVLAR 59
          M+  +  KR R R     +G     N N   R Y+SNG +  KVRG AQ I E+Y  LAR
Sbjct: 1  MKDFRGMKRQRNRNRKPSSG-----NQNNPNRAYESNGPEGTKVRGNAQTIYEKYQQLAR 55

Query: 60 DAMSAGDYVVAENHLQHAEHYNRIVSMAQA 89
          DA S+GD V+AENHLQHAEHY R++   Q 
Sbjct: 56 DANSSGDRVLAENHLQHAEHYFRMIRQMQP 85


>gi|114704327|ref|ZP_01437235.1| hypothetical protein FP2506_05321 [Fulvimarina pelagi HTCC2506]
 gi|114539112|gb|EAU42232.1| hypothetical protein FP2506_05321 [Fulvimarina pelagi HTCC2506]
          Length = 296

 Score = 81.9 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 42/65 (64%), Positives = 52/65 (80%)

Query: 20 GSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEH 79
              RK  NPL R+Y+SNG DVK+RG AQHIA++Y+ LARDA ++GD VVAEN+LQHAEH
Sbjct: 2  RGRGRKGPNPLSRSYESNGPDVKIRGNAQHIADKYAQLARDASASGDRVVAENYLQHAEH 61

Query: 80 YNRIV 84
          Y RI+
Sbjct: 62 YYRII 66


>gi|294678210|ref|YP_003578825.1| hypothetical protein RCAP_rcc02688 [Rhodobacter capsulatus SB 1003]
 gi|294477030|gb|ADE86418.1| conserved hypothetical protein [Rhodobacter capsulatus SB 1003]
          Length = 252

 Score = 81.9 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 33/77 (42%), Positives = 46/77 (59%)

Query: 24  RKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRI 83
           R   N + R +DS+G + KVRGT Q I E+Y  LARDA    D V  +N LQHAEHY R+
Sbjct: 16  RSIGNIINRVFDSSGPEGKVRGTPQQIIEKYLALARDAQLGNDRVAEQNFLQHAEHYTRM 75

Query: 84  VSMAQAQIQEKLQRDEQ 100
           +  AQ ++  + +   +
Sbjct: 76  LGEAQRELAREQEERSR 92


>gi|114766147|ref|ZP_01445151.1| hypothetical protein 1100011001352_R2601_24315 [Pelagibaca
           bermudensis HTCC2601]
 gi|114541607|gb|EAU44649.1| hypothetical protein R2601_24315 [Roseovarius sp. HTCC2601]
          Length = 238

 Score = 81.5 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 45/167 (26%), Positives = 73/167 (43%), Gaps = 7/167 (4%)

Query: 27  LNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSM 86
            N + R +DSNG + KVRGT Q I ++Y+ LARDA    D V AEN  QHAEHY R++S 
Sbjct: 20  GNVVNRVFDSNGPEGKVRGTPQQIIDKYNQLARDAALGNDRVAAENFQQHAEHYLRMLSE 79

Query: 87  AQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGK-------EPIFENSI 139
           AQ ++  K ++ E+++   + Q+++ +      +++     +  +               
Sbjct: 80  AQREVDAKREQQERENRERQAQRDKERAERDAQKSAEREDRDSNQGQSDGGNGNGNGEQP 139

Query: 140 QPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVE 186
           QP         P  + + DV          L       +     P E
Sbjct: 140 QPAPRAEQRSEPKPAAQDDVIDTSEGTESGLVETPENRSAPSPAPTE 186


>gi|163746455|ref|ZP_02153813.1| hypothetical protein OIHEL45_13660 [Oceanibulbus indolifex HEL-45]
 gi|161380340|gb|EDQ04751.1| hypothetical protein OIHEL45_13660 [Oceanibulbus indolifex HEL-45]
          Length = 205

 Score = 81.5 bits (199), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 55/205 (26%), Positives = 89/205 (43%), Gaps = 4/205 (1%)

Query: 5   QQYKRSRGRGSNGGNGS-FNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMS 63
               RSR R  N    S       N + R +DS+G + KVRGT Q + E+Y+ LARDA  
Sbjct: 1   MNSPRSRSRSKNNRKRSPHGGGGGNVVNRVFDSSGPEGKVRGTPQQVIEKYNQLARDAQL 60

Query: 64  AGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASP 123
           + D V AEN  QHAEHY R++S AQ ++ ++ +  E+ +   + +++R +    E EA  
Sbjct: 61  SNDRVAAENFQQHAEHYLRLLSEAQREVDQRREEQERQNRERQAERDRERAERQEREAQQ 120

Query: 124 CPLIEEGKEPIFENSIQ---PKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKS 180
               +  +    +       P+ +    +  +     D S          +P+  P  K 
Sbjct: 121 GGQPQGDEPQAEQQPAHGNAPEQQQPQQQPTEAETNSDESTLVETPESKPKPKRAPRRKP 180

Query: 181 GNQPVEATETIVPQELNSDNASSVD 205
             +  EA       + N D A   +
Sbjct: 181 KPKAAEAQPQDNGSDGNGDTAKVAE 205


>gi|126725346|ref|ZP_01741188.1| hypothetical protein RB2150_04058 [Rhodobacterales bacterium
           HTCC2150]
 gi|126704550|gb|EBA03641.1| hypothetical protein RB2150_04058 [Rhodobacterales bacterium
           HTCC2150]
          Length = 186

 Score = 81.5 bits (199), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 45/164 (27%), Positives = 70/164 (42%), Gaps = 21/164 (12%)

Query: 34  YDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQE 93
           +DS+G + KVRGT Q I E+Y+ LARDA  A D V  EN  QHAEHY R++  A  + + 
Sbjct: 2   FDSSGPEGKVRGTPQQIIEKYTQLARDAQLAHDRVATENFQQHAEHYTRLLGKAVREQEA 61

Query: 94  KLQRDEQDDLLVKEQKERAQNALSEFEA-------------------SPCPLIEEGKEPI 134
           + ++ E      ++ +E  +   ++ ++                    P    E    P+
Sbjct: 62  RREQQEAQHRERQQNREDNRAQHNQNKSDDAASAGSDQPQPNPQPQHKPRENHEAQPNPV 121

Query: 135 -FENSIQPKVEDVAFKTPDISREKDVSYKKVRRRR-PLRPRVFP 176
               + QP V  +  +      E   S    +  R P  PR  P
Sbjct: 122 AAAGAEQPDVMGLGDQPDLGLVETPESKPARKPARKPRAPRKKP 165


>gi|83942388|ref|ZP_00954849.1| hypothetical protein EE36_15147 [Sulfitobacter sp. EE-36]
 gi|83846481|gb|EAP84357.1| hypothetical protein EE36_15147 [Sulfitobacter sp. EE-36]
          Length = 227

 Score = 81.1 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 54/177 (30%), Positives = 85/177 (48%), Gaps = 10/177 (5%)

Query: 25  KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
           +  N + R +DS+G + KVRGT Q I E+Y+ LARDA  + D V AEN  QHAEHY R++
Sbjct: 19  QGGNVVNRVFDSSGPEGKVRGTPQQIIEKYNQLARDAQLSNDRVAAENFQQHAEHYLRML 78

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
           S AQ +I ++  + E+++   + +++R +    E EA+         +     + QP  E
Sbjct: 79  SEAQREIDQRRDQQERENRERQAERDRERVERQEREAA---------QAGQNTADQPAAE 129

Query: 145 DVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNA-KSGNQPVEATETIVPQELNSDN 200
                  D  ++ +      +RRR        NA KS + P    +         DN
Sbjct: 130 ADTGDKSDAPQQDNAKGDAPKRRRSRSNNQNDNAPKSDSAPKSDGDDTQDGSAAEDN 186


>gi|294085500|ref|YP_003552260.1| hypothetical protein SAR116_1933 [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292665075|gb|ADE40176.1| hypothetical protein SAR116_1933 [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 181

 Score = 81.1 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 48/164 (29%), Positives = 68/164 (41%), Gaps = 1/164 (0%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR  Q  KR RGRG  G  G       N    +Y+SNG DVK+RG AQ + E+Y  LA D
Sbjct: 1   MRQPQNAKRGRGRGRRGNGGGGGSHVPN-RNTSYESNGPDVKLRGNAQQLHEKYIALAHD 59

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
           A S+G+ + AE + Q A+HY R+   A    + K Q+++   +   E  E    A++   
Sbjct: 60  ASSSGERIAAEAYSQFADHYFRLHQAAVGAAETKRQQEQAAQVANGEAAETKPEAVNGDA 119

Query: 121 ASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKV 164
               P      E       +             +   D S    
Sbjct: 120 DKASPADSSAPESDEAEGAKKSSTSQRKPRVKPAETDDTSALSP 163


>gi|83953608|ref|ZP_00962329.1| hypothetical protein NAS141_05273 [Sulfitobacter sp. NAS-14.1]
 gi|83841553|gb|EAP80722.1| hypothetical protein NAS141_05273 [Sulfitobacter sp. NAS-14.1]
          Length = 230

 Score = 80.7 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 48/176 (27%), Positives = 84/176 (47%), Gaps = 5/176 (2%)

Query: 25  KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
           +  N + R +DS+G + KVRGT Q I E+Y+ LARDA  + D V AEN  QHAEHY R++
Sbjct: 19  QGGNVVNRVFDSSGPEGKVRGTPQQIIEKYNQLARDAQLSNDRVAAENFQQHAEHYLRML 78

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
           S AQ +I ++  + E+++   + +++R +    E EA+       G+    + + +    
Sbjct: 79  SEAQREIDQRRDQQERENRERQAERDRERVERQEREAAQA-----GQNTADQPAAETDTG 133

Query: 145 DVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDN 200
           + +      + + D   ++  R      +     KS + P    +         DN
Sbjct: 134 EKSDAPQQDNTKGDAPKRRRSRSNNNNNQNDNAPKSDSAPKSDGDDAQDGSAAEDN 189


>gi|146277162|ref|YP_001167321.1| hypothetical protein Rsph17025_1115 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145555403|gb|ABP70016.1| hypothetical protein Rsph17025_1115 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 249

 Score = 80.7 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 45/196 (22%), Positives = 69/196 (35%), Gaps = 23/196 (11%)

Query: 27  LNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSM 86
            N + R +DS+G + KVRGT   I E+Y  LARDA  + D V AEN LQHAEHY R++  
Sbjct: 19  GNIVNRVFDSSGPEGKVRGTPAQIIEKYLFLARDAQLSNDRVAAENFLQHAEHYTRLLGE 78

Query: 87  AQAQIQEKLQRDEQD--------DLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENS 138
           AQ ++  + +    +            + Q+   ++     E       +   E      
Sbjct: 79  AQRELAAEQENRRSEHQQSQTNQGQGGQPQQGNHRHDRPRDERRDDRQDQPRPEREPRPE 138

Query: 139 IQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVF---------------PNAKSGNQ 183
            QP+ +         +        +        P                  P A     
Sbjct: 139 AQPQPQPAEAPASSHAVIDLSENAEEETGLVETPEARPRHRPAPRRRSEPSDPPAPQAES 198

Query: 184 PVEATETIVPQELNSD 199
           P E      P   N++
Sbjct: 199 PSEPAAEKTPDASNTE 214


>gi|83592091|ref|YP_425843.1| hypothetical protein Rru_A0752 [Rhodospirillum rubrum ATCC 11170]
 gi|83575005|gb|ABC21556.1| hypothetical protein Rru_A0752 [Rhodospirillum rubrum ATCC 11170]
          Length = 315

 Score = 80.4 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 50/190 (26%), Positives = 81/190 (42%), Gaps = 13/190 (6%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           M++     R RGR  NG       K      + +DSNG  V+VRG AQ + E+Y  +ARD
Sbjct: 13  MKNANSRGRPRGRSMNG-------KRPPNRNQVFDSNGPGVRVRGNAQQLVEKYLAMARD 65

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
           A S GD ++AEN  QHA+HY R+++    +       ++       E      +     +
Sbjct: 66  ASSQGDRILAENCHQHADHYQRVLNALTGRYIRPEDPNQGGAYGEDEDFGDDDDFRGPRD 125

Query: 121 ASPCPLIEEGKEPIFENSI-QPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAK 179
             P     + ++P + +   +P+ E    + P  +RE     +    R P   R     +
Sbjct: 126 YQP-----DYQQPDYRSDYREPRAEAREPREPRETREPREPREIREPREPRDNRDTREPR 180

Query: 180 SGNQPVEATE 189
              +P E  E
Sbjct: 181 EIREPREPRE 190


>gi|254465567|ref|ZP_05078978.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
 gi|206686475|gb|EDZ46957.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
          Length = 202

 Score = 80.0 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 43/112 (38%), Positives = 61/112 (54%), Gaps = 2/112 (1%)

Query: 34  YDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQE 93
           +DS+G + KVRGT Q I ++Y+ LARDA  + D V AEN  QHAEHY R+++ AQ +I  
Sbjct: 2   FDSSGPEGKVRGTPQQIIDKYNQLARDAQLSNDRVAAENFQQHAEHYLRMLNEAQREIDA 61

Query: 94  KLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVED 145
           +  R+EQ+    + Q ER +      E                +S QP+V D
Sbjct: 62  R--REEQERQNRERQAERDRERAERLERQERESASAVPASDLADSPQPEVID 111


>gi|170742859|ref|YP_001771514.1| hypothetical protein M446_4750 [Methylobacterium sp. 4-46]
 gi|168197133|gb|ACA19080.1| conserved hypothetical protein [Methylobacterium sp. 4-46]
          Length = 347

 Score = 80.0 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 44/86 (51%), Positives = 58/86 (67%)

Query: 10 SRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVV 69
           R   +    G    K  NPL R Y+SNG DVK+RGTAQHIAE+Y+ LARDA + GD V+
Sbjct: 1  MRPNQNRRMRGRNRNKGPNPLTRAYESNGPDVKIRGTAQHIAEKYAQLARDAQANGDPVM 60

Query: 70 AENHLQHAEHYNRIVSMAQAQIQEKL 95
          AEN+ QH EHY+RI++ A  Q +++ 
Sbjct: 61 AENYFQHGEHYHRIIAAANEQYRQQF 86


>gi|126728793|ref|ZP_01744608.1| hypothetical protein SSE37_08198 [Sagittula stellata E-37]
 gi|126710723|gb|EBA09774.1| hypothetical protein SSE37_08198 [Sagittula stellata E-37]
          Length = 258

 Score = 78.8 bits (192), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 37/94 (39%), Positives = 60/94 (63%)

Query: 27  LNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSM 86
            N + R +DSNG + KVRGT Q I ++Y+ LARDA  A D V  EN  QHAEHY R++S 
Sbjct: 21  GNVVNRVFDSNGPEGKVRGTPQQIIDKYNQLARDAGLANDRVNMENFQQHAEHYMRMLSE 80

Query: 87  AQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
           AQ +  ++ ++ E+++   + Q++R ++   + +
Sbjct: 81  AQREQDQRREQQEKENRERQAQRDRDRSQRGDDQ 114


>gi|170746589|ref|YP_001752849.1| hypothetical protein Mrad2831_0139 [Methylobacterium
          radiotolerans JCM 2831]
 gi|170653111|gb|ACB22166.1| conserved hypothetical protein [Methylobacterium radiotolerans
          JCM 2831]
          Length = 350

 Score = 78.0 bits (190), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 46/71 (64%), Positives = 55/71 (77%)

Query: 20 GSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEH 79
          G    K  NPL R+Y+SNG DVK+RGTAQHIA++Y+ LARDA++AGD V AEN+ QH EH
Sbjct: 3  GRNRPKGPNPLTRSYESNGPDVKIRGTAQHIADKYAQLARDALAAGDPVAAENYFQHGEH 62

Query: 80 YNRIVSMAQAQ 90
          Y RIVS AQ Q
Sbjct: 63 YFRIVSGAQDQ 73


>gi|163739711|ref|ZP_02147119.1| hypothetical protein RGBS107_17033 [Phaeobacter gallaeciensis
           BS107]
 gi|161386941|gb|EDQ11302.1| hypothetical protein RGBS107_17033 [Phaeobacter gallaeciensis
           BS107]
          Length = 214

 Score = 78.0 bits (190), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 40/170 (23%), Positives = 73/170 (42%), Gaps = 1/170 (0%)

Query: 34  YDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQE 93
           +DS+G + KVRGT Q I ++Y+ LARDA  + D V  EN  QHAEHY R+++ AQ +I  
Sbjct: 2   FDSSGPEGKVRGTPQQIIDKYNQLARDAQLSNDRVATENFQQHAEHYLRMLNEAQREIDA 61

Query: 94  KLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDI 153
           + +  E+ +   + +++R +    E +        +      +  +    +         
Sbjct: 62  RREEQERQNRERQAERDRERAERLERQEREAGSRSDDPAAAPQPEVMDPRDSNGDSGLVE 121

Query: 154 SREKDVSYKKVRRRRPLRPR-VFPNAKSGNQPVEATETIVPQELNSDNAS 202
           + E           +P +P+   P ++         E     E   D+ +
Sbjct: 122 TPESRDQAAAEGDSKPQKPQARKPRSRKPKAEGGKAEGGKADESKGDDTA 171


>gi|84686942|ref|ZP_01014826.1| hypothetical protein 1099457000247_RB2654_04289 [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84665139|gb|EAQ11619.1| hypothetical protein RB2654_04289 [Rhodobacterales bacterium
           HTCC2654]
          Length = 215

 Score = 77.7 bits (189), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 48/202 (23%), Positives = 84/202 (41%), Gaps = 26/202 (12%)

Query: 12  GRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAE 71
            +  + G  + NR   N + R +DS+G + KVRGT Q I ++Y+ L+RDA    D V  E
Sbjct: 4   SKSRSRGKNNRNRSPSNNINRVFDSSGPEGKVRGTPQQIIDKYTQLSRDAFLGNDRVAGE 63

Query: 72  NHLQHAEHYNRIVSMAQAQIQEKL------------------------QRDEQDDLLVKE 107
           N  QHAEHY R++S AQ   + K                              ++     
Sbjct: 64  NFQQHAEHYARLLSEAQKDAEAKRQQNQPQQGGNSGGNGQNDNQSNGNNDGNGNNQRKNR 123

Query: 108 QKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRR 167
             +R +   +   ++         +P    + Q   ++   +TP+ +++ D ++   + +
Sbjct: 124 DAQRREEKQNRDRSNDNYDPGSSPQPDVIETAQDD-DNGLVETPENAQKADDTHA-EKPK 181

Query: 168 RPLRPRVFPNAKSGNQPVEATE 189
           +P  PR     K      EAT+
Sbjct: 182 KPRAPRKPRAKKPEGDMAEATQ 203


>gi|144897747|emb|CAM74611.1| conserved hypothetical protein [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 194

 Score = 77.7 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 45/74 (60%)

Query: 25  KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
           +N+N   + +DSNG + ++RG A  + E+Y  LARDA S GD   AEN  QHAEHY R++
Sbjct: 48  RNINVRSQVFDSNGPEGRIRGNAHQVMEKYLGLARDAASQGDRHAAENFYQHAEHYFRLI 107

Query: 85  SMAQAQIQEKLQRD 98
           +       ++  ++
Sbjct: 108 NAYNQNNGQRRPQN 121


>gi|328542099|ref|YP_004302208.1| Retinitis pigmentosa 1-like 1 protein [polymorphum gilvum
           SL003B-26A1]
 gi|326411849|gb|ADZ68912.1| Retinitis pigmentosa 1-like 1 protein [Polymorphum gilvum
           SL003B-26A1]
          Length = 246

 Score = 77.3 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 48/159 (30%), Positives = 74/159 (46%), Gaps = 13/159 (8%)

Query: 41  VKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQ 100
           +K+RGTA HIAE+Y  LARDA ++GD V++EN+ QHAEHY RIV+ AQ  +         
Sbjct: 1   MKIRGTALHIAEKYQQLARDAQASGDRVMSENYFQHAEHYYRIVAAAQPNLPAGSPGLRF 60

Query: 101 DDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVS 160
           D+   ++  E A    SE    P            E + +P+ +D   +     R     
Sbjct: 61  DNGQDEDDLELATPERSERSDRPERS---------ERTDRPERQDRRDRPERSER----P 107

Query: 161 YKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSD 199
            +  R  R  RP    +  + + P    + +   +LN +
Sbjct: 108 ERTERPERLERPARHADLVTTDSPQPFIDHMPGIDLNGN 146


>gi|304321741|ref|YP_003855384.1| hypothetical protein PB2503_10974 [Parvularcula bermudensis
           HTCC2503]
 gi|303300643|gb|ADM10242.1| hypothetical protein PB2503_10974 [Parvularcula bermudensis
           HTCC2503]
          Length = 199

 Score = 76.9 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 50/192 (26%), Positives = 80/192 (41%), Gaps = 1/192 (0%)

Query: 14  GSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENH 73
              G N +  R+  N   R++DS G +VK+RGTA  I ++Y  LARDA S+GD + AE+ 
Sbjct: 5   SKRGRNSNRRRQGGNNPNRSFDSTGPEVKIRGTATQIYDKYQALARDAASSGDRIRAESL 64

Query: 74  LQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKE-QKERAQNALSEFEASPCPLIEEGKE 132
           LQHAEHY R++   Q   ++  +  +       + Q   +Q           P  ++ + 
Sbjct: 65  LQHAEHYFRMMKAMQTASEKAEENRQASQGDRNDPQGHDSQGHDDSQTEDEAPTEKKSRR 124

Query: 133 PIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIV 192
              + +      D   +T   S     +     +  P   R  P  +  +      ET  
Sbjct: 125 KESDETSNKDDRDQEGETAAESDSGTDTTTNGDQEDPAPRRRRPRRRRQSDEANGDETPP 184

Query: 193 PQELNSDNASSV 204
             +   DN  SV
Sbjct: 185 KADETQDNDESV 196


>gi|254500180|ref|ZP_05112331.1| hypothetical protein SADFL11_216 [Labrenzia alexandrii DFL-11]
 gi|222436251|gb|EEE42930.1| hypothetical protein SADFL11_216 [Labrenzia alexandrii DFL-11]
          Length = 200

 Score = 76.5 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 47/173 (27%), Positives = 76/173 (43%), Gaps = 12/173 (6%)

Query: 41  VKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQ 100
           +K+RGTA H+AE+Y  LARDA ++GD V++EN+ QHAEHY RIV+ AQ   Q        
Sbjct: 1   MKIRGTAMHVAEKYQQLARDAQASGDRVMSENYNQHAEHYLRIVAAAQPPQQNTQHTARN 60

Query: 101 DDLLVKEQKERAQNALSEFEASPCP-------LIEEGKEPIFENSIQPKVEDVAFKTPDI 153
           +    ++Q     +  S+    P         +  +  +P  +N      E         
Sbjct: 61  EADDNQDQAAVNGSGGSQGSDQPSKPTADNTVVDGDAPQPFIDNMPVIDQEGQVNGAAQS 120

Query: 154 SREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQ 206
           S E   + +K RR+        P A+S  +      +    +  +D   + D+
Sbjct: 121 SDESGEAEEKPRRKT-----RTPRARSPRKAASEAGSESEAQAGADGPEAADE 168


>gi|56552407|ref|YP_163246.1| hypothetical protein ZMO1511 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241761551|ref|ZP_04759638.1| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|260753916|ref|YP_003226809.1| hypothetical protein Za10_1691 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|56543981|gb|AAV90135.1| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|241373859|gb|EER63392.1| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|258553279|gb|ACV76225.1| hypothetical protein Za10_1691 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 357

 Score = 76.5 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/89 (30%), Positives = 41/89 (46%)

Query: 36  SNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKL 95
           +N  D + RG A  + E+Y  LARD    GD V+ E +LQ A+HY RI++  + + +E  
Sbjct: 45  NNRIDNRARGNASQLHEKYKALARDMQLQGDRVMTEYYLQFADHYFRILNDNRLRYEEAR 104

Query: 96  QRDEQDDLLVKEQKERAQNALSEFEASPC 124
            RD          ++   N  S       
Sbjct: 105 MRDRNLSQEGDNNEQIIDNRSSMDSRQNA 133


>gi|297180643|gb|ADI16853.1| hypothetical protein [uncultured alpha proteobacterium
           HF0010_13E22]
          Length = 155

 Score = 76.5 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 42/142 (29%), Positives = 64/142 (45%), Gaps = 22/142 (15%)

Query: 24  RKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRI 83
           + N+     +Y+SNG DVK+RG AQ + E+Y  LA D+ +AG+ + AE + Q A+HY R+
Sbjct: 22  QPNVPNRNTSYESNGPDVKLRGNAQQLNEKYLALAHDSAAAGERITAEAYTQFADHYFRL 81

Query: 84  VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPK- 142
              A    +E+  +                        +P P IEE  +P      QP  
Sbjct: 82  HQAAVDAAEERRAQ---------------HAERQSRAEAPQPSIEEEAKP------QPDT 120

Query: 143 VEDVAFKTPDISREKDVSYKKV 164
             D A +  D +   D+S  K 
Sbjct: 121 PGDSAAEKADGAEVVDLSPAKP 142


>gi|254487948|ref|ZP_05101153.1| conserved hypothetical protein [Roseobacter sp. GAI101]
 gi|214044817|gb|EEB85455.1| conserved hypothetical protein [Roseobacter sp. GAI101]
          Length = 237

 Score = 76.1 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 49/181 (27%), Positives = 78/181 (43%), Gaps = 2/181 (1%)

Query: 25  KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
           +  N + R +DS+G + KVRGT Q + E+Y+ LARDA  + D V AEN  QHAEHY R++
Sbjct: 19  QGGNVVNRVFDSSGPEGKVRGTPQQVIEKYNQLARDAQLSNDRVAAENFQQHAEHYLRML 78

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQP--K 142
           S AQ +I ++ +  E+     +E++ER                +E +        Q    
Sbjct: 79  SEAQREIDQRREEQERQQRERQEEQERQNRERQAERDRERAERQEREAANAGQGNQQGHD 138

Query: 143 VEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
             D          + D    +  + +  R R  P   +G     + E+   +    D   
Sbjct: 139 ESDQPVNAQPSDAQPDAPKDQAEQPKRRRSRSKPAEDAGQSESTSDESSAEESNLVDTPE 198

Query: 203 S 203
           S
Sbjct: 199 S 199


>gi|163793917|ref|ZP_02187891.1| hypothetical protein BAL199_12831 [alpha proteobacterium BAL199]
 gi|159181028|gb|EDP65545.1| hypothetical protein BAL199_12831 [alpha proteobacterium BAL199]
          Length = 369

 Score = 76.1 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 44/106 (41%), Positives = 63/106 (59%), Gaps = 7/106 (6%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR     KR RGRG++  + + NR       + +DSNG DV++RG A  + E+Y  LARD
Sbjct: 1   MRQGPHQKRGRGRGNHRRSNTPNR------NQTFDSNGPDVRIRGNATQVHEKYLNLARD 54

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVK 106
           A ++GD V+AE++ QHAEHY RI+S+ Q   Q    R +Q +    
Sbjct: 55  AAASGDRVLAESYFQHAEHYYRILSVFQDA-QGGENRGQQPNQNGG 99


>gi|87198311|ref|YP_495568.1| hypothetical protein Saro_0286 [Novosphingobium aromaticivorans DSM
           12444]
 gi|87133992|gb|ABD24734.1| conserved hypothetical protein [Novosphingobium aromaticivorans DSM
           12444]
          Length = 340

 Score = 75.7 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 29/117 (24%), Positives = 46/117 (39%)

Query: 37  NGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQ 96
           N  D + RG A  + E+Y  LA+DA   GD V AE +LQ A+HY R+++  + + +E+  
Sbjct: 62  NRIDSRARGNAPQLLEKYRKLAQDAHLNGDRVQAEYYLQFADHYFRVIADTRVRQEEQRA 121

Query: 97  RDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDI 153
           R    +    +  E      S     P            E     +  D      + 
Sbjct: 122 RQSGGERWQDQDVEDDGADFSVEGDFPAFDRPVSHRHDREQREDRQPRDDRQDRGEG 178


>gi|158426118|ref|YP_001527410.1| hypothetical protein AZC_4494 [Azorhizobium caulinodans ORS 571]
 gi|158333007|dbj|BAF90492.1| hypothetical protein [Azorhizobium caulinodans ORS 571]
          Length = 375

 Score = 73.8 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 60/202 (29%), Positives = 85/202 (42%), Gaps = 26/202 (12%)

Query: 14  GSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENH 73
           G        NR++ NP+ R Y+SNG DVKVRGTA HIAE+Y  LARDA S+GD+V AEN+
Sbjct: 4   GQQKRMRGRNRRSSNPMTRVYESNGPDVKVRGTAHHIAEKYLQLARDAQSSGDHVAAENY 63

Query: 74  LQHAEHYNRIVSMAQAQIQEK--------------------LQRDEQDDLLVKEQKERAQ 113
            QHAEHY R+++  Q Q  +                      Q   Q      + ++R Q
Sbjct: 64  YQHAEHYQRLIASLQGQFGQPGFGREDEMDDEDMDEAGFDGPQPGYQPREQNYQGRDREQ 123

Query: 114 NALSEFEASPCPLIEEGKEP------IFENSIQPKVEDVAFKTPDISREKDVSYKKVRRR 167
           N        P    + G +P        E + QP+         +   +   + +    R
Sbjct: 124 NYQPRENRQPRDNRQNGNQPRRNRDEDGEGNYQPREFRSRRDDNEGGYQPRENRQPREPR 183

Query: 168 RPLRPRVFPNAKSGNQPVEATE 189
           +P         +    P E  E
Sbjct: 184 QPREEGEGHYGRQPRMPREEGE 205


>gi|297183694|gb|ADI19819.1| hypothetical protein [uncultured alpha proteobacterium EB000_37G09]
          Length = 179

 Score = 73.8 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 39/168 (23%), Positives = 74/168 (44%), Gaps = 1/168 (0%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MR  Q   + R RG     G + + N+N     ++SNG + ++RG AQ + E+Y+ LA D
Sbjct: 1   MRQNQAQNQKRSRGRGRRTGGYGQTNIN-RNTTFESNGPEGRLRGNAQQLYEKYTALAND 59

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
           A +AG+ + AE   Q A+HY RI        +++ +  ++     +     A++A  +  
Sbjct: 60  ANTAGERISAEACSQFADHYYRINQTIVMAAEQQRRTQDEQRASRRPVHASAEDASDDSS 119

Query: 121 ASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRR 168
           A   P  +E       +      + V+ + P   +       + +  +
Sbjct: 120 AGYSPAPDEQSSEASSSDEPSSNKMVSNEKPSGEKPPRKVAARTKPAK 167


>gi|40062643|gb|AAR37564.1| conserved domain protein [uncultured marine bacterium 313]
          Length = 129

 Score = 73.0 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 39/131 (29%), Positives = 61/131 (46%), Gaps = 8/131 (6%)

Query: 2   RSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDA 61
           R  +     R R S+       R   N    +   N    K   +A+ + E+YS LA++A
Sbjct: 7   RRFRHRSNGRKRQSHDNGDMQMRLRSNSFSNSQTRN--HFKTPLSAEKLFEKYSTLAKEA 64

Query: 62  MSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEA 121
           +S+GD  ++EN+ QHA+H+ RI+      I +K  + + DD LV   K   +N+      
Sbjct: 65  LSSGDKTLSENYFQHADHFMRIIQD--KDINQKQNKVQVDDKLVVRDKHLPENS----GV 118

Query: 122 SPCPLIEEGKE 132
                IEE KE
Sbjct: 119 GQNKTIEEKKE 129


>gi|163850386|ref|YP_001638429.1| hypothetical protein Mext_0953 [Methylobacterium extorquens PA1]
 gi|163661991|gb|ABY29358.1| conserved hypothetical protein [Methylobacterium extorquens PA1]
          Length = 437

 Score = 73.0 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 49/174 (28%), Positives = 83/174 (47%)

Query: 10  SRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVV 69
            R   +    G    K  NPL R+Y+SNG DVK+RGTAQHIA++Y+ LARDA+++GD V 
Sbjct: 1   MRPNQNRRMRGRNRPKGPNPLTRSYESNGPDVKIRGTAQHIADKYAQLARDALASGDPVA 60

Query: 70  AENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEE 129
           AEN+ QH EHY RI++ AQ   + ++ +    +   ++++   +    +        +  
Sbjct: 61  AENYFQHGEHYFRIITGAQEPGRPQVTQGYARNGFDEDEEGDDETVQGQGAEGGRQGLGY 120

Query: 130 GKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQ 183
           G +   + + QP+  +         R          +R   R +        ++
Sbjct: 121 GTDEYGDPTQQPQPFERHDFDGRPQRNDRNDRSDRNQRFQPREQGRDRNDRNDR 174


>gi|188580160|ref|YP_001923605.1| hypothetical protein Mpop_0892 [Methylobacterium populi BJ001]
 gi|179343658|gb|ACB79070.1| conserved hypothetical protein [Methylobacterium populi BJ001]
          Length = 425

 Score = 72.6 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 45/134 (33%), Positives = 73/134 (54%)

Query: 10  SRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVV 69
            R   +    G    K  NPL R+Y+SNG DVK+RGTAQHIA++Y+ LARDA+++GD + 
Sbjct: 1   MRPNQNRRMRGRNRPKGPNPLTRSYESNGPDVKIRGTAQHIADKYAQLARDALASGDPIA 60

Query: 70  AENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEE 129
           AEN+ QH EHY RI++ AQ   + +  +    +   ++++   +    +           
Sbjct: 61  AENYFQHGEHYFRIITGAQEPGRPQASQGYARNGFDEDEEGDDEAVQGQGGEGGRQGFGY 120

Query: 130 GKEPIFENSIQPKV 143
           G +   + + QP+ 
Sbjct: 121 GSDEYGDPAQQPQP 134


>gi|85709575|ref|ZP_01040640.1| hypothetical protein NAP1_11858 [Erythrobacter sp. NAP1]
 gi|85688285|gb|EAQ28289.1| hypothetical protein NAP1_11858 [Erythrobacter sp. NAP1]
          Length = 212

 Score = 71.5 bits (173), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 42/182 (23%), Positives = 79/182 (43%), Gaps = 11/182 (6%)

Query: 37  NGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQ 96
           N  D + RG A  + ++Y  LA+DA   GD V AE +LQ A+HY R+++  +A+  E   
Sbjct: 25  NRIDSRARGNAPQLLDKYKKLAQDAQHNGDRVQAEYYLQFADHYFRVIADNKARQDEARA 84

Query: 97  RDEQ----DDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPD 152
           +  +    D     +  +      +           +G++    +++ P+  +  F+  +
Sbjct: 85  KRNESRGDDRGQANDDSDEEDGNNNRKSNRRSRSRRDGQDQDARDTVSPEEGEKGFEGEE 144

Query: 153 ISREKDVSYKKVRRRRPL------RPRVFPNAKSGNQPVE-ATETIVPQELNSDNASSVD 205
              E++ +  K R R+P       +PR  P  K+     E   ++ V     S + +S D
Sbjct: 145 AGAEEESAKPKRRARKPKSDDAGDKPRRKPRRKADEDTGEGEIDSAVLPPAISASTASDD 204

Query: 206 QD 207
            D
Sbjct: 205 DD 206


>gi|240137462|ref|YP_002961933.1| hypothetical protein MexAM1_META1p0727 [Methylobacterium extorquens
           AM1]
 gi|240007430|gb|ACS38656.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
          Length = 426

 Score = 71.1 bits (172), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 48/164 (29%), Positives = 81/164 (49%)

Query: 20  GSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEH 79
           G    K  NPL R+Y+SNG DVK+RGTAQHIA++Y+ LARDA+++GD V AEN+ QH EH
Sbjct: 3   GRNRPKGPNPLTRSYESNGPDVKIRGTAQHIADKYAQLARDALASGDPVAAENYFQHGEH 62

Query: 80  YNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSI 139
           Y RI++ AQ   + ++ +    +   ++++   +    +        +  G +   + + 
Sbjct: 63  YFRIITGAQEPGRPQVTQGYARNGFDEDEEGDDETVQGQGAEGGRQGLGYGTDEYGDPTQ 122

Query: 140 QPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQ 183
           QP+  +         R          +R   R +        ++
Sbjct: 123 QPQPFERHDFDGRPQRNDRNDRSDRNQRFQPREQGRDRNDRNDR 166


>gi|254559640|ref|YP_003066735.1| hypothetical protein METDI1099 [Methylobacterium extorquens DM4]
 gi|254266918|emb|CAX22717.1| conserved hypothetical protein [Methylobacterium extorquens DM4]
          Length = 429

 Score = 71.1 bits (172), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 48/164 (29%), Positives = 81/164 (49%)

Query: 20  GSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEH 79
           G    K  NPL R+Y+SNG DVK+RGTAQHIA++Y+ LARDA+++GD V AEN+ QH EH
Sbjct: 3   GRNRPKGPNPLTRSYESNGPDVKIRGTAQHIADKYAQLARDALASGDPVAAENYFQHGEH 62

Query: 80  YNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSI 139
           Y RI++ AQ   + ++ +    +   ++++   +    +        +  G +   + + 
Sbjct: 63  YFRIITGAQEPGRPQVTQGYARNGFDEDEEGDDETVQGQGAEGGRQGLGYGTDEYGDPTQ 122

Query: 140 QPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQ 183
           QP+  +         R          +R   R +        ++
Sbjct: 123 QPQPFERHDFDGRPQRNDRNDRSDRNQRFQPREQGRDRNDRNDR 166


>gi|114797461|ref|YP_759359.1| hypothetical protein HNE_0630 [Hyphomonas neptunium ATCC 15444]
 gi|114737635|gb|ABI75760.1| conserved domain protein [Hyphomonas neptunium ATCC 15444]
          Length = 259

 Score = 71.1 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 41/143 (28%), Positives = 66/143 (46%), Gaps = 6/143 (4%)

Query: 24  RKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRI 83
           +   N   R+Y+S G DVK+RG+AQ + E+Y   ARDA ++GD +++E + Q AEHY RI
Sbjct: 16  QNAFNNPNRHYESVGPDVKIRGSAQQVLEKYLQYARDAQTSGDRILSEAYFQFAEHYQRI 75

Query: 84  VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV 143
           V+      ++   R +Q     + Q+ R                  G +P      Q + 
Sbjct: 76  VA------KQTEARVQQPQQNQQNQQNRGDRRDDRDNRPNGDRDYRGNQPSDGADNQDED 129

Query: 144 EDVAFKTPDISREKDVSYKKVRR 166
              A  T  + R  D + +  +R
Sbjct: 130 AGEAVVTSTVPRHDDENQRDTQR 152


>gi|218528946|ref|YP_002419762.1| hypothetical protein Mchl_0916 [Methylobacterium chloromethanicum
           CM4]
 gi|218521249|gb|ACK81834.1| conserved hypothetical protein [Methylobacterium chloromethanicum
           CM4]
          Length = 431

 Score = 71.1 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 48/164 (29%), Positives = 79/164 (48%)

Query: 20  GSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEH 79
           G    K  NPL R+Y+SNG DVK+RGTAQHIA++Y+ LARDA+++GD V AEN+ QH EH
Sbjct: 3   GRNRPKGPNPLTRSYESNGPDVKIRGTAQHIADKYAQLARDALASGDPVAAENYFQHGEH 62

Query: 80  YNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSI 139
           Y RI++ AQ   + ++ +    +   ++++   +             +  G +   + + 
Sbjct: 63  YFRIITGAQEPGRPQVTQGYARNGFDEDEEGDDETVQGPGAEGGRQGLGYGTDEYGDPTQ 122

Query: 140 QPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQ 183
           QP+  +         R       +  + R            G +
Sbjct: 123 QPQPFERHDFDGRPQRNDRSDRNQRFQPREQGRDRNDRNDRGQR 166


>gi|154246562|ref|YP_001417520.1| hypothetical protein Xaut_2621 [Xanthobacter autotrophicus Py2]
 gi|154160647|gb|ABS67863.1| hypothetical protein Xaut_2621 [Xanthobacter autotrophicus Py2]
          Length = 401

 Score = 70.7 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 64/205 (31%), Positives = 92/205 (44%), Gaps = 11/205 (5%)

Query: 5   QQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSA 64
            +  + + R     N + NR++ NPL R Y+SNG D KVRGTA HIAE+Y  LARDA S+
Sbjct: 1   MRNGQQKQRMRGRNNNNGNRRSSNPLTRVYESNGPDTKVRGTAHHIAEKYQQLARDAQSS 60

Query: 65  GDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPC 124
           GD+V AEN+ QHAEHY R+++  Q Q                ++ +           +P 
Sbjct: 61  GDHVAAENYFQHAEHYLRLIASLQGQFAPPPG------FGRDDEMDDEDTDDVGALDAPQ 114

Query: 125 PLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQP 184
           P    G++P      QP+         D +R+     +  R  R    R   +   G QP
Sbjct: 115 PAFNRGEQP-----YQPREARENRDNRDNNRDNRGDDRGQRDNRQGNYRRNRDDDEGYQP 169

Query: 185 VEATETIVPQELNSDNASSVDQDCK 209
            E  E    +E     A    +D +
Sbjct: 170 REQREAREQREPRDQRAPREQRDFR 194


>gi|297182758|gb|ADI18912.1| hypothetical protein [uncultured SAR11 cluster bacterium
           HF0010_09O16]
          Length = 137

 Score = 69.6 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 58/122 (47%), Gaps = 4/122 (3%)

Query: 2   RSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDA 61
           R     +  R   SNG    FN            S G   +    A  + E+Y+ LAR+A
Sbjct: 10  RRSNFRRNERNFKSNGDRNKFNNSFSTSENFQRKSPG---RNNHNAPKLIEKYNNLAREA 66

Query: 62  MSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKL-QRDEQDDLLVKEQKERAQNALSEFE 120
           +S GD +++EN+ QHA+H+ RI++    Q +     +D ++   V E +E  +N++S  +
Sbjct: 67  LSTGDKILSENYFQHADHFTRILNEKGVQRKMSFKNKDLEEPTDVNENRENKENSISNEK 126

Query: 121 AS 122
             
Sbjct: 127 DG 128


>gi|262277606|ref|ZP_06055399.1| conserved hypothetical protein [alpha proteobacterium HIMB114]
 gi|262224709|gb|EEY75168.1| conserved hypothetical protein [alpha proteobacterium HIMB114]
          Length = 140

 Score = 69.2 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 38/57 (66%), Gaps = 2/57 (3%)

Query: 28 NPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV 84
          N   R++  N   V+  G A  + E+Y+ LA +A+++GD ++AEN+ QHA+H+ R++
Sbjct: 33 NDQGRSF--NHQRVRFNGNASKLFEKYNKLASEALASGDKILAENYFQHADHFARMM 87


>gi|332188228|ref|ZP_08389956.1| hypothetical protein SUS17_3393 [Sphingomonas sp. S17]
 gi|332011727|gb|EGI53804.1| hypothetical protein SUS17_3393 [Sphingomonas sp. S17]
          Length = 271

 Score = 68.8 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 27/116 (23%), Positives = 56/116 (48%)

Query: 30  LVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQA 89
             R  + N  D + RG A  + E+Y  LA +A   GD V  E + Q A+HY R++S +++
Sbjct: 27  PGRPDNGNRIDNRARGNANQLYEKYKNLAAEAQRQGDRVNTEYYWQFADHYFRVLSESRS 86

Query: 90  QIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVED 145
           + +E+ QR ++++    +  +   N   ++     P+    ++   E   + +  +
Sbjct: 87  RFEEQNQRRQREESRDDQYDDGFDNDAEDYGDEGDPIRPGEQQGEAEPRRERQPRE 142


>gi|326386586|ref|ZP_08208208.1| hypothetical protein Y88_2480 [Novosphingobium nitrogenifigens
          DSM 19370]
 gi|326208901|gb|EGD59696.1| hypothetical protein Y88_2480 [Novosphingobium nitrogenifigens
          DSM 19370]
          Length = 309

 Score = 68.4 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 38/62 (61%)

Query: 37 NGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQ 96
          N  D + RG A  + E+Y  LA+DA   GD V AE +LQ A+HY R+++  + + +E+ Q
Sbjct: 26 NRIDSRARGNAPQLLEKYRKLAQDAHLNGDRVQAEYYLQFADHYFRVIADTRLRQEEQRQ 85

Query: 97 RD 98
          R 
Sbjct: 86 RQ 87


>gi|168203424|gb|ACA21559.1| hypothetical protein [Candidatus Pelagibacter ubique]
          Length = 136

 Score = 67.6 bits (163), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 25/114 (21%), Positives = 47/114 (41%), Gaps = 1/114 (0%)

Query: 5   QQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSA 64
           +   R   R     N      +      N+       +    A  + E+Y+ LAR+A+S 
Sbjct: 11  RSNFRRNDRNFKSSNDRSKYASNFKNNDNFQRKIP-GRNNHNASKLIEKYNDLAREALSG 69

Query: 65  GDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSE 118
           GD +++EN+ QHA+H+ R++   +   + K   +E+         E+  N    
Sbjct: 70  GDKILSENYFQHADHFTRVLKEQENFKKNKFSEEEKLTSNQTISDEQTNNDSKN 123


>gi|254456044|ref|ZP_05069473.1| conserved hypothetical protein [Candidatus Pelagibacter sp.
           HTCC7211]
 gi|207083046|gb|EDZ60472.1| conserved hypothetical protein [Candidatus Pelagibacter sp.
           HTCC7211]
          Length = 144

 Score = 67.6 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 43/79 (54%), Gaps = 1/79 (1%)

Query: 31  VRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQ 90
             N+       +    A  + E+Y+ LAR+A S GD +++EN+ QHA+H+ RI++  + Q
Sbjct: 38  NENFKRKAP-GRNNHNASKLIEKYNDLAREASSNGDKILSENYFQHADHFTRILNEQENQ 96

Query: 91  IQEKLQRDEQDDLLVKEQK 109
            + +    + D+  +  ++
Sbjct: 97  RRARFSESKSDESNLDAEE 115


>gi|84516319|ref|ZP_01003679.1| hypothetical protein SKA53_05273 [Loktanella vestfoldensis SKA53]
 gi|84510015|gb|EAQ06472.1| hypothetical protein SKA53_05273 [Loktanella vestfoldensis SKA53]
          Length = 146

 Score = 67.6 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 41/135 (30%), Positives = 64/135 (47%), Gaps = 4/135 (2%)

Query: 43  VRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDD 102
           +RGT Q I E+Y+ L RDA  + D V AEN  QHAEHY R+++ AQ ++ ++  RDE + 
Sbjct: 1   MRGTPQQIIEKYNQLHRDAQLSNDRVNAENFAQHAEHYTRLLAEAQREVDQR--RDELEA 58

Query: 103 LLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK 162
              + Q ER +      +A      ++      E     + +D+  + PD    +    K
Sbjct: 59  QNRERQAERDKERNDRMQAQEQAGNDQPA--AVERPDPRETDDLGAQGPDAGLVETPEEK 116

Query: 163 KVRRRRPLRPRVFPN 177
             +R R  R    P 
Sbjct: 117 PQQRARKPRAPRKPR 131


>gi|297183485|gb|ADI19616.1| hypothetical protein [uncultured SAR11 cluster bacterium
           HF0770_37D02]
          Length = 133

 Score = 66.9 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 28/104 (26%), Positives = 52/104 (50%), Gaps = 4/104 (3%)

Query: 15  SNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHL 74
           S    G   R+  N     +  N  + +   +A+ + E+Y+ LA++AMS+GD  ++EN+ 
Sbjct: 21  SRENGGIQGRQGSNSFSNGHIRN--NYRTAQSAEKLLEKYNALAKEAMSSGDKTLSENYF 78

Query: 75  QHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSE 118
           QHA+H+ RI+        +K  +D+  +      K  A+N  + 
Sbjct: 79  QHADHFMRIIED--KNKNQKEHKDQAIEKSTINDKNFAENKEAN 120


>gi|126739406|ref|ZP_01755099.1| hypothetical protein RSK20926_20855 [Roseobacter sp. SK209-2-6]
 gi|126719506|gb|EBA16215.1| hypothetical protein RSK20926_20855 [Roseobacter sp. SK209-2-6]
          Length = 219

 Score = 66.9 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 40/179 (22%), Positives = 71/179 (39%), Gaps = 23/179 (12%)

Query: 43  VRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDD 102
           +RGT Q I ++Y+ LARDA  + D V  EN  QHAEHY R+++ AQ +I  + +  E+ +
Sbjct: 1   MRGTPQQIIDKYNQLARDAQLSNDRVATENFQQHAEHYLRMLTEAQREIDARREEQERQN 60

Query: 103 LLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQP--------------------- 141
              + +++R +    E +       +       + +  P                     
Sbjct: 61  RERQAERDRERAERLERQEREATAKQAAAAEQPQPAAAPAAAQDPAEAPQPDVIDPRDAG 120

Query: 142 --KVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
                    +TP+  +E + + K    R+P   +  P      +   ATE   P    +
Sbjct: 121 NGDTSSGLVETPESKQEVNPAKKAPAPRKPRARKAPPKPVEAAEATPATEGDTPAASEA 179


>gi|297182951|gb|ADI19099.1| hypothetical protein [uncultured alpha proteobacterium
           HF0070_34A12]
          Length = 155

 Score = 66.5 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 44/142 (30%), Positives = 66/142 (46%), Gaps = 22/142 (15%)

Query: 24  RKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRI 83
           + N+     +Y+SNG DVK+RG AQ + E+Y  LA DA +AG+ + AE + Q A+HY R+
Sbjct: 22  QPNVPNRNTSYESNGPDVKLRGNAQQLNEKYLALAHDAAAAGERITAEAYTQFADHYFRL 81

Query: 84  VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV 143
              A    +E+  +                        +P P IEE  +P      QP  
Sbjct: 82  HQAAVDAAEERRAQ---------------HAERQSRAEAPQPSIEEEAKP------QPDT 120

Query: 144 E-DVAFKTPDISREKDVSYKKV 164
           E D A +  D +   D+S  K+
Sbjct: 121 EGDSAAEKADGAEVVDLSPAKL 142


>gi|149185461|ref|ZP_01863777.1| hypothetical protein ED21_20589 [Erythrobacter sp. SD-21]
 gi|148830681|gb|EDL49116.1| hypothetical protein ED21_20589 [Erythrobacter sp. SD-21]
          Length = 219

 Score = 66.1 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 34/173 (19%), Positives = 66/173 (38%), Gaps = 8/173 (4%)

Query: 36  SNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKL 95
           +N  D + RG A  + ++Y  LA+DA   GD V AE +LQ A+HY R+++  +A+ +E  
Sbjct: 25  ANRIDSRARGNAPQMLDKYKKLAQDAQHNGDRVQAEYYLQFADHYFRVIADNKARQEEAK 84

Query: 96  QRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFEN--------SIQPKVEDVA 147
            + + +     +  +  ++     +        E  +   E         +      D  
Sbjct: 85  AKRQDERGNQSDDDDGDEDGDDNRKNRRPRGRREDDQGQNEARGRKPRRKADDADDADDF 144

Query: 148 FKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDN 200
            +  +    KD   +  ++RR  R              E    ++P  +  D 
Sbjct: 145 ERGDNPFTRKDGEDEAPKKRRAPRKAKKGEEGVPGNEGEIDVIVLPPAIGGDE 197


>gi|294010052|ref|YP_003543512.1| hypothetical protein SJA_C1-00660 [Sphingobium japonicum UT26S]
 gi|292673382|dbj|BAI94900.1| hypothetical protein SJA_C1-00660 [Sphingobium japonicum UT26S]
          Length = 260

 Score = 65.3 bits (157), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 28/84 (33%), Positives = 45/84 (53%)

Query: 39  YDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRD 98
            D + RG A  + E+Y  +ARD+  AGD V AE +LQ A+HY R+++  +A+ +E+ QR 
Sbjct: 35  IDSRARGNAAQLLEKYKNMARDSQMAGDRVNAEYYLQFADHYFRVLADNRARQEEQQQRF 94

Query: 99  EQDDLLVKEQKERAQNALSEFEAS 122
              D    +  +    A    E +
Sbjct: 95  RPRDENFDDSFDDFDAADEAGEDA 118


>gi|85375682|ref|YP_459744.1| hypothetical protein ELI_14275 [Erythrobacter litoralis HTCC2594]
 gi|84788765|gb|ABC64947.1| hypothetical protein ELI_14275 [Erythrobacter litoralis HTCC2594]
          Length = 241

 Score = 65.3 bits (157), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 33/163 (20%), Positives = 61/163 (37%), Gaps = 6/163 (3%)

Query: 39  YDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRD 98
            D + RG A  + ++Y  LA+DA   GD V  E +LQ A+HY R+++  +A+  E   + 
Sbjct: 45  IDSRARGNAPQLLDKYKKLAQDAQHNGDRVQMEYYLQFADHYFRVIADNKARQDEARAKR 104

Query: 99  EQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKD 158
           + +    ++  +   +          P    G     +++   K         +      
Sbjct: 105 DAERGHSRDDDDDDDDGDDSRRKGKGPRGRRGDSDDRQDNRPKKRRKDNDSGDEHDDSDS 164

Query: 159 VSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNA 201
                    RP      P AK   +P ++ E  +  E   D +
Sbjct: 165 DGDYDFDEARP------PRAKKARKPRKSDEGSIGVEGEIDAS 201


>gi|94496669|ref|ZP_01303245.1| hypothetical protein SKA58_18232 [Sphingomonas sp. SKA58]
 gi|94424029|gb|EAT09054.1| hypothetical protein SKA58_18232 [Sphingomonas sp. SKA58]
          Length = 282

 Score = 64.9 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 31/94 (32%), Positives = 49/94 (52%)

Query: 39  YDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRD 98
            D + RG A  + E+Y  +ARDA  AGD V AE +LQ A+HY R+++  +A+ +E+ QR 
Sbjct: 34  IDNRARGNAAQLLEKYKNMARDAQMAGDRVNAEYYLQFADHYFRVLADNRARQEEQQQRY 93

Query: 99  EQDDLLVKEQKERAQNALSEFEASPCPLIEEGKE 132
            ++D    E  +   +A    +       E G  
Sbjct: 94  RRNDDDYSEDGDEFDSADYGSDDGRADQSERGSR 127


>gi|296775658|gb|ADH42935.1| hypothetical protein [uncultured SAR11 cluster alpha
           proteobacterium H17925_23J24]
          Length = 118

 Score = 64.9 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 24/93 (25%), Positives = 50/93 (53%)

Query: 8   KRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDY 67
            + R R +  G  +    +   + RN  S     K     + I E+Y  LA++A+S+GD 
Sbjct: 14  NKYRSRRNINGVKNGGVIHQVNVNRNGMSRNGVPKNPHNVERIIEKYKNLAKEALSSGDK 73

Query: 68  VVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQ 100
           ++ EN+LQH++H+ R++S  + ++++   +  +
Sbjct: 74  ILHENYLQHSDHFARLLSEMEPKVKDNSTKQNE 106


>gi|297182637|gb|ADI18795.1| hypothetical protein [uncultured SAR11 cluster bacterium
           HF4000_37C10]
          Length = 127

 Score = 64.9 bits (156), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 27/108 (25%), Positives = 51/108 (47%), Gaps = 2/108 (1%)

Query: 7   YKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGD 66
            + S GR     +    +  L     +        +   +A+ + E+Y+ LA++A+++GD
Sbjct: 11  RRHSNGRKHQPHDNGGTQARLGSNSFSNSQTRNHFRTPQSAEKLFEKYNTLAKEALTSGD 70

Query: 67  YVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQN 114
             ++EN+ QHA+H+ RI+      I +K  R + DD    E     Q+
Sbjct: 71  KTLSENYFQHADHFVRIIE--NKNINQKQNRAQVDDKHSTENSGVNQD 116


>gi|297181092|gb|ADI17291.1| hypothetical protein [uncultured alpha proteobacterium
           HF0070_17D04]
          Length = 155

 Score = 64.6 bits (155), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 44/142 (30%), Positives = 66/142 (46%), Gaps = 22/142 (15%)

Query: 24  RKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRI 83
           + N+     +Y+SNG DVK+RG AQ + E+Y  LA DA +AG+ + AE + Q A+HY R+
Sbjct: 22  QPNVPNRNTSYESNGPDVKLRGNAQQLNEKYLALAHDAAAAGERITAEAYTQFADHYFRL 81

Query: 84  VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV 143
              A    +E+  +                        +P P IEE  +P      QP  
Sbjct: 82  HQAAVDAAEERRAQ---------------HAERQSRAEAPQPSIEEEAKP------QPDT 120

Query: 144 E-DVAFKTPDISREKDVSYKKV 164
           E D A +  D +   D+S  K+
Sbjct: 121 ESDSAAEKADGAEVVDLSPAKL 142


>gi|103488189|ref|YP_617750.1| hypothetical protein Sala_2712 [Sphingopyxis alaskensis RB2256]
 gi|98978266|gb|ABF54417.1| conserved hypothetical protein [Sphingopyxis alaskensis RB2256]
          Length = 273

 Score = 63.8 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 44/82 (53%)

Query: 35  DSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEK 94
            +N  D + RG    + E+Y  LARDA  AGD V+ E +LQ A+HY R+VS  +A+ +EK
Sbjct: 36  QANRIDSRARGNGAQMIEKYRNLARDAQLAGDRVLTEYYLQFADHYFRVVSDFRARQEEK 95

Query: 95  LQRDEQDDLLVKEQKERAQNAL 116
                Q+    + ++ R     
Sbjct: 96  AAASGQERSHDRGREIRGVEDF 117


>gi|296282003|ref|ZP_06860001.1| hypothetical protein CbatJ_00195 [Citromicrobium bathyomarinum
           JL354]
          Length = 258

 Score = 63.8 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 36/186 (19%), Positives = 70/186 (37%), Gaps = 17/186 (9%)

Query: 36  SNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKL 95
           SN  D + RG A  + ++Y  LA+DA   GD V  E +LQ A+HY R+++  +A+  E+ 
Sbjct: 28  SNRIDSRARGNAPQLLDKYKKLAQDAQHNGDRVQTEYYLQFADHYFRVIADNKARQDEQR 87

Query: 96  QR---------------DEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQ 140
            +               D+      +    R  +  ++    P       ++   + S  
Sbjct: 88  AKRDTGRDRANDDTDEDDDDRGNDNRSSGNRGDDNRNDERRKPKKGNRSERQRGRDRSDD 147

Query: 141 PKVEDVAFKTPDISREKDVS--YKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
                 A    +   ++  S     VR+R     R  P A+  ++  +        +   
Sbjct: 148 DDTSSDADSDANDGDDEFESDDNPFVRKRSSEPRRAAPKARKTSRKADKDSDDNKGDDGE 207

Query: 199 DNASSV 204
            +A+ +
Sbjct: 208 IDANVL 213


>gi|307296976|ref|ZP_07576792.1| hypothetical protein SphchDRAFT_3929 [Sphingobium chlorophenolicum
           L-1]
 gi|306877502|gb|EFN08730.1| hypothetical protein SphchDRAFT_3929 [Sphingobium chlorophenolicum
           L-1]
          Length = 249

 Score = 63.8 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 33/147 (22%), Positives = 59/147 (40%)

Query: 39  YDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRD 98
            D + RG A  + E+Y  +ARDA  AGD V AE +LQ A+HY R+++  +A+ +E+ QR 
Sbjct: 35  IDSRARGNAAQLLEKYKNMARDAQMAGDRVNAEYYLQFADHYFRVLADNRARQEEQQQRF 94

Query: 99  EQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKD 158
              D   +E  +         +        +  +       + +         +     +
Sbjct: 95  RPRDDGFEENFDDFDAGDEGGDDGRVDQSFDRGQDFDRRREEQRDYREGRNDRNRRDRNE 154

Query: 159 VSYKKVRRRRPLRPRVFPNAKSGNQPV 185
            S ++  R         P  +   +PV
Sbjct: 155 RSDRRRERPAAEEAAEQPRPQIAAEPV 181


>gi|330813115|ref|YP_004357354.1| hypothetical protein SAR11G3_00140 [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327486210|gb|AEA80615.1| hypothetical protein SAR11G3_00140 [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 146

 Score = 61.9 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 22/86 (25%), Positives = 45/86 (52%), Gaps = 1/86 (1%)

Query: 47  AQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV-SMAQAQIQEKLQRDEQDDLLV 105
           A  + ++Y  LA DA+S GD ++AE++ QHA+HY R++    +  I+ +   +E ++   
Sbjct: 58  ATKMFDKYKTLANDALSVGDIILAESYFQHADHYARLLPPEPKPVIKSEESLNEPENENT 117

Query: 106 KEQKERAQNALSEFEASPCPLIEEGK 131
           + + +      ++ EA     + E  
Sbjct: 118 ETEDDIVSQDAAKAEADASKTVTEEA 143


>gi|167041275|gb|ABZ06031.1| hypothetical protein ALOHA_HF4000005D21ctg1g36 [uncultured marine
           microorganism HF4000_005D21]
 gi|167045780|gb|ABZ10426.1| hypothetical protein ALOHA_HF4000APKG3108ctg1g37 [uncultured marine
           bacterium HF4000_APKG3108]
          Length = 147

 Score = 60.3 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 29/109 (26%), Positives = 55/109 (50%), Gaps = 2/109 (1%)

Query: 2   RSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDA 61
           R  +   RS GR +   + S  ++ L     +        +   +A+ + E+Y+ LA++A
Sbjct: 5   RPRRFRHRSNGRNNQRRDNSDTQERLRSNSFSNSQTRNHFRTPQSAEKLFEKYNALAKEA 64

Query: 62  MSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKE 110
           +++GD  ++EN+ QHA+H+ RI+      I +K    + DD  V   K+
Sbjct: 65  LTSGDRTLSENYFQHADHFMRIIE--NKNINQKQNSVQVDDKQVVNDKQ 111


>gi|296775789|gb|ADH43044.1| hypothetical protein [uncultured SAR11 cluster alpha
           proteobacterium H17925_48B19]
          Length = 102

 Score = 58.4 bits (139), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 26/86 (30%), Positives = 48/86 (55%), Gaps = 6/86 (6%)

Query: 20  GSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEH 79
           G+  + N +    +     +  K    A  + E+Y+ LAR+A+S GD +++EN+LQH+EH
Sbjct: 1   GNGQKSNGDFSNGSSFKRRHPGKNNQNAAKLVEKYNDLAREALSNGDKILSENYLQHSEH 60

Query: 80  YNRIVSMAQAQIQEKLQRDEQDDLLV 105
           ++RI+      I ++  R+  D+L  
Sbjct: 61  FSRIL------ISQENSRNNSDNLTD 80


>gi|304394126|ref|ZP_07376049.1| putative cytoplasmic protein [Ahrensia sp. R2A130]
 gi|303293566|gb|EFL87943.1| putative cytoplasmic protein [Ahrensia sp. R2A130]
          Length = 258

 Score = 57.6 bits (137), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 42/92 (45%), Positives = 58/92 (63%), Gaps = 2/92 (2%)

Query: 33  NYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQ 92
           + +SNG DV++RGTA HIAE+Y  LA DA +AGD V+A+++ Q AEHYNR   +A AQ  
Sbjct: 36  SMESNGPDVRIRGTAAHIAEKYLSLANDAQTAGDTVMAQSYFQFAEHYNR--VVAAAQAV 93

Query: 93  EKLQRDEQDDLLVKEQKERAQNALSEFEASPC 124
           ++ QR+EQ     K+   + QN      AS  
Sbjct: 94  QEAQREEQQARQAKQDARQDQNNQGNGPASNE 125


>gi|297182871|gb|ADI19022.1| hypothetical protein [uncultured alpha proteobacterium
           HF0070_05I22]
          Length = 89

 Score = 57.6 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 34/77 (44%), Gaps = 1/77 (1%)

Query: 55  SVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQ-KERAQ 113
             LA D+ +AG+ + AE + Q A+HY R+   A    + K Q+D+    +  E     A 
Sbjct: 1   MALAHDSAAAGERISAEAYTQFADHYFRLHQAAVGVAETKRQQDQAAAAVSAEATSGDAD 60

Query: 114 NALSEFEASPCPLIEEG 130
           N  +    +P   I   
Sbjct: 61  NGEAGSNHAPTGDITSE 77


>gi|91762344|ref|ZP_01264309.1| hypothetical protein PU1002_03726 [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|91718146|gb|EAS84796.1| hypothetical protein PU1002_03726 [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 158

 Score = 57.2 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 44/93 (47%), Gaps = 8/93 (8%)

Query: 4   VQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMS 63
               +R   R +N G+   N         N+       +    A  + E+Y+ LAR+A++
Sbjct: 19  SNNNRRPPFRSNNEGSKFSN-------NDNFQRKVP-GRNNHNAVKLIEKYNDLAREALA 70

Query: 64  AGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQ 96
             D +++EN+ QHA+H+ R+ +  ++    ++ 
Sbjct: 71  NEDKILSENYFQHADHFTRVQNEQESLRMARVN 103


>gi|40062725|gb|AAR37630.1| hypothetical protein MBMO_EBAC000-62A03.2 [uncultured marine
           bacterium 438]
          Length = 158

 Score = 57.2 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 22/128 (17%), Positives = 55/128 (42%), Gaps = 8/128 (6%)

Query: 4   VQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMS 63
               +R   R +N G+   N         N+       +    A  + E+Y+ LAR+A++
Sbjct: 19  SNNNRRPPFRSNNEGSKFSN-------NDNFQRKVP-GRNNHNAVKLIEKYNDLAREALA 70

Query: 64  AGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASP 123
             D +++EN+ QHA+H+ R+ +  ++    ++       +   + +++ +  +     + 
Sbjct: 71  NEDKILSENYFQHADHFTRVQNEQESLRMARVNSSATATIKPVDSEKKVEETIKTEAETV 130

Query: 124 CPLIEEGK 131
              + E +
Sbjct: 131 KKEVTEPE 138


>gi|40062807|gb|AAR37691.1| hypothetical protein MBMO_EBAC750-02H05.9 [uncultured marine
           bacterium 440]
          Length = 132

 Score = 57.2 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 57/120 (47%), Gaps = 2/120 (1%)

Query: 12  GRGSNGGNGSFNRKNLNPLVRNYDSNG--YDVKVRGTAQHIAERYSVLARDAMSAGDYVV 69
             G +    S N ++   +  ++ S+    + K   +A+ + E Y +LA++A+S GD ++
Sbjct: 13  SNGRDFRRRSNNNESNRLVSGSFASDRGKNNFKSNKSAEQLLESYKILAKEAISLGDKIL 72

Query: 70  AENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEE 129
            EN+LQH +H+ RIVS         L  + Q++ L    +    +  SE +       +E
Sbjct: 73  EENYLQHIDHFERIVSNKNLNQNNNLSNNNQNNNLSNNNQNNNLSNDSETDQDHTNKNKE 132


>gi|71083226|ref|YP_265945.1| hypothetical protein SAR11_0520 [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|71062339|gb|AAZ21342.1| hypothetical protein SAR11_0520 [Candidatus Pelagibacter ubique
           HTCC1062]
          Length = 158

 Score = 57.2 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 44/93 (47%), Gaps = 8/93 (8%)

Query: 4   VQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMS 63
               +R   R +N G+   N         N+       +    A  + E+Y+ LAR+A++
Sbjct: 19  SNNNRRPPFRSNNEGSKFSN-------NDNFQRKVP-GRNNHNAVKLIEKYNDLAREALA 70

Query: 64  AGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQ 96
             D +++EN+ QHA+H+ R+ +  ++    ++ 
Sbjct: 71  NEDKILSENYFQHADHFTRVQNEQESLRMARVN 103


>gi|167519899|ref|XP_001744289.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163777375|gb|EDQ90992.1| predicted protein [Monosiga brevicollis MX1]
          Length = 1735

 Score = 55.7 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/107 (19%), Positives = 36/107 (33%), Gaps = 3/107 (2%)

Query: 97  RDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISRE 156
           ++    +  + +    Q   S   +   P  E    P  E   +PK E      P+   E
Sbjct: 51  QEPSASVASEPKASTRQQPESATTSESKPKTEPKTGPKTEPKTEPKTEPKPESKPEPKTE 110

Query: 157 KDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASS 203
                K   +  P +P   P +K   +P  A  +  P    +D  +S
Sbjct: 111 PKTEPKTEPKTEP-KPASKPESKPEPKPEPAVTS--PSVTKADTKAS 154



 Score = 39.1 bits (89), Expect = 0.42,   Method: Composition-based stats.
 Identities = 13/82 (15%), Positives = 22/82 (26%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
           +  + Q +     + +     K   +       + E  P    E   EP  E   +PK E
Sbjct: 63  ASTRQQPESATTSESKPKTEPKTGPKTEPKTEPKTEPKPESKPEPKTEPKTEPKTEPKTE 122

Query: 145 DVAFKTPDISREKDVSYKKVRR 166
                 P+   E          
Sbjct: 123 PKPASKPESKPEPKPEPAVTSP 144


>gi|118588512|ref|ZP_01545921.1| hypothetical protein SIAM614_24562 [Stappia aggregata IAM 12614]
 gi|118439218|gb|EAV45850.1| hypothetical protein SIAM614_24562 [Stappia aggregata IAM 12614]
          Length = 202

 Score = 55.7 bits (132), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 48/174 (27%), Positives = 73/174 (41%), Gaps = 16/174 (9%)

Query: 49  HIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQ 108
           HIAE+Y  LARDA ++GD V++EN+ QHAEHY RIV+ AQ Q Q       +++     +
Sbjct: 2   HIAEKYQQLARDAQASGDRVMSENYNQHAEHYLRIVAAAQPQQQPMAHASSRNETEDGFE 61

Query: 109 KERAQNALSEFEASPCPL-----------IEEGKEPIFENSI----QPKVEDVAFKTPDI 153
              AQN       +  P              +  +P  ++      + KV   + K    
Sbjct: 62  AA-AQNGSGHSNGAERPSQDVSSSDGDLMDADSPQPFIDDMPVIDQEGKVNGASKKAEKA 120

Query: 154 SREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQD 207
               D + +K RRR        P   SG+QP          E +     S +++
Sbjct: 121 EAGDDEADEKPRRRARTPRARTPRRASGDQPEAGQAASEATESSEAAGGSDEEE 174


>gi|47214568|emb|CAG13290.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 10495

 Score = 54.9 bits (130), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 16/110 (14%), Positives = 38/110 (34%), Gaps = 2/110 (1%)

Query: 82    RIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSE-FEASPCPLIEEGKEPIFENSIQ 140
             R++     + ++   R+       K+     +   +   E  P P  +   EP  +   +
Sbjct: 10256 RVLIEETVETKKVEMREGIPSKEPKQVATMPKPEPTPKAEQEPKPKPKAEPEPKPKPKAE 10315

Query: 141   PKVEDVAFKTPDISREKDVSY-KKVRRRRPLRPRVFPNAKSGNQPVEATE 189
             P+ +      P+   +       K + +    P++ P A+   +P    E
Sbjct: 10316 PEPKPKPKAEPEPKPKPKAEPEPKPKPKVEPEPKLKPKAEPEPKPKPKVE 10365



 Score = 48.0 bits (112), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 15/92 (16%), Positives = 31/92 (33%), Gaps = 11/92 (11%)

Query: 109   KERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSY------- 161
              E+      + E  P P  +   EP  +   +P+ +      P+   +  V         
Sbjct: 10294 AEQEPKPKPKAEPEPKPKPKAEPEPKPKPKAEPEPKPKPKAEPEPKPKPKVEPEPKLKPK 10353

Query: 162   ----KKVRRRRPLRPRVFPNAKSGNQPVEATE 189
                  K + +    P++ P A+   +P +  E
Sbjct: 10354 AEPEPKPKPKVEPEPKLKPKAEPEPKPKQRAE 10385



 Score = 46.8 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/132 (15%), Positives = 39/132 (29%), Gaps = 20/132 (15%)

Query: 89    AQIQEKLQRDEQDDLLVKEQKERAQNALSE-FEASPCPLIEEGKEPIFENSIQPKVEDVA 147
                 E   + + +     + K   +       E  P P  +   EP  +   +P+ +   
Sbjct: 10303 KAEPEPKPKPKAEPEPKPKPKAEPEPKPKPKAEPEPKPKPKVEPEPKLKPKAEPEPKPKP 10362

Query: 148   FKTPDISREKDVSY-KKVRRRRPL------------RPRVFPNAK------SGNQPVEAT 188
                P+   +       K ++R  L             P+V P  K      S  +P    
Sbjct: 10363 KVEPEPKLKPKAEPEPKPKQRAELEPIAELELKPTPAPKVEPEPKPAVKVESEAKPEPVK 10422

Query: 189   ETIVPQELNSDN 200
             +   P    S++
Sbjct: 10423 KLTTPPSKESED 10434



 Score = 45.3 bits (105), Expect = 0.005,   Method: Composition-based stats.
 Identities = 16/109 (14%), Positives = 36/109 (33%), Gaps = 4/109 (3%)

Query: 89    AQIQEKLQRDEQDDLLVKEQKERAQNALSE-FEASPCPLIEEGKEPIFENSIQPKVEDVA 147
                QE   + + +     + K   +       E  P P  +   EP  +  ++P+ +   
Sbjct: 10293 KAEQEPKPKPKAEPEPKPKPKAEPEPKPKPKAEPEPKPKPKAEPEPKPKPKVEPEPKLKP 10352

Query: 148   FKTPDISREKDVSY-KKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQE 195
                P+   +  V    K++ +    P   P  ++  +P+   E      
Sbjct: 10353 KAEPEPKPKPKVEPEPKLKPK--AEPEPKPKQRAELEPIAELELKPTPA 10399


>gi|300116989|dbj|BAJ10661.1| 94-kilodalton protein [Babesia microti]
          Length = 863

 Score = 54.9 bits (130), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 24/118 (20%), Positives = 42/118 (35%), Gaps = 6/118 (5%)

Query: 88  QAQIQEKLQRDEQDDLLVKEQKERAQ----NALSEFEASPCPLIEEGKEPIFENSIQPKV 143
           Q   + K +    D    K Q +           E E  P P  +   +P  ++  +PK 
Sbjct: 643 QPDDKSKPKPQPDDKSKPKPQPDDKSKPKPQPDDESEPIPQPDDKSKPKPQPDDKSKPKP 702

Query: 144 EDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNA 201
           +      P    + D S  K       +P+  P+ KS  +P    ++ V  +   DN+
Sbjct: 703 QPDDKSKPKPQPD-DKSKPKPHPDDKSKPKPHPDDKSKPKPHPD-DSNVTHKGTEDNS 758



 Score = 52.6 bits (124), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 17/88 (19%), Positives = 32/88 (36%), Gaps = 3/88 (3%)

Query: 115 ALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRV 174
              E E  P P  +   +P  ++  +PK +      P    + D S    +     +P+ 
Sbjct: 634 PDDESEPIPQPDDKSKPKPQPDDKSKPKPQPDDKSKPKPQPD-DESEPIPQPDDKSKPKP 692

Query: 175 FPNAKSGNQPVEATETIVPQELNSDNAS 202
            P+ KS  +P    +     +   D+ S
Sbjct: 693 QPDDKS--KPKPQPDDKSKPKPQPDDKS 718



 Score = 51.5 bits (121), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 17/97 (17%), Positives = 37/97 (38%), Gaps = 3/97 (3%)

Query: 106 KEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVR 165
            ++ E       + +  P P  +   +P  ++  +PK +      P    + D S  K +
Sbjct: 635 DDESEPIPQPDDKSKPKPQPDDKSKPKPQPDDKSKPKPQPDDESEPIPQPD-DKSKPKPQ 693

Query: 166 RRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
                +P+  P+ KS  +P    +     + + D+ S
Sbjct: 694 PDDKSKPKPQPDDKS--KPKPQPDDKSKPKPHPDDKS 728



 Score = 50.7 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 13/121 (10%), Positives = 41/121 (33%), Gaps = 8/121 (6%)

Query: 94  KLQRDEQDDLLVKEQKERAQ-NALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPD 152
               DE + +   + K + +     + +  P P  +   +P  ++  +P  +      P 
Sbjct: 632 PQPDDESEPIPQPDDKSKPKPQPDDKSKPKPQPDDKSKPKPQPDDESEPIPQPDDKSKPK 691

Query: 153 ISREKDVSYK-------KVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVD 205
              +     K       K + +   + +  P+    ++P    +     + + D+++   
Sbjct: 692 PQPDDKSKPKPQPDDKSKPKPQPDDKSKPKPHPDDKSKPKPHPDDKSKPKPHPDDSNVTH 751

Query: 206 Q 206
           +
Sbjct: 752 K 752



 Score = 49.5 bits (116), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 19/101 (18%), Positives = 34/101 (33%), Gaps = 3/101 (2%)

Query: 102 DLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSY 161
           D      K   + +  + +  P P  E    P  ++  +PK +      P    + D S 
Sbjct: 611 DNETPAGKSNLKCSDDKSKPKPQPDDESEPIPQPDDKSKPKPQPDDKSKPKPQPD-DKSK 669

Query: 162 KKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
            K +      P   P+ KS  +P    +     +   D+ S
Sbjct: 670 PKPQPDDESEPIPQPDDKS--KPKPQPDDKSKPKPQPDDKS 708


>gi|241889087|ref|ZP_04776391.1| immunoglobulin A1 protease [Gemella haemolysans ATCC 10379]
 gi|241864336|gb|EER68714.1| immunoglobulin A1 protease [Gemella haemolysans ATCC 10379]
          Length = 2130

 Score = 52.6 bits (124), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 25/144 (17%), Positives = 51/144 (35%), Gaps = 29/144 (20%)

Query: 83  IVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGK-EPIFEN---- 137
           IV   Q Q     Q+ +Q   + +  K ++   +   E  P P+      +P  +     
Sbjct: 216 IVENNQNQALGAKQQTQQQKPVRENGKAQSTQPVQP-EVKPEPVKPAQPVQPEVKPEPVK 274

Query: 138 ---SIQPKVEDVAFK--------------TPDISREKDVSYKKVRRRRPLRPRVFPNA-- 178
               +QP+V+    K               P    + +V  + V+  +P++P++ P    
Sbjct: 275 PTQPVQPEVKPEPVKPTQPVQPEVKPEPVKPTQPVQPEVKPEPVKPTQPVQPKIKPEPVK 334

Query: 179 ----KSGNQPVEATETIVPQELNS 198
               K   +P ++T+   P     
Sbjct: 335 PAQLKVKPEPAQSTQETKPVVSTG 358



 Score = 44.1 bits (102), Expect = 0.012,   Method: Composition-based stats.
 Identities = 19/96 (19%), Positives = 44/96 (45%), Gaps = 10/96 (10%)

Query: 98  DEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFEN-------SIQPKVEDVAFKT 150
           ++++     ++K   +N  ++   +      + ++P+ EN        +QP+V+    K 
Sbjct: 203 EKKEIENKVQEKNIVENNQNQALGAKQQT--QQQKPVRENGKAQSTQPVQPEVKPEPVK- 259

Query: 151 PDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVE 186
           P    + +V  + V+  +P++P V P      QPV+
Sbjct: 260 PAQPVQPEVKPEPVKPTQPVQPEVKPEPVKPTQPVQ 295


>gi|170027877|ref|XP_001841823.1| conserved hypothetical protein [Culex quinquefasciatus]
 gi|167868293|gb|EDS31676.1| conserved hypothetical protein [Culex quinquefasciatus]
          Length = 1140

 Score = 52.2 bits (123), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 21/136 (15%), Positives = 43/136 (31%), Gaps = 12/136 (8%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
           +  + +   +   +   +   +   E+  +   E  + P P      EP  E++ +P  E
Sbjct: 258 TEPEPESTAEPSSEPASEPSAEPTSEQGPHPEPEVSSEPEPESTSEPEPSAESTAEPSSE 317

Query: 145 DVA------------FKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIV 192
             A               P  S  +  S  K        P+  P ++  ++P    ET  
Sbjct: 318 PKAEPKSKKTKRATGDSRPPASEPEPKSEPKSEPASEPEPKSEPKSEPSSEPEPKAETTA 377

Query: 193 PQELNSDNASSVDQDC 208
             +  + N  +   D 
Sbjct: 378 KPKPKTTNPWTPRHDF 393



 Score = 39.5 bits (90), Expect = 0.33,   Method: Composition-based stats.
 Identities = 18/91 (19%), Positives = 27/91 (29%), Gaps = 6/91 (6%)

Query: 110 ERAQNALSEFEASPCPLIEEGKEPIFENSIQ--PKVEDVAFKTPDISREKDVSYKKVRRR 167
           E       E E++  P  E   EP  E + +  P  E      P+     +         
Sbjct: 253 EPGPATEPEPESTAEPSSEPASEPSAEPTSEQGPHPEPEVSSEPEPESTSEPEPSAESTA 312

Query: 168 RPLR-PRVFPNAKSGNQPVEATETIVPQELN 197
            P   P+  P +K   +   AT    P    
Sbjct: 313 EPSSEPKAEPKSKKTKR---ATGDSRPPASE 340


>gi|254420928|ref|ZP_05034652.1| hypothetical protein BBAL3_3238 [Brevundimonas sp. BAL3]
 gi|196187105|gb|EDX82081.1| hypothetical protein BBAL3_3238 [Brevundimonas sp. BAL3]
          Length = 299

 Score = 51.1 bits (120), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 46/90 (51%), Gaps = 5/90 (5%)

Query: 50  IAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQ-----IQEKLQRDEQDDLL 104
           + ERY  LARDA S GD V+AEN+ QHAEHY R++   Q Q     I  + Q ++  D+ 
Sbjct: 1   MYERYQQLARDASSGGDRVLAENYQQHAEHYYRVLRALQPQRSFSDIAAREQSNQGFDID 60

Query: 105 VKEQKERAQNALSEFEASPCPLIEEGKEPI 134
            +++      A    + +     ++G E  
Sbjct: 61  FEDESGAQAAAFVAAQQAADRQNQDGAERD 90


>gi|296775699|gb|ADH42975.1| hypothetical protein [uncultured SAR11 cluster alpha
           proteobacterium H17925_38M03]
          Length = 129

 Score = 51.1 bits (120), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 17/65 (26%), Positives = 35/65 (53%)

Query: 45  GTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLL 104
              +   ++Y  LA+DA S GD V+++N+LQHA+HY R  +    + +   ++   ++  
Sbjct: 51  HNVEKTMQKYQQLAKDAQSNGDPVLSQNYLQHADHYLRRYNELSEKREAFSEKTVSEEKS 110

Query: 105 VKEQK 109
           +   +
Sbjct: 111 LNIDE 115


>gi|229551573|ref|ZP_04440298.1| conjugative transposon membrane protein [Lactobacillus rhamnosus
           LMS2-1]
 gi|229315038|gb|EEN81011.1| conjugative transposon membrane protein [Lactobacillus rhamnosus
           LMS2-1]
          Length = 697

 Score = 49.9 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 20/116 (17%), Positives = 39/116 (33%), Gaps = 9/116 (7%)

Query: 86  MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCP-LIEEGKEPI-FENSIQPKV 143
            A+        R E +     +Q E+ +  + E + +  P    E  +P   +  ++P  
Sbjct: 548 AAETAKDSFKGRREANQQERDKQLEQRRKQMQERKLAIKPKADPEKPKPTATKPPVEPTR 607

Query: 144 EDVAFKTPDISREKDVSYKKVRRR-------RPLRPRVFPNAKSGNQPVEATETIV 192
           +      P    E+  +  + +R        RP RP   P A+    P +      
Sbjct: 608 KPTTATPPKPKPEQADTSGQPKRAATKPTSTRPPRPATKPQAEPTITPHQELTPST 663



 Score = 47.6 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 19/108 (17%), Positives = 39/108 (36%), Gaps = 9/108 (8%)

Query: 89  AQIQEKLQRDEQDDLLVKEQKERA------QNALSEFEASPCPLIEEGKEPIFENSIQPK 142
            +   + +RD+Q +   K+ +ER        +       +  P +E  ++P      +PK
Sbjct: 559 RREANQQERDKQLEQRRKQMQERKLAIKPKADPEKPKPTATKPPVEPTRKPTTATPPKPK 618

Query: 143 VEDVAFK-TPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATE 189
            E       P  +  K  S +  R     +P+  P      +   +T+
Sbjct: 619 PEQADTSGQPKRAATKPTSTRPPRPA--TKPQAEPTITPHQELTPSTD 664


>gi|194757120|ref|XP_001960813.1| GF13555 [Drosophila ananassae]
 gi|190622111|gb|EDV37635.1| GF13555 [Drosophila ananassae]
          Length = 1348

 Score = 49.5 bits (116), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 22/120 (18%), Positives = 41/120 (34%), Gaps = 2/120 (1%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
           S A+ + + K +   +     K + +    +  + E  P        EP  E   +P+ +
Sbjct: 353 SEAEPKSEPKSEPKSEPKSEPKSEPKSEPKSEPKSEPEPKSEPTSEPEPKSEPKSEPEPK 412

Query: 145 DVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKS--GNQPVEATETIVPQELNSDNAS 202
                 P+   E   S  + +      P+  P  KS   +QP    E     E  ++  S
Sbjct: 413 SEPKSEPEPKSEPAKSQAEPKSEPKSEPKSEPEPKSEPKSQPSSEPEPKSEPESQAEPKS 472



 Score = 48.0 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 16/115 (13%), Positives = 40/115 (34%), Gaps = 2/115 (1%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
           S  + + +   + + + +   + + E      SE ++ P    +   EP  E + +P+ +
Sbjct: 343 SEPEPKSEPGSEAEPKSEPKSEPKSEPKSEPKSEPKSEPKSEPKSEPEPKSEPTSEPEPK 402

Query: 145 DVAFKTPDISREKDV--SYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELN 197
                 P+   E       K    +    P+  P ++  ++P   +E        
Sbjct: 403 SEPKSEPEPKSEPKSEPEPKSEPAKSQAEPKSEPKSEPKSEPEPKSEPKSQPSSE 457



 Score = 47.2 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 20/108 (18%), Positives = 36/108 (33%), Gaps = 1/108 (0%)

Query: 95  LQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDIS 154
               + +     E K     + +E ++ P    +   EP  E   QP  E      P+  
Sbjct: 408 EPEPKSEPKSEPEPKSEPAKSQAEPKSEPKSEPKSEPEPKSEPKSQPSSEPEPKSEPESQ 467

Query: 155 REKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
            E     K   +  P  P+  P +++  +    +E     E  S+  S
Sbjct: 468 AEPKSEPKSEPKSEP-EPKSEPESEAEPKSEPKSEPKSEPEPKSEPKS 514



 Score = 45.7 bits (106), Expect = 0.004,   Method: Composition-based stats.
 Identities = 21/107 (19%), Positives = 36/107 (33%), Gaps = 1/107 (0%)

Query: 97  RDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISRE 156
           RD  D     E       +  E ++ P    E   EP  E   +P+ +       +   E
Sbjct: 301 RDIGDLTTTLESPAPEPKSEPEPKSEPGSAAEPKSEPKSEPKSEPEPKSEPGSEAEPKSE 360

Query: 157 KDVSYKKVRRRRPLR-PRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
                K   +  P   P+  P ++  ++P   +E     E  S+  S
Sbjct: 361 PKSEPKSEPKSEPKSEPKSEPKSEPKSEPEPKSEPTSEPEPKSEPKS 407



 Score = 43.4 bits (100), Expect = 0.021,   Method: Composition-based stats.
 Identities = 18/119 (15%), Positives = 45/119 (37%), Gaps = 1/119 (0%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
           + +QA+ + + + + + +   K + +   ++  E ++ P    E   EP  E   +P+ +
Sbjct: 426 AKSQAEPKSEPKSEPKSEPEPKSEPKSQPSSEPEPKSEPESQAEPKSEPKSEPKSEPEPK 485

Query: 145 DVAFKTPDISREKDVSYKK-VRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
                  +   E     K     +   +    P ++  ++P   +E     E  S+  S
Sbjct: 486 SEPESEAEPKSEPKSEPKSEPEPKSEPKSEPEPTSEPKSEPEPTSEPQSEPEPTSEPKS 544



 Score = 43.0 bits (99), Expect = 0.024,   Method: Composition-based stats.
 Identities = 22/109 (20%), Positives = 34/109 (31%), Gaps = 1/109 (0%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
           S A+ + + K +   + +   +   E    +  + E    P  E   EP  E   +PK E
Sbjct: 329 SAAEPKSEPKSEPKSEPEPKSEPGSEAEPKSEPKSEPKSEPKSEPKSEPKSEPKSEPKSE 388

Query: 145 DVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVP 193
                 P    E     K         P+  P  KS     +A     P
Sbjct: 389 PEPKSEPTSEPEPKSEPKSE-PEPKSEPKSEPEPKSEPAKSQAEPKSEP 436



 Score = 42.2 bits (97), Expect = 0.047,   Method: Composition-based stats.
 Identities = 23/120 (19%), Positives = 39/120 (32%), Gaps = 4/120 (3%)

Query: 86  MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCP--LIEEGKEPIFENSIQPKV 143
             +++ + +   + +     + Q E      SE ++ P P    E   EP  E   +PK 
Sbjct: 445 EPKSEPKSQPSSEPEPKSEPESQAEPKSEPKSEPKSEPEPKSEPESEAEPKSEPKSEPKS 504

Query: 144 EDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASS 203
           E      P    E     K         P+  P   S  +      T  P+  + + A S
Sbjct: 505 EPEPKSEPKSEPEPTSEPKSE-PEPTSEPQSEPEPTSEPKSEPEP-TSEPEADSKNGAKS 562



 Score = 40.7 bits (93), Expect = 0.15,   Method: Composition-based stats.
 Identities = 18/116 (15%), Positives = 37/116 (31%), Gaps = 1/116 (0%)

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
              + K + + + +     + +    +  + E  P        EP  E   +PK E  + 
Sbjct: 313 PAPEPKSEPEPKSEPGSAAEPKSEPKSEPKSEPEPKSEPGSEAEPKSEPKSEPKSEPKSE 372

Query: 149 KTPDISREKDVSYKK-VRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASS 203
              +   E     K     +        P ++  ++P   +E     E  S+ A S
Sbjct: 373 PKSEPKSEPKSEPKSEPEPKSEPTSEPEPKSEPKSEPEPKSEPKSEPEPKSEPAKS 428



 Score = 37.2 bits (84), Expect = 1.3,   Method: Composition-based stats.
 Identities = 12/92 (13%), Positives = 33/92 (35%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
           S  + + + + + + + +   + + E    +  + E  P    +   EP  E   +P+  
Sbjct: 480 SEPEPKSEPESEAEPKSEPKSEPKSEPEPKSEPKSEPEPTSEPKSEPEPTSEPQSEPEPT 539

Query: 145 DVAFKTPDISREKDVSYKKVRRRRPLRPRVFP 176
                 P+ + E +   K   + + +     P
Sbjct: 540 SEPKSEPEPTSEPEADSKNGAKSKRVAKEHIP 571



 Score = 36.4 bits (82), Expect = 2.3,   Method: Composition-based stats.
 Identities = 20/124 (16%), Positives = 44/124 (35%), Gaps = 4/124 (3%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSI---QP 141
           S  +++ + + + + + +   K +        SE ++ P P  E   EP  ++     Q 
Sbjct: 371 SEPKSEPKSEPKSEPKSEPEPKSEPTSEPEPKSEPKSEPEPKSEPKSEPEPKSEPAKSQA 430

Query: 142 KVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNA 201
           + +      P    E     K      P  P+  P +++  +    +E     E  S+  
Sbjct: 431 EPKSEPKSEPKSEPEPKSEPKSQPSSEP-EPKSEPESQAEPKSEPKSEPKSEPEPKSEPE 489

Query: 202 SSVD 205
           S  +
Sbjct: 490 SEAE 493



 Score = 36.4 bits (82), Expect = 2.3,   Method: Composition-based stats.
 Identities = 24/122 (19%), Positives = 38/122 (31%), Gaps = 11/122 (9%)

Query: 92  QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSI--------QPKV 143
            E     E      K Q E      SE ++ P P  E   +P  E           +PK 
Sbjct: 413 SEPKSEPEPKSEPAKSQAEPKSEPKSEPKSEPEPKSEPKSQPSSEPEPKSEPESQAEPKS 472

Query: 144 ED--VAFKTPDISREKDVS-YKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDN 200
           E        P+   E +     K   +   +    P ++  ++P   +E     E  S+ 
Sbjct: 473 EPKSEPKSEPEPKSEPESEAEPKSEPKSEPKSEPEPKSEPKSEPEPTSEPKSEPEPTSEP 532

Query: 201 AS 202
            S
Sbjct: 533 QS 534


>gi|83859676|ref|ZP_00953196.1| hypothetical protein OA2633_06744 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852035|gb|EAP89889.1| hypothetical protein OA2633_06744 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 159

 Score = 49.2 bits (115), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 29/109 (26%), Positives = 44/109 (40%), Gaps = 1/109 (0%)

Query: 55  SVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQN 114
             LARDA SAGD V+AEN+ QHAEHY RI+   Q +  E+  ++   D            
Sbjct: 1   MQLARDASSAGDRVMAENYYQHAEHYLRIMQANQPKRDERDDQNNSGDDSDASDDAADNG 60

Query: 115 ALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKK 163
             +  + +      E          + + ED +   P    E + +   
Sbjct: 61  NENNADTA-GSASSEDAPRQRRPRGRRRREDNSSDDPLQVVEPEGADAS 108


>gi|239792801|dbj|BAH72699.1| ACYPI002562 [Acyrthosiphon pisum]
          Length = 320

 Score = 48.4 bits (113), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 17/94 (18%), Positives = 37/94 (39%), Gaps = 3/94 (3%)

Query: 105 VKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKV 164
           V+  +E       E +  P P +    +P  +   QP+V+   +  P    +  V+ ++ 
Sbjct: 86  VEPHREVQNPPPQEVQHPPQPDVHYPPQPDVQYPPQPEVQ---YPVPQQEGQPPVAPQQE 142

Query: 165 RRRRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
            +  PL+  ++P    G +P +     +    N 
Sbjct: 143 VQNTPLQQPLYPPQHEGQRPAQPNVEQILPSSNE 176


>gi|229130606|ref|ZP_04259562.1| Lpxtg-motif cell wall anchor domain protein [Bacillus cereus
           BDRD-Cer4]
 gi|228652945|gb|EEL08827.1| Lpxtg-motif cell wall anchor domain protein [Bacillus cereus
           BDRD-Cer4]
          Length = 3139

 Score = 48.0 bits (112), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 17/96 (17%), Positives = 38/96 (39%), Gaps = 4/96 (4%)

Query: 92  QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTP 151
             K   +EQ +   ++  E+ ++  ++ + +  P     ++P  + S   + +    + P
Sbjct: 195 DAKQTTEEQMNGDAQQPTEQPKDGETQQKPAEQPKDGNPQQPA-KQSKDGETQQKPAEQP 253

Query: 152 -DISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVE 186
            D + ++     K   R P +P   P      QP E
Sbjct: 254 KDGNTQQPAEQPKD--RNPQQPTEQPKDGGTQQPTE 287



 Score = 39.9 bits (91), Expect = 0.24,   Method: Composition-based stats.
 Identities = 18/113 (15%), Positives = 34/113 (30%), Gaps = 8/113 (7%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
           +  Q   Q K    +Q      +     Q A    + +P    E   +P    + QP   
Sbjct: 232 NPQQPAKQSKDGETQQKPAEQPKDGNTQQPAEQPKDRNPQQPTE---QPKDGGTQQPTEN 288

Query: 145 DVAFKTPDISREKDVSYKKVRRRRPLRPRV-----FPNAKSGNQPVEATETIV 192
                T       D S K+++       ++      P   + N+P   +   +
Sbjct: 289 PGDNTTGQPVENPDPSPKQIKENILTSVKLTDKDGKPFNDTDNRPNPDSAANI 341


>gi|119484508|ref|ZP_01619125.1| hypothetical protein L8106_02282 [Lyngbya sp. PCC 8106]
 gi|119457982|gb|EAW39105.1| hypothetical protein L8106_02282 [Lyngbya sp. PCC 8106]
          Length = 1880

 Score = 48.0 bits (112), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 21/89 (23%), Positives = 36/89 (40%), Gaps = 5/89 (5%)

Query: 121  ASPCPLIEEGKEPIF----ENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRP-LRPRVF 175
            A P P++E   EP      E  ++P  E      P+   E     + +    P + P   
Sbjct: 1455 AEPEPVVEPTPEPETIAEPEPVVEPTPEPETIAEPEPVVEPTPEPETIAEPEPVVEPTPE 1514

Query: 176  PNAKSGNQPVEATETIVPQELNSDNASSV 204
            P   +  +PVE + + V + +  D  SS+
Sbjct: 1515 PETIAEPEPVETSTSPVTEAVFYDPTSSI 1543



 Score = 44.5 bits (103), Expect = 0.009,   Method: Composition-based stats.
 Identities = 19/101 (18%), Positives = 33/101 (32%), Gaps = 5/101 (4%)

Query: 108  QKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV--EDVAFKTPDISREKDVSY-KKV 164
            + E         E +P P      EP+ E + +P+   E      P    E         
Sbjct: 1466 EPETIAEPEPVVEPTPEPETIAEPEPVVEPTPEPETIAEPEPVVEPTPEPETIAEPEPVE 1525

Query: 165  RRRRPLRPRVF--PNAKSGNQPVEATETIVPQELNSDNASS 203
                P+   VF  P +         T +     ++S+++SS
Sbjct: 1526 TSTSPVTEAVFYDPTSSISGVTQPVTPSNTAANISSEDSSS 1566



 Score = 37.6 bits (85), Expect = 1.1,   Method: Composition-based stats.
 Identities = 14/72 (19%), Positives = 21/72 (29%), Gaps = 9/72 (12%)

Query: 129  EGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPL-----RPRVFPNAKSGNQ 183
               EP+ E    P  E      P+   E     + +    P+      P      +   +
Sbjct: 1439 AEPEPVVE----PTPEPETIAEPEPVVEPTPEPETIAEPEPVVEPTPEPETIAEPEPVVE 1494

Query: 184  PVEATETIVPQE 195
            P    ETI   E
Sbjct: 1495 PTPEPETIAEPE 1506


>gi|198429473|ref|XP_002123658.1| PREDICTED: similar to transmembrane agrin [Ciona intestinalis]
          Length = 2114

 Score = 48.0 bits (112), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 16/76 (21%), Positives = 26/76 (34%), Gaps = 11/76 (14%)

Query: 121  ASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREK-----DVSYKKVRRRR----PLR 171
            A P P  +   EP  E + +P+ E      P+            S  +    R    PL 
Sbjct: 1153 AKPEPTPKSEPEP--EPTSKPEPEPEPTSNPEPEPTPNAKPEPTSNPEPEPERTTKTPLV 1210

Query: 172  PRVFPNAKSGNQPVEA 187
            P+  P   + ++   A
Sbjct: 1211 PKSEPETLATSKATPA 1226



 Score = 41.4 bits (95), Expect = 0.084,   Method: Composition-based stats.
 Identities = 15/94 (15%), Positives = 23/94 (24%), Gaps = 27/94 (28%)

Query: 123  PCPLIEEGKEPIF----------------------ENSIQPKVEDVAFKTPDISREKDVS 160
            P P++E    P                        E + + + E      P+   E   S
Sbjct: 1121 PVPVVEPEPTPNAKPEPEPTSKPEPEPEPTPNAKPEPTPKSEPEPEPTSKPEPEPE-PTS 1179

Query: 161  YKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQ 194
              +        P   P   S  +P     T  P 
Sbjct: 1180 NPEPEPT----PNAKPEPTSNPEPEPERTTKTPL 1209


>gi|84996043|ref|XP_952743.1| surface protein precursor (TaSP) [Theileria annulata strain Ankara]
 gi|18495791|emb|CAC87893.1| surface protein [Theileria annulata]
 gi|65303740|emb|CAI76117.1| surface protein precursor (TaSP), putative [Theileria annulata]
          Length = 314

 Score = 48.0 bits (112), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 17/112 (15%), Positives = 35/112 (31%), Gaps = 11/112 (9%)

Query: 102 DLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSY 161
           D    +        + + E S  P  +E  EP  +   QP  E    +   ++ E     
Sbjct: 35  DPNDDQHPLDPDQLIDQIEPSEQPAQQEPIEP--QQPTQPSTEPEELQPETVTVEVPEPV 92

Query: 162 KKVRRR--------RPLRPRVFPNAKSGNQPVEATETIVP-QELNSDNASSV 204
                +        +   P   P  +  ++P        P +  +S + ++V
Sbjct: 93  TSEEPKESDQTEEQKHEEPEASPAPEPVDEPAVHATESTPTKASSSGDGAAV 144


>gi|196048194|ref|ZP_03115371.1| surface layer domain protein [Bacillus cereus 03BB108]
 gi|196020931|gb|EDX59661.1| surface layer domain protein [Bacillus cereus 03BB108]
          Length = 453

 Score = 47.6 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 48/132 (36%), Gaps = 18/132 (13%)

Query: 68  VVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLI 127
           V  E + Q        ++  + + + +++ D + +   +E+ E            P P  
Sbjct: 193 VTREAYSQF---LFNSINAVEKEEKPEVKPDPKPETKPEEKPE----------VKPDPKP 239

Query: 128 EEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEA 187
           E   E   E    PK E    + P++         K   +   +P V P+ K   +P E 
Sbjct: 240 ETKPEEKPEVKPDPKPETKPEEKPEVK-----PDPKPETKPEEKPEVKPDPKPETKPEEK 294

Query: 188 TETIVPQELNSD 199
            ET +P  L+  
Sbjct: 295 PETNLPTSLDKV 306


>gi|296505781|ref|YP_003667481.1| collagen adhesion protein [Bacillus thuringiensis BMB171]
 gi|296326833|gb|ADH09761.1| collagen adhesion protein [Bacillus thuringiensis BMB171]
          Length = 3121

 Score = 47.6 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 20/121 (16%), Positives = 49/121 (40%), Gaps = 6/121 (4%)

Query: 92  QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTP 151
             K   +EQ +   ++  E+ ++  ++ + +  P     ++P  + S   + +    + P
Sbjct: 189 DAKQTTEEQKNGDAQQPTEQPKDGETQQKPAEQPKDGNPQQPA-KQSKDGETQQKPAEQP 247

Query: 152 DISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSV---DQDC 208
                     ++ +     +P   P   +  QPVE  +   P+++  +  +SV   D+D 
Sbjct: 248 KDG-NPQQPTEQPKDGGTQQPTENPGDNTTGQPVENPDPS-PKQIKENILTSVKLTDKDG 305

Query: 209 K 209
           K
Sbjct: 306 K 306



 Score = 41.4 bits (95), Expect = 0.067,   Method: Composition-based stats.
 Identities = 12/109 (11%), Positives = 40/109 (36%), Gaps = 9/109 (8%)

Query: 93  EKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFE----NSIQPKVEDVAF 148
           ++   ++  D   ++  +++++  ++ + +  P     ++P  +     + QP       
Sbjct: 215 QQKPAEQPKDGNPQQPAKQSKDGETQQKPAEQPKDGNPQQPTEQPKDGGTQQPTENPGDN 274

Query: 149 KTPDISREKDVSYKKVRRRRPLRPRV-----FPNAKSGNQPVEATETIV 192
            T       D S K+++       ++      P   + N+P   +   +
Sbjct: 275 TTGQPVENPDPSPKQIKENILTSVKLTDKDGKPFNDTDNRPNPDSAANI 323


>gi|325660918|ref|ZP_08149546.1| hypothetical protein HMPREF0490_00278 [Lachnospiraceae bacterium
            4_1_37FAA]
 gi|325472992|gb|EGC76202.1| hypothetical protein HMPREF0490_00278 [Lachnospiraceae bacterium
            4_1_37FAA]
          Length = 1118

 Score = 47.6 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 15/109 (13%), Positives = 37/109 (33%), Gaps = 3/109 (2%)

Query: 84   VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV 143
            ++    Q   +    EQ +      ++      +  + +P     E   P   N  QP  
Sbjct: 974  LASVPEQPDPEQPNPEQPNPEQPNPEQPNPEQPNPEQPNPEQPNPEQPNPEQPNPEQPNP 1033

Query: 144  EDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIV 192
            E  + + P+  +    + ++ +  +P      PN ++  +P +      
Sbjct: 1034 EQPSPEKPNPEQP---NPEQPKPEQPKPDGEKPNGQTAQKPSKGESVKT 1079



 Score = 41.8 bits (96), Expect = 0.066,   Method: Composition-based stats.
 Identities = 15/81 (18%), Positives = 24/81 (29%), Gaps = 2/81 (2%)

Query: 114  NALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPR 173
                  + +P     E   P   N  QP  E    + P+   + +       +  P +P 
Sbjct: 979  EQPDPEQPNPEQPNPEQPNPEQPNPEQPNPEQPNPEQPNP-EQPNPEQPNPEQPNPEQPS 1037

Query: 174  -VFPNAKSGNQPVEATETIVP 193
               PN +  N      E   P
Sbjct: 1038 PEKPNPEQPNPEQPKPEQPKP 1058


>gi|229021550|ref|ZP_04178148.1| Surface layer protein [Bacillus cereus AH1273]
 gi|229027088|ref|ZP_04183393.1| Surface layer protein [Bacillus cereus AH1272]
 gi|228734228|gb|EEL84917.1| Surface layer protein [Bacillus cereus AH1272]
 gi|228739721|gb|EEL90120.1| Surface layer protein [Bacillus cereus AH1273]
          Length = 470

 Score = 47.2 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/140 (17%), Positives = 52/140 (37%), Gaps = 7/140 (5%)

Query: 67  YVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPL 126
           +V  E + Q        ++  + + + +++ D + +   + + E  +    + E  P P 
Sbjct: 197 HVTREQYSQF---LYNSINAVEKETKPEVKPDPKPETKPETKPE--EKPEVKPEVKPDPK 251

Query: 127 IEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVE 186
            E   E   E    PK E    + P++  +      K   +  ++P   P  K   +P E
Sbjct: 252 PETKPEEKPEVKPDPKPETKPEEKPEVKPDPK-PETKPEEKPEVKPDPKPETKPEEKP-E 309

Query: 187 ATETIVPQELNSDNASSVDQ 206
                 P+     +AS  ++
Sbjct: 310 TKPETKPEVPAGLDASLANE 329


>gi|260814161|ref|XP_002601784.1| hypothetical protein BRAFLDRAFT_121172 [Branchiostoma floridae]
 gi|229287086|gb|EEN57796.1| hypothetical protein BRAFLDRAFT_121172 [Branchiostoma floridae]
          Length = 1063

 Score = 47.2 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/97 (22%), Positives = 36/97 (37%), Gaps = 3/97 (3%)

Query: 115 ALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLR-PR 173
           A     + P P   E ++P     +  +  D     P+  R +     K   RRP   P 
Sbjct: 99  APGPTPSQPRPQ-SERQQPDDLPPVDYESVDETNAAPEPPRYERAIRPKTALRRPGAPPS 157

Query: 174 VFPNAKSGNQPVEATETIVPQELNSD-NASSVDQDCK 209
             P++KSG+ P +     +    N D +  S+D    
Sbjct: 158 GRPSSKSGDTPKKKAPESIASTKNDDIDNQSIDSTFS 194


>gi|115523562|ref|YP_780473.1| hypothetical protein RPE_1543 [Rhodopseudomonas palustris BisA53]
 gi|115517509|gb|ABJ05493.1| tetratricopeptide TPR_2 [Rhodopseudomonas palustris BisA53]
          Length = 1290

 Score = 46.8 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 23/83 (27%), Positives = 31/83 (37%), Gaps = 7/83 (8%)

Query: 109 KERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREK-------DVSY 161
           ++    A SE EASP    E   EP  E   +PKVE       +   E            
Sbjct: 330 RQMKSEANSEAEASPEASPEAKPEPKVEPKPEPKVEPKVEAKVEAKLEPIVEAKAEPTPE 389

Query: 162 KKVRRRRPLRPRVFPNAKSGNQP 184
            K + +   +P V P AK   +P
Sbjct: 390 IKPQTKPAPQPDVKPEAKIEAKP 412



 Score = 38.4 bits (87), Expect = 0.60,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 32/90 (35%), Gaps = 13/90 (14%)

Query: 106 KEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQ--------PKVEDVAFKTPDISREK 157
           +   E   +  +  EA P P +E   EP  E  ++        P VE  A  TP+I    
Sbjct: 335 EANSEAEASPEASPEAKPEPKVEPKPEPKVEPKVEAKVEAKLEPIVEAKAEPTPEIK--- 391

Query: 158 DVSYKKVRRRRPLRPRVFPNAKSGNQPVEA 187
                K   +  ++P     AK    P  A
Sbjct: 392 --PQTKPAPQPDVKPEAKIEAKPDAVPEPA 419


>gi|158295816|ref|XP_316438.4| AGAP006405-PA [Anopheles gambiae str. PEST]
 gi|157016218|gb|EAA10736.4| AGAP006405-PA [Anopheles gambiae str. PEST]
          Length = 736

 Score = 46.8 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 16/93 (17%), Positives = 37/93 (39%), Gaps = 1/93 (1%)

Query: 115 ALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRV 174
             S  E++P P  E   EP   ++ +   +     +P+++ E               P  
Sbjct: 34  PESTPESAPEPTPESAPEPTSVSAPESAPKSAPESSPELAPES-APESAPESAPESAPES 92

Query: 175 FPNAKSGNQPVEATETIVPQELNSDNASSVDQD 207
            P +   ++ + A+E+      N+++ S ++ D
Sbjct: 93  TPESAPESESIPASESAPELIPNTESESGIEAD 125


>gi|295693516|ref|YP_003602126.1| mucus-binding protein [Lactobacillus crispatus ST1]
 gi|295031622|emb|CBL51101.1| Mucus-binding protein [Lactobacillus crispatus ST1]
          Length = 3552

 Score = 46.8 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 15/63 (23%), Positives = 22/63 (34%), Gaps = 1/63 (1%)

Query: 123  PCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGN 182
            P P  E   +P  E   +P  E    K PD   + D   K  +  +P +P      K  +
Sbjct: 3391 PTPEPEPQPKPTPEPQPKPNPEPKPDK-PDKPNKPDRPNKPAKPDKPAKPNKESEKKHNH 3449

Query: 183  QPV 185
               
Sbjct: 3450 SKA 3452


>gi|190015625|ref|YP_001967238.1| surface layer domain protein [Bacillus cereus]
 gi|217956748|ref|YP_002335842.1| surface layer domain protein [Bacillus cereus AH187]
 gi|116584532|gb|ABK00649.1| surface layer domain protein [Bacillus cereus]
 gi|217068404|gb|ACJ82652.1| surface layer domain protein [Bacillus cereus AH187]
          Length = 444

 Score = 46.5 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 18/94 (19%), Positives = 39/94 (41%), Gaps = 1/94 (1%)

Query: 114 NALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSY-KKVRRRRPLRP 172
           N+++  E    P ++   +P  +   +P+V+           + +V    K   +   +P
Sbjct: 204 NSINAVEKEEKPEVKPDPKPETKPEEKPEVKPDPKPETKPEEKPEVKPDPKPETKPEEKP 263

Query: 173 RVFPNAKSGNQPVEATETIVPQELNSDNASSVDQ 206
            V P+ K   +P E  E     +  ++  SS+D+
Sbjct: 264 EVKPDPKPETKPEEKPEVKPDPKPETNLPSSIDK 297



 Score = 40.3 bits (92), Expect = 0.19,   Method: Composition-based stats.
 Identities = 24/126 (19%), Positives = 40/126 (31%), Gaps = 26/126 (20%)

Query: 68  VVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLI 127
           V  E + Q       + +   A  +E+    + D     + +E+        E  P P  
Sbjct: 193 VTREAYSQF------LFNSINAVEKEEKPEVKPDPKPETKPEEKP-------EVKPDPKP 239

Query: 128 EEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEA 187
           E   E   E    PK E    + P++  +              +P   P  K   +P   
Sbjct: 240 ETKPEEKPEVKPDPKPETKPEEKPEVKPDP-------------KPETKPEEKPEVKPDPK 286

Query: 188 TETIVP 193
            ET +P
Sbjct: 287 PETNLP 292


>gi|190348740|gb|EDK41258.2| hypothetical protein PGUG_05356 [Meyerozyma guilliermondii ATCC 6260]
          Length = 1460

 Score = 46.5 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 29/173 (16%), Positives = 54/173 (31%), Gaps = 24/173 (13%)

Query: 1    MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYD-SNGYDVK--VRGTAQHIAERYSVL 57
            +R  +Q K+ + +           KNL     +YD S+    +  +R +     + Y+  
Sbjct: 1211 LRLAEQEKQEQLKLKIEKENKEREKNLQSAALSYDDSSRPSSRTDIRKSEPKRYDYYNKY 1270

Query: 58   ARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALS 117
                 S  D   AE            V  A  +  ++++ + + +   K  KE  +   S
Sbjct: 1271 E---GSTTDSTNAEK-----------VQKASNEEDDQMEIERESETNDKSAKEAKEAEES 1316

Query: 118  EFEASPCPLIEEGK-------EPIFENSIQPKVEDVAFKTPDISREKDVSYKK 163
              E    P  EE         +   +    P  +     TP+          K
Sbjct: 1317 NKETKDEPRKEEKPDIKQRIEQAKRKLRDSPTPQSSKTATPEPDLFPSAPSAK 1369


>gi|228938205|ref|ZP_04100820.1| hypothetical protein bthur0008_8730 [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228971083|ref|ZP_04131716.1| hypothetical protein bthur0003_8650 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228788606|gb|EEM36552.1| hypothetical protein bthur0003_8650 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228821438|gb|EEM67448.1| hypothetical protein bthur0008_8730 [Bacillus thuringiensis serovar
           berliner ATCC 10792]
          Length = 473

 Score = 46.5 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 22/88 (25%), Positives = 34/88 (38%), Gaps = 13/88 (14%)

Query: 120 EASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAK 179
           E  P P  E   E   E    PK E    + P++         K   +   +P V P+ K
Sbjct: 253 EVKPDPKPETKPEEKPEVKPDPKPETKPEEKPEVK-----PDPKPETKPEEKPEVKPDLK 307

Query: 180 SGNQPVEATETIVPQELNSDNASSVDQD 207
              +P E  +T +P        S++D+D
Sbjct: 308 PETKPEEKPDTNLP--------SNIDKD 327


>gi|229142380|ref|ZP_04270898.1| Surface layer protein [Bacillus cereus BDRD-ST26]
 gi|228641093|gb|EEK97406.1| Surface layer protein [Bacillus cereus BDRD-ST26]
          Length = 449

 Score = 46.5 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 18/94 (19%), Positives = 39/94 (41%), Gaps = 1/94 (1%)

Query: 114 NALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSY-KKVRRRRPLRP 172
           N+++  E    P ++   +P  +   +P+V+           + +V    K   +   +P
Sbjct: 209 NSINAVEKEEKPEVKPDPKPETKPEEKPEVKPDPKPETKPEEKPEVKPDPKPETKPEEKP 268

Query: 173 RVFPNAKSGNQPVEATETIVPQELNSDNASSVDQ 206
            V P+ K   +P E  E     +  ++  SS+D+
Sbjct: 269 EVKPDPKPETKPEEKPEVKPDPKPETNLPSSIDK 302



 Score = 39.9 bits (91), Expect = 0.22,   Method: Composition-based stats.
 Identities = 22/126 (17%), Positives = 42/126 (33%), Gaps = 26/126 (20%)

Query: 68  VVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLI 127
           V  E + Q        ++  + + + +++ D + +   +E+ E            P P  
Sbjct: 198 VTREAYSQF---LFNSINAVEKEEKPEVKPDPKPETKPEEKPE----------VKPDPKP 244

Query: 128 EEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEA 187
           E   E   E    PK E    + P++  +              +P   P  K   +P   
Sbjct: 245 ETKPEEKPEVKPDPKPETKPEEKPEVKPDP-------------KPETKPEEKPEVKPDPK 291

Query: 188 TETIVP 193
            ET +P
Sbjct: 292 PETNLP 297


>gi|58262694|ref|XP_568757.1| hypothetical protein [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|57223407|gb|AAW41450.1| conserved hypothetical protein [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 1608

 Score = 46.5 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 19/97 (19%), Positives = 39/97 (40%), Gaps = 6/97 (6%)

Query: 80  YNRIVSMAQAQIQEKLQRDE---QDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFE 136
           Y R       + +++  +D    +D+ +  E  E+ +  L   ++ P P  E  ++   E
Sbjct: 2   YTR---TTMEEGEQQHTQDPPRVRDEPVGGEASEQGKQQLETAQSEPEPQTEPQQQAQLE 58

Query: 137 NSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPR 173
              Q + E    + P    +      +  +RRPL P+
Sbjct: 59  QPSQLQPEATPQQQPQEGSQGAPEPPRPAKRRPLPPK 95


>gi|238499341|ref|XP_002380905.1| tRNA-splicing endonuclease, putative [Aspergillus flavus NRRL3357]
 gi|220692658|gb|EED49004.1| tRNA-splicing endonuclease, putative [Aspergillus flavus NRRL3357]
          Length = 2122

 Score = 46.1 bits (107), Expect = 0.003,   Method: Composition-based stats.
 Identities = 24/135 (17%), Positives = 48/135 (35%), Gaps = 12/135 (8%)

Query: 81   NRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPC-PLIEEGKEPIFENSI 139
             R++S    Q ++++ R+E     +++Q+   Q A       P  P+I+       +   
Sbjct: 1887 TRVLS---KQEKQRIAREEYHHTQMQKQRAERQRARQLGGHDPKVPVIQVTSGSNEKKPE 1943

Query: 140  QPKVEDVAFKTPDISREKDVSYKKVRRRR-------PLRPRVFPNAKSGNQPVEATETIV 192
            QPK +           +   S      +R       P  P+  P  K        TE +V
Sbjct: 1944 QPKTDSSKGAAKRKHTDSPSSDTAKPPKRKIDQKVPPTAPK-NPRRKIDANVPPKTEDLV 2002

Query: 193  PQELNSDNASSVDQD 207
                +    + ++Q+
Sbjct: 2003 KPSRDGPAYAPINQN 2017


>gi|18495779|emb|CAC87478.1| surface protein [Theileria annulata]
          Length = 313

 Score = 46.1 bits (107), Expect = 0.003,   Method: Composition-based stats.
 Identities = 19/109 (17%), Positives = 36/109 (33%), Gaps = 4/109 (3%)

Query: 90  QIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFK 149
                  +   D   + +Q E++Q    +    P    +   EP     +QP+   V   
Sbjct: 33  DFDPNDDQQPLDPNQLMDQIEQSQEDTQQEPIEPQQPTQPSTEP---EELQPETVTVEVP 89

Query: 150 TPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
            P  S E   S +   ++    P   P  +  ++P        P + +S
Sbjct: 90  EPVTSEEPKESDQTEEQKHE-EPEASPAPEPVDEPAVHATESTPTKASS 137


>gi|30910869|gb|AAP36993.1| surface protein [Theileria sp. China 1]
          Length = 312

 Score = 46.1 bits (107), Expect = 0.003,   Method: Composition-based stats.
 Identities = 19/109 (17%), Positives = 36/109 (33%), Gaps = 4/109 (3%)

Query: 90  QIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFK 149
                  +   D   + +Q E++Q    +    P    +   EP     +QP+   V   
Sbjct: 33  DFDPNDDQQPLDPNQLMDQIEQSQEDTQQEPIEPQQPTQPSTEP---EELQPETVTVEVP 89

Query: 150 TPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
            P  S E   S +   ++    P   P  +  ++P        P + +S
Sbjct: 90  EPVTSEEPKESDQTEEQKHE-EPEASPAPEPVDEPAVHATESTPTKASS 137


>gi|18495757|emb|CAC87576.1| surface protein [Theileria annulata]
          Length = 312

 Score = 46.1 bits (107), Expect = 0.003,   Method: Composition-based stats.
 Identities = 19/109 (17%), Positives = 36/109 (33%), Gaps = 4/109 (3%)

Query: 90  QIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFK 149
                  +   D   + +Q E++Q    +    P    +   EP     +QP+   V   
Sbjct: 33  DFDPNDDQQPLDPNQLMDQIEQSQEDTQQEPIEPQQPTQPSTEP---EELQPETVTVEVP 89

Query: 150 TPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
            P  S E   S +   ++    P   P  +  ++P        P + +S
Sbjct: 90  EPVTSEEPKESDQTEEQKHE-EPEASPAPEPVDEPAVHATESTPTKASS 137


>gi|225023361|ref|ZP_03712553.1| hypothetical protein EIKCOROL_00219 [Eikenella corrodens ATCC
           23834]
 gi|224943839|gb|EEG25048.1| hypothetical protein EIKCOROL_00219 [Eikenella corrodens ATCC
           23834]
          Length = 1232

 Score = 46.1 bits (107), Expect = 0.003,   Method: Composition-based stats.
 Identities = 24/131 (18%), Positives = 49/131 (37%), Gaps = 12/131 (9%)

Query: 84  VSMAQAQIQEKLQRD--EQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQP 141
           +S  Q ++++  +R    +  L   E  E  Q+     +A P  L + G +P   ++ QP
Sbjct: 33  LSRLQKEVEQLRRRQPLREQRLAESESSELRQSE----QAVPQHLGQAGLQPNAPSAAQP 88

Query: 142 KVE------DVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQE 195
                    +V       + +  V+           P    +  + +QP EA    +P +
Sbjct: 89  DFSGWPYNPNVPTSAAASAPQPSVAAFDAIPSAAAGPAQSAHLAAHSQPAEAAVHPLPAQ 148

Query: 196 LNSDNASSVDQ 206
               + S+ +Q
Sbjct: 149 SGQSSQSTFEQ 159


>gi|228918950|ref|ZP_04082335.1| hypothetical protein bthur0012_60530 [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
 gi|228840752|gb|EEM86009.1| hypothetical protein bthur0012_60530 [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
          Length = 480

 Score = 45.7 bits (106), Expect = 0.004,   Method: Composition-based stats.
 Identities = 25/142 (17%), Positives = 49/142 (34%), Gaps = 15/142 (10%)

Query: 67  YVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPL 126
           +V  E + Q        ++  + + + +++ D + +   +E+ E            P P 
Sbjct: 214 HVTREQYSQF---LYNSINAVEKETKPEVKPDPKPETKPEEKPE----------VKPNPK 260

Query: 127 IEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVE 186
            E   E   E    PK E    + P++  +      K   +  ++P   P  K   +P E
Sbjct: 261 PETKPEEKPEVKPDPKPETKPEEKPEVKPDPK-PETKPEEKPEVKPDPKPETKPEEKP-E 318

Query: 187 ATETIVPQELNSDNASSVDQDC 208
                 P+     + S V  D 
Sbjct: 319 VKPDPKPEVPAGLDESLVQPDF 340


>gi|44004399|ref|NP_982067.1| surface layer protein [Bacillus cereus ATCC 10987]
 gi|42741465|gb|AAS44910.1| surface layer protein [Bacillus cereus ATCC 10987]
          Length = 484

 Score = 45.7 bits (106), Expect = 0.004,   Method: Composition-based stats.
 Identities = 27/149 (18%), Positives = 56/149 (37%), Gaps = 12/149 (8%)

Query: 67  YVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEF------E 120
           +V  E + Q        ++  + + + +++ D + +   +E+ E   +   E       E
Sbjct: 192 HVTREQYSQF---LYNSINAVEKETKPEVKPDPKSETKPEEKPEVKPDPKPETKPEEKPE 248

Query: 121 ASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPL---RPRVFPN 177
             P P  E   E   E    PK E    + P++  +     K   +       +P   P 
Sbjct: 249 VKPDPKPETKPEEKPEVKPDPKPETKLEEKPEVKPDPKPETKPEEKPEVKPDPKPETKPE 308

Query: 178 AKSGNQPVEATETIVPQELNSDNASSVDQ 206
            K   +P    ET   ++ +++  SS+D+
Sbjct: 309 EKPEVKPDPKPETKPEEKPDTNLPSSIDK 337


>gi|126652635|ref|ZP_01724799.1| hypothetical protein BB14905_19710 [Bacillus sp. B14905]
 gi|126590626|gb|EAZ84743.1| hypothetical protein BB14905_19710 [Bacillus sp. B14905]
          Length = 1722

 Score = 45.7 bits (106), Expect = 0.004,   Method: Composition-based stats.
 Identities = 14/96 (14%), Positives = 26/96 (27%), Gaps = 5/96 (5%)

Query: 111  RAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKV-RRRRP 169
               +  +       P+      P  E  I P   +     P+   + +       +   P
Sbjct: 1530 NPTDPDNPTSEPGQPVDPNKPNPDPEKPIDP---NKPNPDPEKPVDPNKPNPDPNKPVGP 1586

Query: 170  LRPRVFPNAKSG-NQPVEATETIVPQELNSDNASSV 204
             +P   PN     N+P   T           +  +V
Sbjct: 1587 NKPNPDPNKPVEPNKPKPDTNKPTTPGNGGTSVQNV 1622


>gi|134108756|ref|XP_777031.1| hypothetical protein CNBB5570 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50259714|gb|EAL22384.1| hypothetical protein CNBB5570 [Cryptococcus neoformans var.
           neoformans B-3501A]
          Length = 1561

 Score = 45.7 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 17/89 (19%), Positives = 37/89 (41%), Gaps = 3/89 (3%)

Query: 88  QAQIQEKLQRDE---QDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
             + +++  +D    +D+ +  E  E+ +  L   ++ P P  E  ++   E   Q + E
Sbjct: 1   MEEGEQQHTQDPPRVRDEPVGGEASEQGKQQLETAQSEPEPQTEPQQQAQLEQPSQLQPE 60

Query: 145 DVAFKTPDISREKDVSYKKVRRRRPLRPR 173
               + P    +      +  +RRPL P+
Sbjct: 61  ATPQQQPQEGSQGAPEPPRPAKRRPLPPK 89


>gi|149636104|ref|XP_001509618.1| PREDICTED: similar to lipin 3 [Ornithorhynchus anatinus]
          Length = 927

 Score = 45.3 bits (105), Expect = 0.005,   Method: Composition-based stats.
 Identities = 18/92 (19%), Positives = 37/92 (40%), Gaps = 1/92 (1%)

Query: 115 ALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPR- 173
                +     L EEG EP+   + QP +E+     P       +  +    R+   P  
Sbjct: 367 GRLPQKGEGADLEEEGPEPVVVGAPQPGMEEGQMPPPGAVGTPPLPPRARWPRKARDPSG 426

Query: 174 VFPNAKSGNQPVEATETIVPQELNSDNASSVD 205
               A+ G   ++ ++ + P ++  D+ +S+D
Sbjct: 427 REWRAERGKGSLKRSQHLGPSDIYLDDLASLD 458


>gi|75758524|ref|ZP_00738644.1| Collagen adhesion protein [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|228903836|ref|ZP_04067951.1| Lpxtg-motif cell wall anchor domain protein [Bacillus thuringiensis
           IBL 4222]
 gi|74493958|gb|EAO57054.1| Collagen adhesion protein [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|228855745|gb|EEN00290.1| Lpxtg-motif cell wall anchor domain protein [Bacillus thuringiensis
           IBL 4222]
          Length = 3232

 Score = 45.3 bits (105), Expect = 0.005,   Method: Composition-based stats.
 Identities = 22/131 (16%), Positives = 49/131 (37%), Gaps = 14/131 (10%)

Query: 92  QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIF-----ENSIQPKVEDV 146
             K    EQ +   ++  E+ ++  ++ + +  P     ++P       E   +P  +  
Sbjct: 195 DAKQTTKEQKNGDAQQPTEQPKDGETQQKPAEQPKDGNPQQPAKHSKDGETQQKPAEQPK 254

Query: 147 AFKTPDISREKDVSYKKVRRRRPL-----RPRVFPNAKSGNQPVEATETIVPQELNSDNA 201
              T   + +      +    +P      +P   P   +  QPVE  +   P+++  +  
Sbjct: 255 DGNTQQPAEQPKNGNPQQPTEQPKDGGTQQPTENPGDNTTGQPVENPDPS-PKQIKENIL 313

Query: 202 SSV---DQDCK 209
           +SV   D+D K
Sbjct: 314 TSVKLTDKDGK 324


>gi|225856358|ref|YP_002737869.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae P1031]
 gi|225725142|gb|ACO20994.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae P1031]
          Length = 1880

 Score = 45.3 bits (105), Expect = 0.005,   Method: Composition-based stats.
 Identities = 28/132 (21%), Positives = 48/132 (36%), Gaps = 11/132 (8%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPC----PLIEEGKEPIFENSIQ 140
           +  QA+ + ++   E+       + E +     + E  P     P +EEGKE   E +  
Sbjct: 186 NQEQARTENQVVETEEAPKEEAPKTEESPKEEPKSEVKPTDDTLPKVEEGKEDSAEPAPV 245

Query: 141 PKVEDVAFKTPDISR-EKDVSYKKVRRRRPLR--PRVFPNAKSGNQPVEATET---IVPQ 194
            +V       P+     K  S    +     +  P V   AK   QPV+ T+      P+
Sbjct: 246 EEVGGEVESKPEEKVAVKPESQPSDKPAEESKVEPPV-EQAKVPEQPVQPTQAEQPSTPK 304

Query: 195 ELNSDNASSVDQ 206
           E +       D+
Sbjct: 305 ESSQQENPKEDR 316


>gi|281212041|gb|EFA86202.1| Ras GTPase domain-containing protein [Polysphondylium pallidum PN500]
          Length = 4267

 Score = 45.3 bits (105), Expect = 0.006,   Method: Composition-based stats.
 Identities = 22/121 (18%), Positives = 43/121 (35%), Gaps = 3/121 (2%)

Query: 87   AQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDV 146
            A++  +E  ++DE+    V+E+    Q  + E      P   E ++P  E       +  
Sbjct: 1084 AKSVAEEDKKKDEEQPK-VEEKPVEEQPKVEEKPVEEQPKSTEEQQPKVEEPKPVDEQPK 1142

Query: 147  AFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQ 206
              + P    E+     K    +P             +   A E  V       +A++V++
Sbjct: 1143 VEEKP--VEEQPKVEDKPVEEQPKSEEQKSEVVESPKVEGAEEKKVETVAEEVSAATVEK 1200

Query: 207  D 207
            D
Sbjct: 1201 D 1201



 Score = 40.3 bits (92), Expect = 0.17,   Method: Composition-based stats.
 Identities = 19/113 (16%), Positives = 40/113 (35%), Gaps = 11/113 (9%)

Query: 93   EKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPD 152
             K++   +      ++K+  Q  + E      P +EE  +P+ E     + +    + P 
Sbjct: 1078 SKVEEPAKSVAEEDKKKDEEQPKVEEKPVEEQPKVEE--KPVEEQPKSTEEQQPKVEEPK 1135

Query: 153  ISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVD 205
               E+    +K    +P         K  ++PVE       Q+     +  V+
Sbjct: 1136 PVDEQPKVEEKPVEEQP---------KVEDKPVEEQPKSEEQKSEVVESPKVE 1179


>gi|46123707|ref|XP_386407.1| hypothetical protein FG06231.1 [Gibberella zeae PH-1]
          Length = 769

 Score = 45.3 bits (105), Expect = 0.006,   Method: Composition-based stats.
 Identities = 14/92 (15%), Positives = 30/92 (32%), Gaps = 8/92 (8%)

Query: 117 SEFEASPCPLIEEGKEPIFENSIQP--------KVEDVAFKTPDISREKDVSYKKVRRRR 168
           S  +    P  +   +P+F  +++            D     P   +      +    ++
Sbjct: 81  SPSKPVSQPATQPAAQPMFRPALKASALRGTIWDTGDSKRSYPLPKKVGVSRPRTASPKK 140

Query: 169 PLRPRVFPNAKSGNQPVEATETIVPQELNSDN 200
           P  PR  P  K   +P  A +  +  +  S +
Sbjct: 141 PAAPRGRPRKKKVEEPAPAADDGLSAKQESID 172


>gi|254565591|ref|XP_002489906.1| Subunit of the THO complex [Pichia pastoris GS115]
 gi|238029702|emb|CAY67625.1| Subunit of the THO complex [Pichia pastoris GS115]
 gi|328350317|emb|CCA36717.1| Uncharacterized protein C1D4.14 [Pichia pastoris CBS 7435]
          Length = 1636

 Score = 44.9 bits (104), Expect = 0.006,   Method: Composition-based stats.
 Identities = 26/122 (21%), Positives = 50/122 (40%), Gaps = 11/122 (9%)

Query: 86   MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVED 145
              +   +EK +R ++ + +  + KE+ Q    + E     + E+      EN  +   E 
Sbjct: 1335 EHKRTKEEKRERQKEKERVRMKDKEKQQEKEGDIEKDTDKVTEK------ENKKESPKEK 1388

Query: 146  VAFKTPDISREKDVSY---KKVRRRRPLRPRVFPNA--KSGNQPVEATETIVPQELNSDN 200
               K P+   E+  S    K+++ R   RPR   N   +  ++    T++  P   N DN
Sbjct: 1389 ENEKAPEKRVEEVSSEGKGKEIKDREQERPRSSENDLKEDSSKRRVDTKSDTPPHSNQDN 1448

Query: 201  AS 202
            + 
Sbjct: 1449 SE 1450


>gi|189194551|ref|XP_001933614.1| dihydrolipoamide succinyltransferase [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187979178|gb|EDU45804.1| dihydrolipoamide succinyltransferase [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 461

 Score = 44.9 bits (104), Expect = 0.006,   Method: Composition-based stats.
 Identities = 22/106 (20%), Positives = 44/106 (41%), Gaps = 2/106 (1%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
           + A+ + +E    +++     + Q+E+++    E +  P P  EE  +P  E+  QPK E
Sbjct: 155 TEAKDEPKEPASSEQETSSQPEGQQEKSEAPKEESKPEP-PKQEEKPQPTKESKPQPKKE 213

Query: 145 DVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATET 190
                 P  +       ++V+  R +R R+    K       +  T
Sbjct: 214 SKPQDEPKPATPGSREERRVKMNR-MRLRIAERLKQSQNTAASLTT 258



 Score = 38.0 bits (86), Expect = 0.93,   Method: Composition-based stats.
 Identities = 17/94 (18%), Positives = 38/94 (40%), Gaps = 3/94 (3%)

Query: 98  DEQDDLLVKEQKERAQNA-LSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTP--DIS 154
           +E+D + V ++  R +    +  +       +E      E S QP+ +    + P  +  
Sbjct: 131 NEEDTVTVGQEIVRLEAGGEAPAKTEAKDEPKEPASSEQETSSQPEGQQEKSEAPKEESK 190

Query: 155 REKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEAT 188
            E     +K +  +  +P+    +K  ++P  AT
Sbjct: 191 PEPPKQEEKPQPTKESKPQPKKESKPQDEPKPAT 224


>gi|117956299|gb|ABK58721.1| surface protein [Theileria annulata]
          Length = 314

 Score = 44.9 bits (104), Expect = 0.006,   Method: Composition-based stats.
 Identities = 17/105 (16%), Positives = 31/105 (29%), Gaps = 10/105 (9%)

Query: 102 DLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSY 161
           D    +Q       + + E S  P  +E  EP  +   QP  E        ++ E     
Sbjct: 35  DPNDDQQPLDPNQLIDQEEPSEQPTQQEPIEP--QQPTQPSTEPEELDPETVTVEVPEPV 92

Query: 162 KKVRRRRPLR--------PRVFPNAKSGNQPVEATETIVPQELNS 198
                +   +        P   P  +  ++P        P + +S
Sbjct: 93  TSEESKESDQTEEQKHEEPEASPVPEPVDEPAVQATESTPTKASS 137


>gi|317150187|ref|XP_001823850.2| tRNA-splicing endonuclease [Aspergillus oryzae RIB40]
          Length = 2103

 Score = 44.9 bits (104), Expect = 0.006,   Method: Composition-based stats.
 Identities = 24/135 (17%), Positives = 48/135 (35%), Gaps = 12/135 (8%)

Query: 81   NRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPC-PLIEEGKEPIFENSI 139
             R++S    Q ++++ R+E     +++Q+   Q A       P  P+I+       +   
Sbjct: 1929 TRVLS---KQEKQRIAREEYHHTQMQKQRAERQRARQLGGHDPKVPVIQVTSGSNEKKPE 1985

Query: 140  QPKVEDVAFKTPDISREKDVSYKKVRRRR-------PLRPRVFPNAKSGNQPVEATETIV 192
            QPK +           +   S      +R       P  P+  P  K        TE +V
Sbjct: 1986 QPKTDSSKGAAKRKHTDSPSSDTAKPPKRKIDQKVPPTAPK-NPRRKIDANVPPKTEDLV 2044

Query: 193  PQELNSDNASSVDQD 207
                +    + ++Q+
Sbjct: 2045 KPSRDGPAYAPINQN 2059


>gi|269797105|ref|YP_003311005.1| hypothetical protein Vpar_0036 [Veillonella parvula DSM 2008]
 gi|269093734|gb|ACZ23725.1| hypothetical protein Vpar_0036 [Veillonella parvula DSM 2008]
          Length = 467

 Score = 44.9 bits (104), Expect = 0.007,   Method: Composition-based stats.
 Identities = 15/109 (13%), Positives = 39/109 (35%), Gaps = 3/109 (2%)

Query: 81  NRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQ 140
            ++++   A+      + +++     E  +       E + +P P+ +   +P  + + +
Sbjct: 341 FKVLTEGHAKEGAITWQADKNGQGKYEYGKVQPTPKPEVQPAPAPMPKPEVKPAPQPTPK 400

Query: 141 PKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATE 189
           P+V+     TP     K       +    ++P   P  K   +P     
Sbjct: 401 PEVKPAPVPTPKP-EVKPAPQPTPKPE--VKPAPVPTPKPEVKPAPQPT 446



 Score = 38.0 bits (86), Expect = 0.96,   Method: Composition-based stats.
 Identities = 13/64 (20%), Positives = 22/64 (34%), Gaps = 5/64 (7%)

Query: 123 PCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGN 182
           P P  E    P  + + +P+V+     TP     K       +    ++P   P  K   
Sbjct: 409 PTPKPEVKPAP--QPTPKPEVKPAPVPTPKP-EVKPAPQPTPKPE--VKPAPVPTPKLEV 463

Query: 183 QPVE 186
           +P  
Sbjct: 464 KPTP 467


>gi|326439063|ref|NP_001191988.1| hypothetical protein LOC100161332 [Acyrthosiphon pisum]
          Length = 288

 Score = 44.9 bits (104), Expect = 0.007,   Method: Composition-based stats.
 Identities = 17/94 (18%), Positives = 37/94 (39%), Gaps = 3/94 (3%)

Query: 105 VKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKV 164
           V+  +E       E +  P P +    +P  +   QP+V+   +  P    +  V+ ++ 
Sbjct: 86  VEPHREVQNPPPQEVQHPPQPDVHYPPQPDVQYPPQPEVQ---YPVPQQEGQPPVAPQQE 142

Query: 165 RRRRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
            +  PL+  ++P    G +P +     +    N 
Sbjct: 143 VQNTPLQQPLYPPQHEGQRPAQPNVEQILPSSNE 176


>gi|209527769|ref|ZP_03276263.1| FHA domain containing protein [Arthrospira maxima CS-328]
 gi|209491802|gb|EDZ92163.1| FHA domain containing protein [Arthrospira maxima CS-328]
          Length = 526

 Score = 44.9 bits (104), Expect = 0.008,   Method: Composition-based stats.
 Identities = 21/91 (23%), Positives = 36/91 (39%), Gaps = 11/91 (12%)

Query: 120 EASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAK 179
           E+ P P+IE   EPI E+  +P +E      P+   E +          P+       A+
Sbjct: 180 ESEPEPIIESEPEPIIESEPEPIIE----SEPEPIIESEPEPVAESEPEPV-------AE 228

Query: 180 SGNQPVEATETIVPQELNSDNASSVDQDCKV 210
           S  +PV  +E     E   ++  S  +   +
Sbjct: 229 SEPEPVAESEPEPVAESEGEDEKSQSKIFGI 259



 Score = 41.1 bits (94), Expect = 0.098,   Method: Composition-based stats.
 Identities = 18/84 (21%), Positives = 31/84 (36%), Gaps = 5/84 (5%)

Query: 120 EASPCPLIEEGKEPIFENSIQP----KVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVF 175
           E+ P P+IE   EPI E+  +P    + E +    P+   E +          P+     
Sbjct: 140 ESEPEPIIESEPEPIIESEPEPIIESEPEPIIESEPEPIIESEPEPIIESEPEPII-ESE 198

Query: 176 PNAKSGNQPVEATETIVPQELNSD 199
           P     ++P    E+       S+
Sbjct: 199 PEPIIESEPEPIIESEPEPVAESE 222


>gi|229147897|ref|ZP_04276238.1| Lpxtg-motif cell wall anchor domain protein [Bacillus cereus
           BDRD-ST24]
 gi|228635547|gb|EEK92036.1| Lpxtg-motif cell wall anchor domain protein [Bacillus cereus
           BDRD-ST24]
          Length = 817

 Score = 44.9 bits (104), Expect = 0.008,   Method: Composition-based stats.
 Identities = 16/96 (16%), Positives = 37/96 (38%), Gaps = 4/96 (4%)

Query: 92  QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTP 151
             K   +EQ +   ++  E+ ++  ++ + +  P     ++P  + S   + +    + P
Sbjct: 195 DAKQTTEEQKNSDAQQPTEQPKDGETQQKPAEQPKDGNPQQPA-KQSKDGETQQKPAEQP 253

Query: 152 -DISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVE 186
            D + ++     K     P +P   P      QP E
Sbjct: 254 KDGNTQQPAEQPKD--GNPQQPTEQPKDGGTQQPTE 287



 Score = 37.6 bits (85), Expect = 1.1,   Method: Composition-based stats.
 Identities = 18/113 (15%), Positives = 34/113 (30%), Gaps = 8/113 (7%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
           +  Q   Q K    +Q      +     Q A    + +P    E   +P    + QP   
Sbjct: 232 NPQQPAKQSKDGETQQKPAEQPKDGNTQQPAEQPKDGNPQQPTE---QPKDGGTQQPTEN 288

Query: 145 DVAFKTPDISREKDVSYKKVRRRRPLRPRV-----FPNAKSGNQPVEATETIV 192
                T       D S K+++       ++      P   + N+P   +   +
Sbjct: 289 PGDNTTGQPVENPDPSPKQIKENILTSVKLTDKDGKPFNDTDNRPNPDSAANI 341


>gi|294792363|ref|ZP_06757510.1| putative autotransporter beta-domain [Veillonella sp. 6_1_27]
 gi|294456262|gb|EFG24625.1| putative autotransporter beta-domain [Veillonella sp. 6_1_27]
          Length = 789

 Score = 44.5 bits (103), Expect = 0.008,   Method: Composition-based stats.
 Identities = 22/134 (16%), Positives = 37/134 (27%), Gaps = 28/134 (20%)

Query: 100 QDDLLVKEQKERAQNALSEF-EASPCPLIEEGKE--PIFENSIQPKVEDVAFKTPDIS-- 154
           Q D   + + E  +   +   E  P P+     E  P  + + +P+V+     TP     
Sbjct: 357 QADKNGQGKYEYGKVQPTPKPEVKPAPVPTPKPEVKPAPQPTPKPEVKPAPVPTPKPEVK 416

Query: 155 ---------------------REKDVSYKKVRR--RRPLRPRVFPNAKSGNQPVEATETI 191
                                  K       +   +    P   P  K   QP   TE  
Sbjct: 417 PTPQPTPKPEVKPAPVPTPKPEVKPAPQPTPKPEVKPAPVPTPKPEVKPTPQPTPKTEEK 476

Query: 192 VPQELNSDNASSVD 205
               L  +   +V+
Sbjct: 477 QVPALEQNPQMNVN 490


>gi|148985247|ref|ZP_01818470.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae SP3-BS71]
 gi|147922445|gb|EDK73564.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae SP3-BS71]
 gi|301799702|emb|CBW32267.1| putative zinc metalloproteinase ZmpB [Streptococcus pneumoniae
           OXC141]
          Length = 1811

 Score = 44.5 bits (103), Expect = 0.008,   Method: Composition-based stats.
 Identities = 26/141 (18%), Positives = 50/141 (35%), Gaps = 18/141 (12%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPC----PLIEEGKEPIFENSIQ 140
           +  QA+ + ++   E+       + E +     + E  P     P +EEGKE   E S  
Sbjct: 186 NQEQARTENQVVETEEAPKEEAPKTEESPKEEPKSEVKPTDDTLPKVEEGKEDSAEPSPV 245

Query: 141 PKVEDVAFKTPD--------------ISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVE 186
            +V       P+               + E  V     + + P +P     A+  + P E
Sbjct: 246 EEVGGEVESKPEEKVAVKPESQPSDKPAEESKVEPPVEQAKVPEQPVQPTQAEQPSTPKE 305

Query: 187 ATETIVPQELNSDNASSVDQD 207
           +++   P+E      +   +D
Sbjct: 306 SSQQENPKEDRGAEETPKQED 326


>gi|146412730|ref|XP_001482336.1| hypothetical protein PGUG_05356 [Meyerozyma guilliermondii ATCC 6260]
          Length = 1460

 Score = 44.5 bits (103), Expect = 0.008,   Method: Composition-based stats.
 Identities = 31/175 (17%), Positives = 56/175 (32%), Gaps = 28/175 (16%)

Query: 1    MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYD-SNGYDVK--VRGTAQHIAERYSVL 57
            +R  +Q K+ + +           KNL     +YD S+    +  +R       + Y+  
Sbjct: 1211 LRLAEQEKQEQLKLKIEKENKEREKNLQSAALSYDDSSRPSSRTDIRKLEPKRYDYYNKY 1270

Query: 58   ARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALS 117
                 S  D   AE            V  A  +  ++++ + + +   K  KE  +   S
Sbjct: 1271 E---GSTTDSTNAEK-----------VQKASNEEDDQMEIERESETNDKSAKEAKEAEES 1316

Query: 118  EFEASPCPLIEEGKEPIFENSIQ---------PKVEDVAFKTPDISREKDVSYKK 163
              E    P  EE  +P  +  I+         P  +     TP+          K
Sbjct: 1317 NKETKDEPRKEE--KPDIKQRIEQAKRKLRDSPTPQSSKTATPEPDLFPLAPSAK 1369


>gi|149020278|ref|ZP_01835170.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae SP23-BS72]
 gi|147930580|gb|EDK81562.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae SP23-BS72]
          Length = 1822

 Score = 44.5 bits (103), Expect = 0.009,   Method: Composition-based stats.
 Identities = 29/132 (21%), Positives = 51/132 (38%), Gaps = 11/132 (8%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPC----PLIEEGKEPIFENSIQ 140
           +  QA+ + ++   E+       + E +     + E  P     P +EEGKE   E +  
Sbjct: 186 NQEQARTENQVVETEEAPKEEAPKTEESPKEEPKSEIKPTDDTLPKVEEGKEDSAEPAPV 245

Query: 141 PKVEDVAFKTPDISR-EKDVSYKKVRRRRPLR--PRVFPNAKSGNQPVEATET---IVPQ 194
            +V       P+     K  S    +     +  P V   AK   QPV+ T+      P+
Sbjct: 246 EEVGGEVESKPEEKVAVKPESQPSDKSAEESKVEPPV-EQAKVPEQPVQPTQAEQPSTPK 304

Query: 195 ELNSDNASSVDQ 206
           E + ++ S  D+
Sbjct: 305 ESSQEDNSKEDR 316


>gi|148989036|ref|ZP_01820436.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae SP6-BS73]
 gi|147925533|gb|EDK76610.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae SP6-BS73]
          Length = 1822

 Score = 44.5 bits (103), Expect = 0.009,   Method: Composition-based stats.
 Identities = 29/132 (21%), Positives = 51/132 (38%), Gaps = 11/132 (8%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPC----PLIEEGKEPIFENSIQ 140
           +  QA+ + ++   E+       + E +     + E  P     P +EEGKE   E +  
Sbjct: 186 NQEQARTENQVVETEEAPKEEAPKTEESPKEEPKSEIKPTDDTLPKVEEGKEDSAEPAPV 245

Query: 141 PKVEDVAFKTPDISR-EKDVSYKKVRRRRPLR--PRVFPNAKSGNQPVEATET---IVPQ 194
            +V       P+     K  S    +     +  P V   AK   QPV+ T+      P+
Sbjct: 246 EEVGGEVESKPEEKVAVKPESQPSDKSAEESKVEPPV-EQAKVPEQPVQPTQAEQPSTPK 304

Query: 195 ELNSDNASSVDQ 206
           E + ++ S  D+
Sbjct: 305 ESSQEDNSKEDR 316


>gi|296218926|ref|XP_002755627.1| PREDICTED: probable G-protein coupled receptor 152-like [Callithrix
           jacchus]
          Length = 471

 Score = 44.5 bits (103), Expect = 0.009,   Method: Composition-based stats.
 Identities = 24/94 (25%), Positives = 35/94 (37%), Gaps = 7/94 (7%)

Query: 117 SEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRP-----LR 171
           SE  A P P++E   +P  +   QP+V   A    D +    ++     +  P     L 
Sbjct: 337 SEDPALPGPMVE--AQPQMDPVAQPQVNPTAQPRSDPTAHAQLNPTAQPQSDPTAHAQLN 394

Query: 172 PRVFPNAKSGNQPVEATETIVPQELNSDNASSVD 205
           P   P +    QP   TE   P    S  +S  D
Sbjct: 395 PTAQPQSDPIAQPQSDTEAQTPGPAASSASSPCD 428


>gi|241889916|ref|ZP_04777214.1| putative iron ABC transporter permease [Gemella haemolysans ATCC
            10379]
 gi|241863538|gb|EER67922.1| putative iron ABC transporter permease [Gemella haemolysans ATCC
            10379]
          Length = 1278

 Score = 44.5 bits (103), Expect = 0.009,   Method: Composition-based stats.
 Identities = 14/85 (16%), Positives = 30/85 (35%), Gaps = 5/85 (5%)

Query: 123  PCPLIEEGKE--PIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKS 180
              P  EE  +  P  +   + K +    + P    EK  +    + +   +P++ P    
Sbjct: 1151 EQPKPEEKPQTTPSEQPKPEEKPQTTPSEQPKP-EEKPRTTPSEQPKPEEKPQITPEQPK 1209

Query: 181  GNQPVEATET--IVPQELNSDNASS 203
              +P E+       P   +  N+ +
Sbjct: 1210 AEKPQESPSEQPSTPSVDDKKNSDT 1234


>gi|322806536|emb|CBZ04105.1| hypothetical protein H04402_02297 [Clostridium botulinum H04402
           065]
          Length = 535

 Score = 44.5 bits (103), Expect = 0.009,   Method: Composition-based stats.
 Identities = 16/77 (20%), Positives = 33/77 (42%), Gaps = 3/77 (3%)

Query: 97  RDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISRE 156
           +++ +D    + +++ ++     E  P    E+  E   EN  + K ED     P+   E
Sbjct: 308 KNKPEDKTENKPEDKPEDKP---EDKPENKPEDKPEDKPENKPEDKPEDKPEDKPENKPE 364

Query: 157 KDVSYKKVRRRRPLRPR 173
                K+ + + P RP+
Sbjct: 365 DKPENKRPKAKSPKRPK 381



 Score = 39.1 bits (89), Expect = 0.39,   Method: Composition-based stats.
 Identities = 18/69 (26%), Positives = 26/69 (37%), Gaps = 1/69 (1%)

Query: 127 IEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVE 186
           I+   E   EN  + K ED     P+   E D    K   +   +P   P  K  N+P +
Sbjct: 307 IKNKPEDKTENKPEDKPEDKPEDKPENKPE-DKPEDKPENKPEDKPEDKPEDKPENKPED 365

Query: 187 ATETIVPQE 195
             E   P+ 
Sbjct: 366 KPENKRPKA 374



 Score = 38.4 bits (87), Expect = 0.60,   Method: Composition-based stats.
 Identities = 17/70 (24%), Positives = 23/70 (32%)

Query: 115 ALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRV 174
              + E  P    E+  E   EN  + K ED     P+   E     K   +        
Sbjct: 311 PEDKTENKPEDKPEDKPEDKPENKPEDKPEDKPENKPEDKPEDKPEDKPENKPEDKPENK 370

Query: 175 FPNAKSGNQP 184
            P AKS  +P
Sbjct: 371 RPKAKSPKRP 380


>gi|271968892|ref|YP_003343088.1| protein kinase [Streptosporangium roseum DSM 43021]
 gi|270512067|gb|ACZ90345.1| protein kinase [Streptosporangium roseum DSM 43021]
          Length = 572

 Score = 44.5 bits (103), Expect = 0.009,   Method: Composition-based stats.
 Identities = 16/90 (17%), Positives = 29/90 (32%), Gaps = 4/90 (4%)

Query: 114 NALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSY--KKVRRRRPLR 171
            ++   + +  P  E  +EP  E + +P         P  +          K    R  +
Sbjct: 374 ESVIPADETDEPTGEPSQEPSAEPTAEPTQTASPTAGPPTAAPTREPTATPKPSPSRSRK 433

Query: 172 PRVFPNAK--SGNQPVEATETIVPQELNSD 199
           P   P  K  + + P  +TE     +   D
Sbjct: 434 PTRAPTRKPTASSSPTPSTEESSTLDSADD 463


>gi|241022831|ref|XP_002406030.1| conserved hypothetical protein [Ixodes scapularis]
 gi|215491857|gb|EEC01498.1| conserved hypothetical protein [Ixodes scapularis]
          Length = 1255

 Score = 44.5 bits (103), Expect = 0.009,   Method: Composition-based stats.
 Identities = 17/80 (21%), Positives = 26/80 (32%), Gaps = 1/80 (1%)

Query: 119 FEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSY-KKVRRRRPLRPRVFPN 177
            E +P P  E   EP  E   +P  E     + + + E       K       +P   PN
Sbjct: 312 AEPAPEPSAEPVPEPSAEPVPEPSAEPAPQPSAEPAPEPSAEPAPKTLAEFQAKPTSKPN 371

Query: 178 AKSGNQPVEATETIVPQELN 197
            +   +P   +E     E  
Sbjct: 372 PEPSPEPHAPSEHTQKPESE 391



 Score = 39.5 bits (90), Expect = 0.27,   Method: Composition-based stats.
 Identities = 16/73 (21%), Positives = 24/73 (32%), Gaps = 1/73 (1%)

Query: 131 KEPIFENSIQPKVEDVAFKTPDISREK-DVSYKKVRRRRPLRPRVFPNAKSGNQPVEATE 189
            EP+ E S +P  E  A   P+ S E       +        P   P+A+   +P     
Sbjct: 296 AEPVLEPSAKPTPEPSAEPAPEPSAEPVPEPSAEPVPEPSAEPAPQPSAEPAPEPSAEPA 355

Query: 190 TIVPQELNSDNAS 202
                E  +   S
Sbjct: 356 PKTLAEFQAKPTS 368



 Score = 37.6 bits (85), Expect = 1.1,   Method: Composition-based stats.
 Identities = 10/77 (12%), Positives = 17/77 (22%), Gaps = 7/77 (9%)

Query: 118 EFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDI-------SREKDVSYKKVRRRRPL 170
           E  A P P       P       P+        P         +        +   +   
Sbjct: 301 EPSAKPTPEPSAEPAPEPSAEPVPEPSAEPVPEPSAEPAPQPSAEPAPEPSAEPAPKTLA 360

Query: 171 RPRVFPNAKSGNQPVEA 187
             +  P +K   +P   
Sbjct: 361 EFQAKPTSKPNPEPSPE 377


>gi|182683590|ref|YP_001835337.1| zinc metalloprotease ZmpB, putative [Streptococcus pneumoniae
           CGSP14]
 gi|303261342|ref|ZP_07347290.1| zinc metalloprotease ZmpB, putative [Streptococcus pneumoniae
           SP14-BS292]
 gi|303264008|ref|ZP_07349929.1| zinc metalloprotease ZmpB, putative [Streptococcus pneumoniae
           BS397]
 gi|303266322|ref|ZP_07352212.1| zinc metalloprotease ZmpB, putative [Streptococcus pneumoniae
           BS457]
 gi|303268789|ref|ZP_07354577.1| zinc metalloprotease ZmpB, putative [Streptococcus pneumoniae
           BS458]
 gi|182628924|gb|ACB89872.1| zinc metalloprotease ZmpB, putative [Streptococcus pneumoniae
           CGSP14]
 gi|301801527|emb|CBW34219.1| putative IgA-specific zinc metalloproteinase ZmpB [Streptococcus
           pneumoniae INV200]
 gi|302637476|gb|EFL67963.1| zinc metalloprotease ZmpB, putative [Streptococcus pneumoniae
           SP14-BS292]
 gi|302641654|gb|EFL72013.1| zinc metalloprotease ZmpB, putative [Streptococcus pneumoniae
           BS458]
 gi|302644133|gb|EFL74390.1| zinc metalloprotease ZmpB, putative [Streptococcus pneumoniae
           BS457]
 gi|302646413|gb|EFL76639.1| zinc metalloprotease ZmpB, putative [Streptococcus pneumoniae
           BS397]
          Length = 1980

 Score = 44.5 bits (103), Expect = 0.010,   Method: Composition-based stats.
 Identities = 21/125 (16%), Positives = 42/125 (33%), Gaps = 8/125 (6%)

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE-DVA 147
            +  EK   + +      E+++  +    + +  P  ++E   E   +   +PKVE    
Sbjct: 287 PREDEKAPVEPEKQPEAPEEEKAVEETPKQEDTQPE-VVETKDEAANQPVEEPKVETPAV 345

Query: 148 FKTPDISREKDVSY------KKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNA 201
            K  + + E  V         +   + P+ P   P A    +  E T     +       
Sbjct: 346 EKQTEPTEEPKVEQVGEPVEPREDEKAPVSPEKQPEAPEEEKTAEETPKQEDKIKGIGTK 405

Query: 202 SSVDQ 206
             VD+
Sbjct: 406 EPVDK 410


>gi|297688020|ref|XP_002821504.1| PREDICTED: probable G-protein coupled receptor 152-like [Pongo
           abelii]
          Length = 438

 Score = 44.5 bits (103), Expect = 0.010,   Method: Composition-based stats.
 Identities = 13/105 (12%), Positives = 31/105 (29%), Gaps = 2/105 (1%)

Query: 98  DEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREK 157
           +E+       + +   ++       P P  +   +P+ +  + P ++  +  T     + 
Sbjct: 319 EERPGSFTPAEPQTQLDSEGPTLPEPMPEAQPQMDPVAQPQVNPTLQPQSDPTAQPQSDT 378

Query: 158 DVSYKKVRRRRPLRPR--VFPNAKSGNQPVEATETIVPQELNSDN 200
            V            PR    P   S   P    +   P     ++
Sbjct: 379 KVQTPGPAASSVPSPRDEASPTPSSHPTPGAPEDPATPPASEGES 423


>gi|221059954|ref|XP_002260622.1| Flavin containing amine oxidoreductase [Plasmodium knowlesi strain H]
 gi|193810696|emb|CAQ42594.1| Flavin containing amine oxidoreductase,putative [Plasmodium knowlesi
            strain H]
          Length = 2180

 Score = 44.5 bits (103), Expect = 0.010,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 36/86 (41%), Gaps = 2/86 (2%)

Query: 66   DYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASP-C 124
            D ++ EN+  + E Y RIV  A   IQ K  +  Q  +    Q +  +  +      P  
Sbjct: 955  DSIIYENYYDYGEEYYRIVRKATQPIQPKATQPIQPKVNEPIQPKVNE-PIHPKVNEPIQ 1013

Query: 125  PLIEEGKEPIFENSIQPKVEDVAFKT 150
            P   E  +P   +SIQPK +     T
Sbjct: 1014 PNANEPIQPKATHSIQPKDKKDIKST 1039


>gi|168492261|ref|ZP_02716404.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae CDC0288-04]
 gi|183573511|gb|EDT94039.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae CDC0288-04]
          Length = 1865

 Score = 44.5 bits (103), Expect = 0.010,   Method: Composition-based stats.
 Identities = 28/149 (18%), Positives = 49/149 (32%), Gaps = 24/149 (16%)

Query: 77  AEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFE 136
           AE+    ++  QA+ + +    E+     +  KE  ++ +   + +  P +EEGKE   E
Sbjct: 178 AENPQVTINQEQAKAENQAVETEEAPKTEESPKEEPKSEIKPTDDT-LPKVEEGKEASAE 236

Query: 137 NSIQPKVEDVAFKTPDISR-EKDVSYKKVRRRR---------PLRPR----------VFP 176
            +   +V       P+     K  S    +            P+ PR            P
Sbjct: 237 PATVEEVGGEVESKPEEKVAVKPESQPSDKPAEESKVEQAGEPVAPREDEKAPVEPEKQP 296

Query: 177 NAKSGNQPVEAT---ETIVPQELNSDNAS 202
            A    + VE T   E   P     +   
Sbjct: 297 EAPEEEKAVEETPKQEESTPDTKAEETVE 325


>gi|332075958|gb|EGI86424.1| LPXTG-motif cell wall anchor domain protein [Streptococcus
           pneumoniae GA41301]
          Length = 1882

 Score = 44.1 bits (102), Expect = 0.010,   Method: Composition-based stats.
 Identities = 24/141 (17%), Positives = 51/141 (36%), Gaps = 18/141 (12%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPC----PLIEEGKEPIFENSIQ 140
           +  QA+ + ++   E+       + E +     + E  P     P +EEGKE   E++  
Sbjct: 186 NQEQARTENQVVETEEAPKEEAPRTEESPKEEPKSEVKPTDDTLPKVEEGKEDSVESAPV 245

Query: 141 PKVEDVAFKTPD--------------ISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVE 186
            +V       P+               + E +V     + + P +P     A+    P +
Sbjct: 246 EEVSGEVESKPEEKVAVKPESQPSDKQAEEPNVEPPVEQPKVPEQPVQPTQAEQPRIPKD 305

Query: 187 ATETIVPQELNSDNASSVDQD 207
           +++   P+E      +   +D
Sbjct: 306 SSQEDNPKEDRGAEETPKQED 326


>gi|254454321|ref|ZP_05067758.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
 gi|198268727|gb|EDY92997.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
          Length = 138

 Score = 44.1 bits (102), Expect = 0.011,   Method: Composition-based stats.
 Identities = 31/138 (22%), Positives = 50/138 (36%), Gaps = 9/138 (6%)

Query: 62  MSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRD---------EQDDLLVKEQKERA 112
           M A D V +EN  QHAEHY R+++ AQ +I  K +           EQD      Q ER 
Sbjct: 1   MLARDSVNSENFAQHAEHYTRMLAEAQKEIDAKREEQEKYNRERQIEQDKQNRDRQAERD 60

Query: 113 QNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRP 172
           +   +  +A                    +++D      +   E     +  ++RR  +P
Sbjct: 61  RERDARLKAQEEAAAAAPAPEPAPVEQPVQIDDGDSGLVETPEETPKLVEAPKKRRTRKP 120

Query: 173 RVFPNAKSGNQPVEATET 190
           +  P+      P      
Sbjct: 121 KARPDQPVEAGPTPDPAE 138


>gi|145344959|ref|XP_001416991.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144577217|gb|ABO95284.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 1362

 Score = 44.1 bits (102), Expect = 0.011,   Method: Composition-based stats.
 Identities = 38/208 (18%), Positives = 63/208 (30%), Gaps = 28/208 (13%)

Query: 13   RGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAEN 72
            RG  GG  S +R   NP+ R           R  A+   E  +    D+  + D++ A+ 
Sbjct: 808  RGDRGGAKSTSRS--NPVSRT---------ERNAAESALESGTQ--EDSQLSNDHIKAQK 854

Query: 73   HLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKER--------AQNALSEFEASPC 124
                A      ++ A         ++E +    +  +          AQN   +      
Sbjct: 855  LFAQASEDESALTPAPKVRTSAQNQEEDERQRSRPDRAETAPKVRTSAQNQEEDERQRSR 914

Query: 125  PLIEEGKEPIFENSIQPKVEDV-AFKTPDISREKD-----VSYKKVRRRRPLRPRVFPNA 178
            P   E   P    S Q + ED      PD +            ++   R+  RP     A
Sbjct: 915  PDRAETA-PKVRTSAQNQEEDERQRSRPDRAETAPKVRTSAQNQEEDERQRSRPDRAETA 973

Query: 179  KSGNQPVEATETIVPQELNSDNASSVDQ 206
                   +  E    Q    D A +  +
Sbjct: 974  PKVRTSAQNQEEDERQRSRPDRAETAPK 1001


>gi|15902625|ref|NP_358175.1| Zinc metalloprotease [Streptococcus pneumoniae R6]
 gi|116515780|ref|YP_816076.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae D39]
 gi|62512118|sp|Q8DQN5|ZMPB_STRR6 RecName: Full=Zinc metalloprotease zmpB; Flags: Precursor
 gi|15458161|gb|AAK99385.1| Zinc metalloprotease [Streptococcus pneumoniae R6]
 gi|116076356|gb|ABJ54076.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae D39]
          Length = 1876

 Score = 44.1 bits (102), Expect = 0.012,   Method: Composition-based stats.
 Identities = 28/137 (20%), Positives = 46/137 (33%), Gaps = 16/137 (11%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPC----PLIEEGKEPIFENSIQ 140
           +  QA+ + ++   E+       + E +     + E  P     P +EEGKE   E +  
Sbjct: 186 NQEQARTENQVVETEEAPKEEAPKTEESPKEEPKSEVKPTDDTLPKVEEGKEDSAEPAPV 245

Query: 141 PKVEDVAFKTPDISR-EKDVSYKKVRRRR---------PLRPRVFPNA--KSGNQPVEAT 188
            +V       P+     K  S    +            P+ PR    A  +  NQP    
Sbjct: 246 EEVGGEVESKPEEKVAVKPESQPSDKPAEESKVEQAGEPVAPRKDEQAPVEPENQPEAPE 305

Query: 189 ETIVPQELNSDNASSVD 205
           E    +E      S+ D
Sbjct: 306 EEKAVEETPKQEESTPD 322


>gi|228911197|ref|ZP_04075002.1| Lpxtg-motif cell wall anchor domain protein [Bacillus thuringiensis
           IBL 200]
 gi|228848373|gb|EEM93222.1| Lpxtg-motif cell wall anchor domain protein [Bacillus thuringiensis
           IBL 200]
          Length = 3153

 Score = 44.1 bits (102), Expect = 0.012,   Method: Composition-based stats.
 Identities = 23/141 (16%), Positives = 55/141 (39%), Gaps = 18/141 (12%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFE----NSIQ 140
           +  Q     +   ++Q D   ++  ++ ++  ++  A   P     ++P+ +    N+ Q
Sbjct: 200 TEEQKNGDAQQPTEQQKDGNPQKPAKQPKDGNTQQPAE-QPKNGNLQQPVEQPKDGNTQQ 258

Query: 141 PKVED------VAFKTP-DISREKDVSYKKVRRRRPLR--PRVFPNAKSGNQPVEATETI 191
           P  +          + P D + ++     K    +PL   P+     +    P E  +  
Sbjct: 259 PAEQPKDGNTQQPVEQPKDGNTQQPAEQPKEGHPQPLAKQPKDGETQQPTENPGENPDPS 318

Query: 192 VPQELNSDNASSV---DQDCK 209
            P+++  +  +SV   D+D K
Sbjct: 319 -PKQIKENILTSVKLTDKDGK 338


>gi|169833025|ref|YP_001694137.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae Hungary19A-6]
 gi|168995527|gb|ACA36139.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae Hungary19A-6]
          Length = 1900

 Score = 44.1 bits (102), Expect = 0.012,   Method: Composition-based stats.
 Identities = 25/141 (17%), Positives = 50/141 (35%), Gaps = 18/141 (12%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPC----PLIEEGKEPIFENSIQ 140
           +  QA+ + ++   E+       + E +     + E  P     P +EEGKE   E +  
Sbjct: 186 NQEQARTENQVVETEEAPKEEAPRTEESPKEEPKSEVKPTDDTLPKVEEGKEDSAEPAPV 245

Query: 141 PKVEDVAFKTPD--------------ISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVE 186
            +V       P+               + E  V     + + P +P     A+  + P E
Sbjct: 246 EEVGGEVESKPEEKVAVKPESQPSDKPAEESKVEPPVEQAKVPEQPVQPTQAEQPSTPKE 305

Query: 187 ATETIVPQELNSDNASSVDQD 207
           +++   P+E      +   +D
Sbjct: 306 SSQQENPKEDRGAEETPKQED 326


>gi|225858492|ref|YP_002740002.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae 70585]
 gi|225720604|gb|ACO16458.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae 70585]
          Length = 1895

 Score = 44.1 bits (102), Expect = 0.013,   Method: Composition-based stats.
 Identities = 29/134 (21%), Positives = 49/134 (36%), Gaps = 11/134 (8%)

Query: 83  IVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPC----PLIEEGKEPIFENS 138
           I +  QA+ + ++   E+       + E +     + E  P     P +EEGKE   E +
Sbjct: 184 ITNQEQARTENQVVETEEAPKEEAPKTEESPKEEPKSEVKPTDDTLPKVEEGKEDSAEPA 243

Query: 139 IQPKVEDVAFKTPDISR-EKDVSYKKVRRRRPLR--PRVFPNAKSGNQPVEATET---IV 192
              +V       P+     K  S    +     +  P V   AK   QPV+ T+      
Sbjct: 244 PVEEVGGEVESKPEEKVAVKPESQPSDKPAEESKVEPPV-EQAKVPEQPVQPTQAEQPST 302

Query: 193 PQELNSDNASSVDQ 206
           P+E +       D+
Sbjct: 303 PKETSQQENPKEDR 316


>gi|332837073|ref|XP_001173032.2| PREDICTED: LOW QUALITY PROTEIN: probable G-protein coupled receptor
           152 [Pan troglodytes]
          Length = 470

 Score = 44.1 bits (102), Expect = 0.013,   Method: Composition-based stats.
 Identities = 20/120 (16%), Positives = 38/120 (31%), Gaps = 6/120 (5%)

Query: 84  VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV 143
           ++ AQ+Q+   + + + +  L       AQ  L+       P  +   +P      QP+ 
Sbjct: 345 MAEAQSQMD-PMAQPQVNPTLQPRSDPTAQPQLNPT---AQPQSDPTAQPQLNLMAQPQS 400

Query: 144 EDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASS 203
           + VA    D + +                   P   S   P    +   P     ++ SS
Sbjct: 401 DSVAQPQADTNVQTPAPAASSVPSPC--DEASPTPSSHPTPGALEDPATPPASEGESPSS 458


>gi|190015168|ref|YP_001966612.1| surface layer protein [Bacillus cereus]
 gi|190015433|ref|YP_001966938.1| surface layer protein [Bacillus cereus]
 gi|218848477|ref|YP_002454964.1| surface layer protein [Bacillus cereus AH820]
 gi|116584844|gb|ABK00959.1| surface layer protein [Bacillus cereus]
 gi|116585114|gb|ABK01223.1| surface layer protein [Bacillus cereus]
 gi|218540528|gb|ACK92924.1| surface layer protein [Bacillus cereus AH820]
          Length = 489

 Score = 44.1 bits (102), Expect = 0.013,   Method: Composition-based stats.
 Identities = 26/129 (20%), Positives = 46/129 (35%), Gaps = 10/129 (7%)

Query: 67  YVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEF------E 120
           +V  E + Q        ++  + + + +++ D + +   +E+ E   +   E       E
Sbjct: 192 HVTREQYSQF---LYNSINAVEKETKPEVKPDPKPETKPEEKPEVKPDPKPETKPEEKPE 248

Query: 121 ASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKS 180
             P P  E   E   E    PK E      P+   E      K   +   +P V P+ K 
Sbjct: 249 VKPDPKPETKPEEKPEVKPDPKPETKPETKPEEKPEVK-PDPKPETKPEEKPEVKPDPKP 307

Query: 181 GNQPVEATE 189
             +P E  E
Sbjct: 308 ETKPEEKPE 316


>gi|74229688|ref|YP_308892.1| hoar orf [Trichoplusia ni SNPV]
 gi|72259602|gb|AAZ67373.1| hoar orf [Trichoplusia ni SNPV]
          Length = 967

 Score = 44.1 bits (102), Expect = 0.013,   Method: Composition-based stats.
 Identities = 17/86 (19%), Positives = 34/86 (39%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
           +  +++ ++  + + + +   + + E  Q+   E EA      E   EPI E   +P  E
Sbjct: 585 NEPESEAEQSNEPESEAEQSNEPESEAEQSNEPESEAEQSNEPEPDAEPIVEPIAEPDAE 644

Query: 145 DVAFKTPDISREKDVSYKKVRRRRPL 170
            VA    ++  E D          P+
Sbjct: 645 PVAELDAELDAEPDAEPDAEPVAEPV 670


>gi|148997256|ref|ZP_01824910.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae SP11-BS70]
 gi|168575334|ref|ZP_02721270.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae MLV-016]
 gi|307067282|ref|YP_003876248.1| hypothetical protein SPAP_0653 [Streptococcus pneumoniae AP200]
 gi|147756956|gb|EDK63996.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae SP11-BS70]
 gi|183578557|gb|EDT99085.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae MLV-016]
 gi|306408819|gb|ADM84246.1| hypothetical protein SPAP_0653 [Streptococcus pneumoniae AP200]
          Length = 1887

 Score = 43.8 bits (101), Expect = 0.014,   Method: Composition-based stats.
 Identities = 28/137 (20%), Positives = 46/137 (33%), Gaps = 16/137 (11%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPC----PLIEEGKEPIFENSIQ 140
           +  QA+ + ++   E+       + E +     + E  P     P +EEGKE   E +  
Sbjct: 186 NQEQARTENQVVETEEAPKEEAPKTEESPKEEPKSEVKPTDDTLPKVEEGKEDSAEPAPV 245

Query: 141 PKVEDVAFKTPDISR-EKDVSYKKVRRRR---------PLRPRVFPNA--KSGNQPVEAT 188
            +V       P+     K  S    +            P+ PR    A  +  NQP    
Sbjct: 246 EEVGGEVESKPEEKVAVKPESQPSDKPAEESKVEQAGEPVAPRKDEQAPVEPENQPEAPE 305

Query: 189 ETIVPQELNSDNASSVD 205
           E    +E      S+ D
Sbjct: 306 EEKAVEETPKQEESTPD 322


>gi|300933892|ref|ZP_07149148.1| signal recognition particle receptor [Corynebacterium resistens DSM
           45100]
          Length = 483

 Score = 43.8 bits (101), Expect = 0.014,   Method: Composition-based stats.
 Identities = 22/91 (24%), Positives = 37/91 (40%), Gaps = 9/91 (9%)

Query: 112 AQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLR 171
            Q+     +A P P  E  +EP  E +   K E    + P+     + +     +  P++
Sbjct: 76  KQDVKPAPKAEPKP--EVKQEPEVEQAPGAKQEPEVEQKPEHEVSAEPAAPAPEKAEPVK 133

Query: 172 PR--VFPNAKSGNQPVEATETIVPQELNSDN 200
           P   V P      QP EAT    P E ++++
Sbjct: 134 PEAPVKP-----EQPAEATPVATPVEESAES 159



 Score = 36.4 bits (82), Expect = 2.2,   Method: Composition-based stats.
 Identities = 16/75 (21%), Positives = 28/75 (37%), Gaps = 1/75 (1%)

Query: 87  AQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIF-ENSIQPKVED 145
           A+ + + K + + +     K++ E  Q    E  A P     E  EP+  E  ++P+   
Sbjct: 85  AEPKPEVKQEPEVEQAPGAKQEPEVEQKPEHEVSAEPAAPAPEKAEPVKPEAPVKPEQPA 144

Query: 146 VAFKTPDISREKDVS 160
            A        E   S
Sbjct: 145 EATPVATPVEESAES 159


>gi|115391411|ref|XP_001213210.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gi|114194134|gb|EAU35834.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
          Length = 520

 Score = 43.8 bits (101), Expect = 0.014,   Method: Composition-based stats.
 Identities = 29/119 (24%), Positives = 44/119 (36%), Gaps = 7/119 (5%)

Query: 91  IQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVED----- 145
              K ++ + D+       +RA++A    EA P P+ +   +   E+  QP V D     
Sbjct: 299 ANSKKRKLDDDEHEDPRTAKRAKDAGDNGEAGPEPVPQSEPQAGTESKEQPAVTDKQDFK 358

Query: 146 -VAFKTPDISREKDVSYKKVRRRRPLR-PRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
             A  TP       +  K+  R    R P  +PN     Q  E  ET  P       A+
Sbjct: 359 HSALPTPTPMGTFSLFVKEDFRDHFCRCPECYPNLSHHPQLREEEETYEPPLSEDGEAN 417


>gi|321257133|ref|XP_003193481.1| hypothetical protein CGB_D3340W [Cryptococcus gattii WM276]
 gi|317459951|gb|ADV21694.1| hypothetical protein CNBD5190 [Cryptococcus gattii WM276]
          Length = 1110

 Score = 43.8 bits (101), Expect = 0.015,   Method: Composition-based stats.
 Identities = 20/137 (14%), Positives = 52/137 (37%), Gaps = 2/137 (1%)

Query: 71  ENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEG 130
           +N+ Q  +H  R++S A  +++E ++R E+++  ++  +   + +  +       + ++ 
Sbjct: 156 QNNAQITDHPLRVLSRAVRELREVIERLEKENSRLRMNQIEREPSSGKATDQQISIHDDL 215

Query: 131 KEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATET 190
            E I  +                          +       P  F  + S + P   T T
Sbjct: 216 NEAISTSLTSTSSLREVPSRASALSIPQSELPSLSPTTSRFPAGFSPSSSNSIPF--TST 273

Query: 191 IVPQELNSDNASSVDQD 207
            V       +A+S++++
Sbjct: 274 SVDPHQPDVDAASINEN 290


>gi|194397255|ref|YP_002037320.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae G54]
 gi|194356922|gb|ACF55370.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae G54]
          Length = 1870

 Score = 43.8 bits (101), Expect = 0.015,   Method: Composition-based stats.
 Identities = 28/147 (19%), Positives = 45/147 (30%), Gaps = 27/147 (18%)

Query: 83  IVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPC----PLIEEGKEPIFENS 138
           I +  QA+ + ++   E+       + E +     + E  P     P +EEGKE   E +
Sbjct: 184 ITNQEQARTENQVVETEEAPKEEAPKTEESSKEEPKSEVKPTDDTLPKVEEGKEDSAEPA 243

Query: 139 IQPKVEDVAFKTPDISR-EKDVSYKKVRRRR---------PLRPR----------VFPNA 178
              +V       P+     K  S    +            P+ PR            P A
Sbjct: 244 PVEEVGGEVESKPEEKVAVKPESQPSDKPAEESKVEQAGEPVAPREDEKAPVEPEKQPEA 303

Query: 179 KSGNQPVEAT---ETIVPQELNSDNAS 202
               + VE T   E   P     +   
Sbjct: 304 PEEEKAVEETPKQEESTPDTKAEETVE 330


>gi|158317250|ref|YP_001509758.1| acyltransferase 3 [Frankia sp. EAN1pec]
 gi|158112655|gb|ABW14852.1| acyltransferase 3 [Frankia sp. EAN1pec]
          Length = 977

 Score = 43.8 bits (101), Expect = 0.015,   Method: Composition-based stats.
 Identities = 21/134 (15%), Positives = 46/134 (34%), Gaps = 6/134 (4%)

Query: 39  YDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRD 98
            + ++R    +  +    + R A ++ D   A    + A+ + R++  A+ ++  +  R 
Sbjct: 119 PEGRLRRAGAYSGDETEHIERRAAASRDPREA---ARDADDHTRVI--ARPRVPARAGRA 173

Query: 99  EQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKD 158
            +      ++  R  + L      P P   E  E     S QP  +    + P   R   
Sbjct: 174 ARTGRPAGDRSPRGGHELVGSG-PPRPHGAEPAEARRSGSRQPVADPSRRREPGGPRTPR 232

Query: 159 VSYKKVRRRRPLRP 172
                 +     +P
Sbjct: 233 QPGTSRQTGTSRQP 246


>gi|195436564|ref|XP_002066237.1| GK22253 [Drosophila willistoni]
 gi|194162322|gb|EDW77223.1| GK22253 [Drosophila willistoni]
          Length = 5492

 Score = 43.8 bits (101), Expect = 0.015,   Method: Composition-based stats.
 Identities = 20/136 (14%), Positives = 46/136 (33%), Gaps = 12/136 (8%)

Query: 85   SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASP----CPLIEEGKEPIFENSIQ 140
            +M   +  ++  +++Q D    +Q +  +   +  +  P         +   P    + +
Sbjct: 4819 NMQDPEEAQEEPKEQQTDQPQSDQSDSEEEGEAGQDQEPTTSGQDDEVQDPTPDETQTEE 4878

Query: 141  PKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAK------SGNQPVEATETIVPQ 194
            P+ +       D   ++D    + +R    +P  F  +K         Q V  TE     
Sbjct: 4879 PETQKRGEIDEDKEEDEDQEGDQEKREE--KPEQFAQSKDKSSKEENVQSVPETEKNSSV 4936

Query: 195  ELNSDNASSVDQDCKV 210
            +        + QD K+
Sbjct: 4937 DQVQQQDEDIKQDQKL 4952


>gi|326773842|ref|ZP_08233124.1| sialidase (Neuraminidase) [Actinomyces viscosus C505]
 gi|326635981|gb|EGE36885.1| sialidase (Neuraminidase) [Actinomyces viscosus C505]
          Length = 911

 Score = 43.8 bits (101), Expect = 0.017,   Method: Composition-based stats.
 Identities = 19/106 (17%), Positives = 26/106 (24%), Gaps = 9/106 (8%)

Query: 108 QKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSY------ 161
           QK    +      A+P     E   P    S +P         P+ S   + S       
Sbjct: 663 QKPAEPSPAPSPTAAPSAAPSEQPAPSAAPSTEPTQAPAPSSAPEPSAVPEPSSAPAPEP 722

Query: 162 ---KKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSV 204
                        P   P   +G     A ET          A +V
Sbjct: 723 TTAPSTEPTPTPAPSSAPEPSAGPTAAPAPETSSAPAAEPTQAPTV 768



 Score = 39.1 bits (89), Expect = 0.33,   Method: Composition-based stats.
 Identities = 16/70 (22%), Positives = 26/70 (37%), Gaps = 1/70 (1%)

Query: 119 FEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRP-LRPRVFPN 177
            E +P P      EP    +  P  E  +    + ++   V+      + P  +P   P+
Sbjct: 728 TEPTPTPAPSSAPEPSAGPTAAPAPETSSAPAAEPTQAPTVAPSAEPTQVPGAQPSAAPS 787

Query: 178 AKSGNQPVEA 187
            K G QP  A
Sbjct: 788 EKPGAQPSSA 797


>gi|224536406|ref|ZP_03676945.1| hypothetical protein BACCELL_01280 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224521961|gb|EEF91066.1| hypothetical protein BACCELL_01280 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 515

 Score = 43.4 bits (100), Expect = 0.018,   Method: Composition-based stats.
 Identities = 19/100 (19%), Positives = 33/100 (33%), Gaps = 7/100 (7%)

Query: 93  EKLQRDEQDDLLVKEQKERAQ------NALSEFEASPCPLIEEGKEPIFENSIQPKVEDV 146
            K Q+ E +D   K   E              F A P P   E  +P+  +  +P +  V
Sbjct: 34  AKQQQQEFEDFKNKADAEFETFLRETWQKYEAFAAIPAPERPEPPKPVEFDKTKPTMPPV 93

Query: 147 AFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVE 186
             K P   +  D     +  + P+  +        ++P  
Sbjct: 94  NIK-PAAPKVPDAPVPSMGEKVPVDVKRPDLPAIEDKPAP 132


>gi|126348237|emb|CAJ89958.1| conserved hypothetical protein [Streptomyces ambofaciens ATCC
           23877]
          Length = 4796

 Score = 43.4 bits (100), Expect = 0.018,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 34/90 (37%), Gaps = 3/90 (3%)

Query: 120 EASPCPLIEEGKEPIFENSIQPKVED--VAFKTPDISREKDVSYKKVRRRRPLRPRVFPN 177
            A+P P+ E+   P+ ++  QP  +   V    P  S     S        P R R  P+
Sbjct: 422 SAAPRPVDEDTPRPLTDSLRQPHAQPPLVPDAAPGPSVTTSQSQASPTAAPPPRHRTPPS 481

Query: 178 AKSGNQPVEAT-ETIVPQELNSDNASSVDQ 206
                    AT +T+VP    +     VD+
Sbjct: 482 DDPAVTGGPATQDTVVPDAPRTHAPEEVDR 511


>gi|28379477|ref|NP_786369.1| cell surface protein precursor [Lactobacillus plantarum WCFS1]
 gi|28272317|emb|CAD65231.1| cell surface protein precursor [Lactobacillus plantarum WCFS1]
          Length = 1356

 Score = 43.4 bits (100), Expect = 0.018,   Method: Composition-based stats.
 Identities = 20/114 (17%), Positives = 36/114 (31%), Gaps = 4/114 (3%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
             Q ++  Q +E        Q E         +       E+  +P  E   QP+ +    
Sbjct: 1176 GQPEQPSQPEEPGQPEQPSQPEEPGQPEQPSQPEEPGHPEQPSQP--EEPGQPE-QPSQP 1232

Query: 149  KTPDISREKDVSYKKVRRRRPLRPRVFPN-AKSGNQPVEATETIVPQELNSDNA 201
            + P  S +     K  +     +P    + A       E + T  P +  SD +
Sbjct: 1233 EEPGQSEKPGELQKPSQPADSEQPDGLSDQANLSRNQAEQSRTSQPSQAESDQS 1286


>gi|50545139|ref|XP_500107.1| YALI0A15796p [Yarrowia lipolytica]
 gi|49645972|emb|CAG84038.1| YALI0A15796p [Yarrowia lipolytica]
          Length = 982

 Score = 43.4 bits (100), Expect = 0.019,   Method: Composition-based stats.
 Identities = 16/112 (14%), Positives = 31/112 (27%)

Query: 84  VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV 143
           V   +   + +    E +    + +K   +    E    P P + E   P  E     K 
Sbjct: 752 VEEIKPTPEVEKPTPEVEKPTPEVEKPTPEKPTPEVPEKPTPEVPEKPTPEVEKPTPEKP 811

Query: 144 EDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQE 195
                + P   +      +K            P  +   +P    E   P++
Sbjct: 812 TPEVPEKPTPEKPTPEVPEKPTPEVEKPTPEKPTPEVPEKPTPEVEKPTPEK 863



 Score = 40.3 bits (92), Expect = 0.16,   Method: Composition-based stats.
 Identities = 13/83 (15%), Positives = 21/83 (25%), Gaps = 1/83 (1%)

Query: 112 AQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLR 171
            +         P P + E   P  E     K      + P    EK  + +K     P +
Sbjct: 813 PEVPEKPTPEKPTPEVPEKPTPEVEKPTPEKPTPEVPEKPTPEVEKP-TPEKPTPEVPEK 871

Query: 172 PRVFPNAKSGNQPVEATETIVPQ 194
           P       +  +P          
Sbjct: 872 PTPEVEKPTPEKPTPEVPQSEKP 894



 Score = 38.0 bits (86), Expect = 0.92,   Method: Composition-based stats.
 Identities = 11/80 (13%), Positives = 20/80 (25%)

Query: 116 LSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVF 175
                  P P + E   P       P+      + P   +      +K            
Sbjct: 804 EKPTPEKPTPEVPEKPTPEKPTPEVPEKPTPEVEKPTPEKPTPEVPEKPTPEVEKPTPEK 863

Query: 176 PNAKSGNQPVEATETIVPQE 195
           P  +   +P    E   P++
Sbjct: 864 PTPEVPEKPTPEVEKPTPEK 883


>gi|168487244|ref|ZP_02711752.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae CDC1087-00]
 gi|183569885|gb|EDT90413.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae CDC1087-00]
          Length = 1937

 Score = 43.4 bits (100), Expect = 0.019,   Method: Composition-based stats.
 Identities = 27/133 (20%), Positives = 47/133 (35%), Gaps = 11/133 (8%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFE----NSIQ 140
              +++ +EK+    +      E+++  +    + E++P    EE  EP  E       Q
Sbjct: 250 GEVESKPEEKVAVKPEKQPEAPEEEKAVEETPKQEESTPDTKAEETVEPKEETVNQPVEQ 309

Query: 141 PKVE-DVAFKTPDISREKDVSY------KKVRRRRPLRPRVFPNAKSGNQPVEATETIVP 193
           PKVE     K  + + E  V             + P+ P   P A    + VE T     
Sbjct: 310 PKVETPAVEKQTEPTEEPKVEQVGEPVEPSEDEKAPVSPEKQPEAPEEEKAVEETPKPED 369

Query: 194 QELNSDNASSVDQ 206
           +         VD+
Sbjct: 370 KIKGIGTKEPVDK 382



 Score = 39.9 bits (91), Expect = 0.25,   Method: Composition-based stats.
 Identities = 23/126 (18%), Positives = 43/126 (34%), Gaps = 10/126 (7%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPC----PLIEEGKEPIFENSIQ 140
           +  QA+ + ++   E+       + E +     + E  P     P +EEGKE   E +  
Sbjct: 186 NQEQARTENQVVETEEAPKEEAPRTEESPKEEPKSEVKPTDDTLPKVEEGKEDSAEPAPV 245

Query: 141 PKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDN 200
            +V       P+         +             P  +      +A ET+ P+E     
Sbjct: 246 EEVGGEVESKPEEKVAVKPEKQPEAPEEEKAVEETPKQEESTPDTKAEETVEPKE----- 300

Query: 201 ASSVDQ 206
             +V+Q
Sbjct: 301 -ETVNQ 305


>gi|46243671|ref|NP_996880.1| probable G-protein coupled receptor 152 [Homo sapiens]
 gi|48428096|sp|Q8TDT2|GP152_HUMAN RecName: Full=Probable G-protein coupled receptor 152; AltName:
           Full=G-protein coupled receptor PGR5
 gi|20152304|dbj|BAB89333.1| putative G-protein coupled receptor [Homo sapiens]
 gi|21928971|dbj|BAC06071.1| seven transmembrane helix receptor [Homo sapiens]
 gi|45774614|gb|AAS76893.1| G protein-coupled receptor 152 [Homo sapiens]
 gi|110645884|gb|AAI19780.1| G protein-coupled receptor 152 [Homo sapiens]
 gi|114107675|gb|AAI22870.1| G protein-coupled receptor 152 [Homo sapiens]
          Length = 470

 Score = 43.4 bits (100), Expect = 0.019,   Method: Composition-based stats.
 Identities = 20/120 (16%), Positives = 38/120 (31%), Gaps = 6/120 (5%)

Query: 84  VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV 143
           ++ AQ+Q+   + + + +  L       AQ  L+       P  +   +P      QP+ 
Sbjct: 345 MAEAQSQMD-PVAQPQVNPTLQPRSDPTAQPQLNPT---AQPQSDPTAQPQLNLMAQPQS 400

Query: 144 EDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASS 203
           + VA    D + +                   P   S   P    +   P     ++ SS
Sbjct: 401 DSVAQPQADTNVQTPAPAASSVPSPC--DEASPTPSSHPTPGALEDPATPPASEGESPSS 458


>gi|149010714|ref|ZP_01832085.1| Zinc metalloprotease zmpB precursor, putative [Streptococcus
           pneumoniae SP19-BS75]
 gi|147765195|gb|EDK72124.1| Zinc metalloprotease zmpB precursor, putative [Streptococcus
           pneumoniae SP19-BS75]
          Length = 1969

 Score = 43.4 bits (100), Expect = 0.021,   Method: Composition-based stats.
 Identities = 18/123 (14%), Positives = 47/123 (38%), Gaps = 6/123 (4%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKE-RAQNALSEFEASPCPLIEEGKEPIFENSIQPKV 143
           +  + + Q +   +E+      +Q++ + +   ++ EA+  P+    +EP  E +   + 
Sbjct: 282 APVEPEKQPEAPEEEKAVEETPKQEDTQPEVVETKDEAANQPV----EEPKVE-TPAVEK 336

Query: 144 EDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASS 203
           +    + P + +  +    +   + P+ P   P A    +  E T     +         
Sbjct: 337 QTEPTEEPKVEQVGEPVAPREDEKAPVSPEKQPEAPEEEKTAEETPKQEDKIKGIGTKEP 396

Query: 204 VDQ 206
           VD+
Sbjct: 397 VDK 399


>gi|91992384|gb|ABE72947.1| vitelline envelope zona pellucida domain 9 [Haliotis corrugata]
          Length = 508

 Score = 43.4 bits (100), Expect = 0.022,   Method: Composition-based stats.
 Identities = 14/91 (15%), Positives = 27/91 (29%), Gaps = 1/91 (1%)

Query: 112 AQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLR 171
            Q+        P   I+E   P+     QP+      + P      D   + + R    +
Sbjct: 372 PQSDEKAERPRPLSRIDEQPRPLSRIDEQPRPLSRIDEQPRPLSRIDEQPRPLSRIDE-Q 430

Query: 172 PRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
           PR+        +P+   +         +N  
Sbjct: 431 PRLLSRIDEQPRPLAIMDDEHLPFAKQNNED 461


>gi|156101567|ref|XP_001616477.1| hypothetical protein [Plasmodium vivax SaI-1]
 gi|148805351|gb|EDL46750.1| hypothetical protein, conserved [Plasmodium vivax]
          Length = 1131

 Score = 43.4 bits (100), Expect = 0.022,   Method: Composition-based stats.
 Identities = 29/149 (19%), Positives = 51/149 (34%), Gaps = 11/149 (7%)

Query: 71  ENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQ----NALSEFEASPCPL 126
           EN  +    YN +  + + Q +   +   +     +E +E AQ        E E S  P 
Sbjct: 481 ENFFKRK--YNDMNKIIKVQEENLQKMGLEKGAEAQEGEEPAQLKRKRKRDEGELSGQPS 538

Query: 127 IEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLR-PRVFPNAKSGNQPV 185
            + G++P    + QP  +   +     S   +    +     P   P   PN      P 
Sbjct: 539 EQPGEQPNEYANEQPGEQPNEYANEQPSEMPNEMPSENPNEMPSENPNEMPNELPNEPPH 598

Query: 186 EATETIVPQELNSDNASSVDQ----DCKV 210
             T       +   N S+++     DCK+
Sbjct: 599 GGTGAKRTPVILKKNESTLNAMKNLDCKL 627


>gi|68271041|gb|AAY89041.1| Gar [Bacillus cereus]
          Length = 588

 Score = 43.0 bits (99), Expect = 0.023,   Method: Composition-based stats.
 Identities = 18/130 (13%), Positives = 48/130 (36%), Gaps = 2/130 (1%)

Query: 71  ENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEG 130
           E   Q  + +    ++ + +  +  Q   ++      ++E+ +   ++      P   + 
Sbjct: 138 ETLQQTLDKFGTCKTVEEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTDDPKQEKPEEPKT 197

Query: 131 KEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATET 190
            +P  E   +PK +D   + P+    K    K+ +  +P +  +   A   N  +  T  
Sbjct: 198 DDPKQEKPEEPKTDDPKQEKPE--EPKTDDPKQEKPEQPKQENIQVPAAQVNDAISKTSE 255

Query: 191 IVPQELNSDN 200
            + Q+    +
Sbjct: 256 KMLQDGIESD 265


>gi|300769401|ref|ZP_07079287.1| cell surface protein precursor [Lactobacillus plantarum subsp.
            plantarum ATCC 14917]
 gi|300492816|gb|EFK27998.1| cell surface protein precursor [Lactobacillus plantarum subsp.
            plantarum ATCC 14917]
          Length = 1357

 Score = 43.0 bits (99), Expect = 0.024,   Method: Composition-based stats.
 Identities = 20/114 (17%), Positives = 36/114 (31%), Gaps = 4/114 (3%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
             Q ++  Q +E        Q E         +       E+  +P  E   QP+ +    
Sbjct: 1177 GQPEQPSQPEEPGQPEQPSQPEEPGQPEQPSQPEEPGHPEQPSQP--EEPGQPE-QPSQP 1233

Query: 149  KTPDISREKDVSYKKVRRRRPLRPRVFPN-AKSGNQPVEATETIVPQELNSDNA 201
            + P  S +     K  +     +P    + A       E + T  P +  SD +
Sbjct: 1234 EEPGQSEKPGELQKPSQPADSEQPDGLSDQANLSRNQAEQSRTSQPSQAESDQS 1287


>gi|47224272|emb|CAG09118.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 533

 Score = 43.0 bits (99), Expect = 0.024,   Method: Composition-based stats.
 Identities = 21/111 (18%), Positives = 39/111 (35%), Gaps = 9/111 (8%)

Query: 86  MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE-------ASPCPLIEEGKE--PIFE 136
               + +++L+++++     KE+K+   +     E       ++P P I    +  P   
Sbjct: 25  ELTKEEKQRLRKEKKQQRKGKEKKDDKTSQEGGKEKNSVSSSSAPQPSIPVTAQKAPSAV 84

Query: 137 NSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEA 187
            +  P          D   +     K  RR R    R F  AK G    +A
Sbjct: 85  PASVPVPAPECAAPVDKPAKSKAELKAERRARQEAERAFKQAKKGEAGQQA 135


>gi|209548905|ref|YP_002280822.1| ribonuclease, Rne/Rng family [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209534661|gb|ACI54596.1| ribonuclease, Rne/Rng family [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 965

 Score = 43.0 bits (99), Expect = 0.025,   Method: Composition-based stats.
 Identities = 26/134 (19%), Positives = 48/134 (35%), Gaps = 7/134 (5%)

Query: 79  HYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEP--IFE 136
           H     +       +    D Q  L  + ++ R    +   E +P   + +  +P     
Sbjct: 66  HGFLAFAEIHPDYYQIPLADRQALLRAEAEEHRRDEDVEHVETAPMVDLSKQDQPDVGIV 125

Query: 137 NSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVE---ATETIVP 193
            +  P+  DV  +             +    +  RPR   + K   +P     ATE  VP
Sbjct: 126 PAEAPETADVTAEPAAAEAVASPEATEEAPAKKARPRR--SRKKAAEPAPETTATEDAVP 183

Query: 194 QELNSDNASSVDQD 207
            ++ ++ ASSVD +
Sbjct: 184 TDVEAEGASSVDNE 197


>gi|237650331|ref|ZP_04524583.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae CCRI 1974]
 gi|237821684|ref|ZP_04597529.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae CCRI 1974M2]
          Length = 1883

 Score = 43.0 bits (99), Expect = 0.026,   Method: Composition-based stats.
 Identities = 26/145 (17%), Positives = 48/145 (33%), Gaps = 24/145 (16%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
           +  QA+ + ++   E+     +  KE  ++ +   + +  P +EEGKE   E +   +V 
Sbjct: 186 NQEQARTENQVVETEEAPKTEESPKEEPKSEIKPTDDT-LPKVEEGKEASAEPATVEEVG 244

Query: 145 DVAFKTPDISR-EKDVSYKKVRRRR---------PLRPR----------VFPNAKSGNQP 184
                 P+     K  S    +            P+ PR            P A    + 
Sbjct: 245 GEVESKPEEKVAVKPESQPSDKPAEESKVEQAGEPVAPREDEKAPVEPEKQPEAPEEEKA 304

Query: 185 VEAT---ETIVPQELNSDNASSVDQ 206
           VE T   E   P     +     ++
Sbjct: 305 VEETPKQEESTPDTKAEETVEPKEK 329


>gi|269302498|gb|ACZ32598.1| type III secretion apparatus protein, YscD/HrpQ family
           [Chlamydophila pneumoniae LPCoLN]
          Length = 845

 Score = 43.0 bits (99), Expect = 0.027,   Method: Composition-based stats.
 Identities = 35/185 (18%), Positives = 70/185 (37%), Gaps = 22/185 (11%)

Query: 35  DSN--GYDVKVRGTAQ--HIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQ 90
           DSN  G D++ R T++  H  +    L +D   + D + + +  + A+ +   ++ A+A+
Sbjct: 126 DSNEQGKDLEPRQTSETNHSPKPKEKLTKD-QGSSDPITSRD-QELADAF---LASAKAE 180

Query: 91  IQEKL--------QRDEQDDLLVKEQKERAQNALSEFEASPCPLIEE--GKEPIFEN--- 137
             +          +    + L  KEQ  +      E    P   I E  G  P  +    
Sbjct: 181 KNQPRAKVAKKGLKESSNESLNPKEQNAKDSPKGEERTNKPQNAIMEDNGASPSQDPQPK 240

Query: 138 SIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELN 197
           S +P +E+ A     +   K V  K  ++  P  P      + G++   +     P +  
Sbjct: 241 SAEPSLENTARDETPLKENKPVEEKANKKATPDSPEKKDQPEEGSKKEGSKIEATPADSQ 300

Query: 198 SDNAS 202
            ++  
Sbjct: 301 KESED 305


>gi|156546387|ref|XP_001606911.1| PREDICTED: hypothetical protein [Nasonia vitripennis]
          Length = 2318

 Score = 43.0 bits (99), Expect = 0.027,   Method: Composition-based stats.
 Identities = 18/114 (15%), Positives = 37/114 (32%), Gaps = 3/114 (2%)

Query: 86  MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIE--EGKEPIFENSIQPKV 143
            A+     +   + + +     +       +SE ++ P P  E     EP+ E   +P+ 
Sbjct: 633 SAEPASDSEPVSEPKSEPEPSAEPASDSEPVSEPKSEPEPSAEPASDSEPVSEPKSEPEP 692

Query: 144 EDVAFKTPDISREKDVSYKK-VRRRRPLRPRVFPNAKSGNQPVEATETIVPQEL 196
                  P+ + E     K              P A+  ++P  A+E     + 
Sbjct: 693 SAEPKSEPEPALEPVAEPKSEPEPASEPTSDSEPAAEPKSEPEPASEPSAEPKS 746



 Score = 41.8 bits (96), Expect = 0.066,   Method: Composition-based stats.
 Identities = 18/106 (16%), Positives = 34/106 (32%), Gaps = 1/106 (0%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
           S A+ +   + +   +    +K   E    A    E+ P    +   EP  E   +P+  
Sbjct: 772 SAAKPEPASEPEPSTEPTSDLKPHAEPKSLAEPSSESEPTAEPKSEPEPSAEPKSEPEPA 831

Query: 145 DVAFKTPDISREKDVSY-KKVRRRRPLRPRVFPNAKSGNQPVEATE 189
                 P+ S E                P   P +K  ++   ++E
Sbjct: 832 AKPASQPEPSAEPKSEPEPTADPASEPEPTAEPTSKPESEMEPSSE 877



 Score = 38.0 bits (86), Expect = 0.87,   Method: Composition-based stats.
 Identities = 14/108 (12%), Positives = 33/108 (30%), Gaps = 3/108 (2%)

Query: 86  MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIE--EGKEPIFENSIQPKV 143
            A+ + + +   + + +         A    +E ++ P P  E     EP+ E   +P+ 
Sbjct: 573 AAEPKSEPEHAAEPKSEPEPSADVTSASEPTAEPKSEPEPSAEPASDSEPVSEPKSEPEP 632

Query: 144 EDVAFKTPDISREKDVSY-KKVRRRRPLRPRVFPNAKSGNQPVEATET 190
                   +   E                P   P ++       A+++
Sbjct: 633 SAEPASDSEPVSEPKSEPEPSAEPASDSEPVSEPKSEPEPSAEPASDS 680



 Score = 37.2 bits (84), Expect = 1.5,   Method: Composition-based stats.
 Identities = 18/107 (16%), Positives = 37/107 (34%), Gaps = 3/107 (2%)

Query: 100 QDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDIS---RE 156
           QD       +     + +E E  P    +   EP+ E   +P+        P+ +   + 
Sbjct: 493 QDPYHGLHHEHDESKSKTEGEVDPSAEPKSEPEPVAEPESKPEPSSEPKSEPEPAAEPKS 552

Query: 157 KDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASS 203
           +     +       +    P A+  ++P  A E     E ++D  S+
Sbjct: 553 EPEPSSEPEPSVEPKSEPEPAAEPKSEPEHAAEPKSEPEPSADVTSA 599



 Score = 36.4 bits (82), Expect = 2.3,   Method: Composition-based stats.
 Identities = 18/123 (14%), Positives = 35/123 (28%), Gaps = 13/123 (10%)

Query: 87  AQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIE--EGKEPIFENSIQPKVE 144
           ++ +   +   D +     K + E +    SE E +  P+ E     EP  E +   +  
Sbjct: 668 SEPEPSAEPASDSEPVSEPKSEPEPSAEPKSEPEPALEPVAEPKSEPEPASEPTSDSEPA 727

Query: 145 DVAFKTPDISREKDVSYKKVR-----------RRRPLRPRVFPNAKSGNQPVEATETIVP 193
                 P+ + E     K                    P+  P + +  +P    E    
Sbjct: 728 AEPKSEPEPASEPSAEPKSEPAAEPAAEPTILPESTAEPKSEPESAAKPEPASEPEPSTE 787

Query: 194 QEL 196
              
Sbjct: 788 PTS 790



 Score = 34.5 bits (77), Expect = 9.0,   Method: Composition-based stats.
 Identities = 20/128 (15%), Positives = 39/128 (30%), Gaps = 3/128 (2%)

Query: 83  IVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSI--Q 140
           + S ++   + K + +   +     +      +  E  A P    E   EP  E     +
Sbjct: 596 VTSASEPTAEPKSEPEPSAEPASDSEPVSEPKSEPEPSAEPASDSEPVSEPKSEPEPSAE 655

Query: 141 PKVEDVAFKTPDISREKDVSYKKV-RRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSD 199
           P  +      P    E               +    P+A+  ++P  A E +   +   +
Sbjct: 656 PASDSEPVSEPKSEPEPSAEPASDSEPVSEPKSEPEPSAEPKSEPEPALEPVAEPKSEPE 715

Query: 200 NASSVDQD 207
            AS    D
Sbjct: 716 PASEPTSD 723


>gi|241699696|ref|XP_002413152.1| conserved hypothetical protein [Ixodes scapularis]
 gi|215506966|gb|EEC16460.1| conserved hypothetical protein [Ixodes scapularis]
          Length = 594

 Score = 43.0 bits (99), Expect = 0.028,   Method: Composition-based stats.
 Identities = 24/129 (18%), Positives = 47/129 (36%), Gaps = 10/129 (7%)

Query: 86  MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASP---CPLIEEGKEPIFENSIQPK 142
             Q ++QEK ++  QD L ++E+ ++ + A       P    P+    K+P   +  Q +
Sbjct: 447 DIQQKLQEKRRQQLQDLLAIEEEMKQGKLAPRGPPQGPAPRQPIPRSKKQPWLRSPPQFR 506

Query: 143 VEDVAFKTPDISREK-DVSYKK---VRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
              +   +P++      +   +     R  P   R  P      Q   A         + 
Sbjct: 507 YRSLLGGSPEVLLCPHRLDQARGGGPLRAAPPLARTLPRELRWAQRALAFRES---NSSD 563

Query: 199 DNASSVDQD 207
            +  S D+D
Sbjct: 564 GDVDSADED 572


>gi|225871549|ref|YP_002752907.1| surface layer protein [Bacillus cereus 03BB102]
 gi|225785545|gb|ACO25763.1| surface layer protein [Bacillus cereus 03BB102]
          Length = 437

 Score = 43.0 bits (99), Expect = 0.028,   Method: Composition-based stats.
 Identities = 21/96 (21%), Positives = 35/96 (36%), Gaps = 8/96 (8%)

Query: 114 NALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPR 173
           N+++  E    P ++   +P  +   +P+V       PD   E     K   +  P +P 
Sbjct: 215 NSINVIEKETKPEVKPDPKPETKPEEKPEV------KPDPKPETKPEEKPEVKPDP-KPE 267

Query: 174 VFPNAKSGNQPVEATETIVPQELNSDNASSVDQDCK 209
             P  K   +P    ET  P      + S V +D  
Sbjct: 268 TKPEEKPEVKPDPKPETK-PAVPEGLDTSLVAEDFS 302


>gi|164659167|ref|XP_001730708.1| hypothetical protein MGL_2162 [Malassezia globosa CBS 7966]
 gi|159104605|gb|EDP43494.1| hypothetical protein MGL_2162 [Malassezia globosa CBS 7966]
          Length = 1055

 Score = 43.0 bits (99), Expect = 0.030,   Method: Composition-based stats.
 Identities = 22/140 (15%), Positives = 44/140 (31%), Gaps = 9/140 (6%)

Query: 64  AGDYVVAENHLQHA--EHYNRIVSM--AQAQIQEKLQRDEQDDLLVKEQKERAQNALSEF 119
           AG+ V+   + Q+A  +HY +      AQ ++  + Q         +++  + Q      
Sbjct: 16  AGETVMH--YDQNAYGQHYEQPTQQYYAQPEMDAEYQAQVNAQQEAQQRALQEQAQQQPT 73

Query: 120 EASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDIS---REKDVSYKKVRRRRPLRPRVFP 176
           E +  P   +G            +               E+D   + V++R   RP    
Sbjct: 74  EKAQAPAEPQGDGDDLPEDEYGALVAFIRSQKRSGGDDEEEDTGIRVVKKRDMWRPWKVR 133

Query: 177 NAKSGNQPVEATETIVPQEL 196
             +      E T      + 
Sbjct: 134 EVRVNKNGEEETVAQKVPQA 153


>gi|323099908|gb|ADX23545.1| trans-sialidase [Trypanosoma cruzi]
          Length = 818

 Score = 42.6 bits (98), Expect = 0.030,   Method: Composition-based stats.
 Identities = 16/97 (16%), Positives = 26/97 (26%), Gaps = 2/97 (2%)

Query: 109 KERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK--KVRR 166
            E         E  P     E  +P      +PK  +     P  +  K    K  + + 
Sbjct: 620 AEPKPAEPKPAEPKPAEPKPEEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKP 679

Query: 167 RRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASS 203
             P      P      +P  A       +    NA++
Sbjct: 680 AEPKPAEPKPAEPKSGEPKPAEPKPAEPKPAEPNAAT 716



 Score = 42.6 bits (98), Expect = 0.036,   Method: Composition-based stats.
 Identities = 21/118 (17%), Positives = 36/118 (30%), Gaps = 2/118 (1%)

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
           A+ +    + E+      +  E         E  P        +P      +PK  +   
Sbjct: 630 AEPKPAEPKPEEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKP 689

Query: 149 KTPDISREKDVSYK--KVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSV 204
             P     K    K  + +   P          + +QP  AT +   + L S  +SSV
Sbjct: 690 AEPKSGEPKPAEPKPAEPKPAEPNAATSSAREGTADQPASATSSDEHEALASVTSSSV 747



 Score = 41.8 bits (96), Expect = 0.060,   Method: Composition-based stats.
 Identities = 14/92 (15%), Positives = 22/92 (23%), Gaps = 2/92 (2%)

Query: 109 KERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK--KVRR 166
            E         E  P        +P      +PK E+     P  +  K    K  + + 
Sbjct: 605 AEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPEEPKPAEPKPAEPKPAEPKPAEPKP 664

Query: 167 RRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
             P      P      +P  A       +   
Sbjct: 665 AEPKPAEPKPAEPKPAEPKPAEPKPAEPKSGE 696



 Score = 37.6 bits (85), Expect = 0.99,   Method: Composition-based stats.
 Identities = 13/92 (14%), Positives = 22/92 (23%), Gaps = 2/92 (2%)

Query: 109 KERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK--KVRR 166
            E         E  P        +P+     +PK  +     P  +  K    K  + + 
Sbjct: 480 AEPKPAEPKPAEPKPAEPKPAEPKPVEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKP 539

Query: 167 RRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
             P      P      +P  A       +   
Sbjct: 540 AEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAE 571



 Score = 37.6 bits (85), Expect = 1.1,   Method: Composition-based stats.
 Identities = 13/81 (16%), Positives = 21/81 (25%), Gaps = 2/81 (2%)

Query: 109 KERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK--KVRR 166
            E         E  P        +P+     +PK  +     P  +  K    K  + + 
Sbjct: 555 AEPKPAEPKPAEPKPAEPKPAEPKPVEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKP 614

Query: 167 RRPLRPRVFPNAKSGNQPVEA 187
             P      P      +P  A
Sbjct: 615 AEPKPAEPKPAEPKPAEPKPA 635



 Score = 37.6 bits (85), Expect = 1.1,   Method: Composition-based stats.
 Identities = 13/94 (13%), Positives = 23/94 (24%), Gaps = 2/94 (2%)

Query: 107 EQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK--KV 164
           +  E         E  P        +P     ++PK  +     P  +  K    K  + 
Sbjct: 473 KSAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPVEPKPAEPKPAEPKPAEPKPAEPKPAEP 532

Query: 165 RRRRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
           +   P      P      +P  A       +   
Sbjct: 533 KPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAE 566



 Score = 37.2 bits (84), Expect = 1.3,   Method: Composition-based stats.
 Identities = 13/92 (14%), Positives = 22/92 (23%), Gaps = 2/92 (2%)

Query: 109 KERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK--KVRR 166
            E         E  P        +P     ++PK  +     P  +  K    K  + + 
Sbjct: 550 AEPKPAEPKPAEPKPAEPKPAEPKPAEPKPVEPKPAEPKPAEPKPAEPKPAEPKPAEPKP 609

Query: 167 RRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
             P      P      +P  A       +   
Sbjct: 610 AEPKPAEPKPAEPKPAEPKPAEPKPAEPKPEE 641



 Score = 37.2 bits (84), Expect = 1.3,   Method: Composition-based stats.
 Identities = 14/92 (15%), Positives = 22/92 (23%), Gaps = 2/92 (2%)

Query: 109 KERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK--KVRR 166
            E         E  P        +P      +PK  +     P  +  K    K  + + 
Sbjct: 495 AEPKPAEPKPVEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKP 554

Query: 167 RRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
             P      P      +P  A    V  +   
Sbjct: 555 AEPKPAEPKPAEPKPAEPKPAEPKPVEPKPAE 586



 Score = 36.8 bits (83), Expect = 1.8,   Method: Composition-based stats.
 Identities = 13/92 (14%), Positives = 21/92 (22%), Gaps = 2/92 (2%)

Query: 109 KERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK--KVRR 166
            E         E  P        +P      +PK  +     P  +  K    K  + + 
Sbjct: 590 AEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPEEPKPAEPKP 649

Query: 167 RRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
             P      P      +P  A       +   
Sbjct: 650 AEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAE 681



 Score = 36.8 bits (83), Expect = 2.0,   Method: Composition-based stats.
 Identities = 13/92 (14%), Positives = 21/92 (22%), Gaps = 2/92 (2%)

Query: 109 KERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK--KVRR 166
            E         E  P        +P      +PK  +     P  +  K    K  + + 
Sbjct: 525 AEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPVEPKP 584

Query: 167 RRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
             P      P      +P  A       +   
Sbjct: 585 AEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAE 616



 Score = 36.8 bits (83), Expect = 2.0,   Method: Composition-based stats.
 Identities = 13/92 (14%), Positives = 21/92 (22%), Gaps = 2/92 (2%)

Query: 109 KERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK--KVRR 166
            E         E  P        +P      +PK  +     P  +  K    K  + + 
Sbjct: 585 AEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPEEPKP 644

Query: 167 RRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
             P      P      +P  A       +   
Sbjct: 645 AEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAE 676



 Score = 36.8 bits (83), Expect = 2.0,   Method: Composition-based stats.
 Identities = 13/92 (14%), Positives = 21/92 (22%), Gaps = 2/92 (2%)

Query: 109 KERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK--KVRR 166
            E         E  P        +P      +PK  +     P  +  K    K  + + 
Sbjct: 570 AEPKPAEPKPVEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKP 629

Query: 167 RRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
             P      P      +P  A       +   
Sbjct: 630 AEPKPAEPKPEEPKPAEPKPAEPKPAEPKPAE 661



 Score = 36.8 bits (83), Expect = 2.1,   Method: Composition-based stats.
 Identities = 14/92 (15%), Positives = 22/92 (23%), Gaps = 2/92 (2%)

Query: 109 KERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK--KVRR 166
            E         E  P        +P      +PK  +     P  +  K V  K  + + 
Sbjct: 530 AEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPVEPKPAEPKP 589

Query: 167 RRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
             P      P      +P  A       +   
Sbjct: 590 AEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAE 621



 Score = 36.4 bits (82), Expect = 2.5,   Method: Composition-based stats.
 Identities = 13/92 (14%), Positives = 21/92 (22%), Gaps = 2/92 (2%)

Query: 109 KERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK--KVRR 166
            E         E  P        +P      +PK  +     P  +  K    K  + + 
Sbjct: 485 AEPKPAEPKPAEPKPAEPKPVEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKP 544

Query: 167 RRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
             P      P      +P  A       +   
Sbjct: 545 AEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAE 576



 Score = 36.4 bits (82), Expect = 2.7,   Method: Composition-based stats.
 Identities = 13/92 (14%), Positives = 21/92 (22%), Gaps = 2/92 (2%)

Query: 109 KERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK--KVRR 166
            E         E  P        +P      +PK  +     P  +  K    K  + + 
Sbjct: 510 AEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKP 569

Query: 167 RRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
             P      P      +P  A       +   
Sbjct: 570 AEPKPAEPKPVEPKPAEPKPAEPKPAEPKPAE 601



 Score = 36.1 bits (81), Expect = 2.8,   Method: Composition-based stats.
 Identities = 13/96 (13%), Positives = 21/96 (21%), Gaps = 2/96 (2%)

Query: 109 KERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK--KVRR 166
            E         E  P        +P      +PK  +     P  +  K    K  + + 
Sbjct: 545 AEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPVEPKPAEPKPAEPKPAEPKPAEPKP 604

Query: 167 RRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
             P      P      +P  A       +       
Sbjct: 605 AEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPE 640



 Score = 36.1 bits (81), Expect = 2.9,   Method: Composition-based stats.
 Identities = 13/92 (14%), Positives = 21/92 (22%), Gaps = 2/92 (2%)

Query: 109 KERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK--KVRR 166
            E         E  P        +P      +PK  +     P  +  K    K  + + 
Sbjct: 515 AEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKP 574

Query: 167 RRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
             P      P      +P  A       +   
Sbjct: 575 AEPKPVEPKPAEPKPAEPKPAEPKPAEPKPAE 606



 Score = 36.1 bits (81), Expect = 3.1,   Method: Composition-based stats.
 Identities = 12/92 (13%), Positives = 20/92 (21%), Gaps = 2/92 (2%)

Query: 109 KERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK--KVRR 166
            E         E  P        +P      +PK  +     P  +  K    K  + + 
Sbjct: 560 AEPKPAEPKPAEPKPAEPKPVEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKP 619

Query: 167 RRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
             P      P      +P          +   
Sbjct: 620 AEPKPAEPKPAEPKPAEPKPEEPKPAEPKPAE 651



 Score = 36.1 bits (81), Expect = 3.2,   Method: Composition-based stats.
 Identities = 13/91 (14%), Positives = 21/91 (23%), Gaps = 2/91 (2%)

Query: 110 ERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK--KVRRR 167
           E         E  P        +P      +PK  +     P  +  K    K  + +  
Sbjct: 506 EPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPA 565

Query: 168 RPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
            P      P      +P  A       +   
Sbjct: 566 EPKPAEPKPAEPKPVEPKPAEPKPAEPKPAE 596



 Score = 36.1 bits (81), Expect = 3.3,   Method: Composition-based stats.
 Identities = 13/92 (14%), Positives = 20/92 (21%), Gaps = 2/92 (2%)

Query: 109 KERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK--KVRR 166
            E         E  P        +P      +PK  +     P     K    K  + + 
Sbjct: 535 AEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPVEPKPAEPKPAEPKP 594

Query: 167 RRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
             P      P      +P  A       +   
Sbjct: 595 AEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAE 626



 Score = 36.1 bits (81), Expect = 3.3,   Method: Composition-based stats.
 Identities = 13/92 (14%), Positives = 21/92 (22%), Gaps = 2/92 (2%)

Query: 109 KERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK--KVRR 166
            E         E  P        +P      +PK  +     P  +  K    K  + + 
Sbjct: 540 AEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPVEPKPAEPKPAEPKPAEPKP 599

Query: 167 RRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
             P      P      +P  A       +   
Sbjct: 600 AEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAE 631



 Score = 36.1 bits (81), Expect = 3.4,   Method: Composition-based stats.
 Identities = 13/92 (14%), Positives = 20/92 (21%), Gaps = 2/92 (2%)

Query: 109 KERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK--KVRR 166
            E         E  P        +P      +PK  +     P     K    K  + + 
Sbjct: 595 AEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPEEPKPAEPKPAEPKP 654

Query: 167 RRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
             P      P      +P  A       +   
Sbjct: 655 AEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAE 686



 Score = 36.1 bits (81), Expect = 3.5,   Method: Composition-based stats.
 Identities = 13/91 (14%), Positives = 21/91 (23%), Gaps = 2/91 (2%)

Query: 110 ERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK--KVRRR 167
           E         E  P        +P      +PK  +     P  +  K    K  + +  
Sbjct: 581 EPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPE 640

Query: 168 RPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
            P      P      +P  A       +   
Sbjct: 641 EPKPAEPKPAEPKPAEPKPAEPKPAEPKPAE 671



 Score = 35.7 bits (80), Expect = 3.9,   Method: Composition-based stats.
 Identities = 13/92 (14%), Positives = 21/92 (22%), Gaps = 2/92 (2%)

Query: 109 KERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK--KVRR 166
            E         E  P        +P      +PK  +     P  +  K    K  + + 
Sbjct: 565 AEPKPAEPKPAEPKPVEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKP 624

Query: 167 RRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
             P      P      +P  A       +   
Sbjct: 625 AEPKPAEPKPAEPKPEEPKPAEPKPAEPKPAE 656



 Score = 35.3 bits (79), Expect = 5.1,   Method: Composition-based stats.
 Identities = 13/89 (14%), Positives = 21/89 (23%), Gaps = 2/89 (2%)

Query: 109 KERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK--KVRR 166
            E         E  P        +P      +PK  +     P  +  K    K  + + 
Sbjct: 490 AEPKPAEPKPAEPKPVEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKP 549

Query: 167 RRPLRPRVFPNAKSGNQPVEATETIVPQE 195
             P      P      +P  A       +
Sbjct: 550 AEPKPAEPKPAEPKPAEPKPAEPKPAEPK 578


>gi|281416568|ref|ZP_06247588.1| cellulosome anchoring protein cohesin region [Clostridium
            thermocellum JW20]
 gi|281407970|gb|EFB38228.1| cellulosome anchoring protein cohesin region [Clostridium
            thermocellum JW20]
          Length = 1790

 Score = 42.6 bits (98), Expect = 0.031,   Method: Composition-based stats.
 Identities = 21/119 (17%), Positives = 33/119 (27%), Gaps = 4/119 (3%)

Query: 92   QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQ----PKVEDVA 147
             E    DE          +    + +  E  P     +   P  E +      P  E   
Sbjct: 982  DEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTP 1041

Query: 148  FKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQ 206
             +TP+     D    +        P   P       P E  E  +P +  SD  +  D+
Sbjct: 1042 SETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDE 1100



 Score = 42.6 bits (98), Expect = 0.031,   Method: Composition-based stats.
 Identities = 21/119 (17%), Positives = 33/119 (27%), Gaps = 4/119 (3%)

Query: 92   QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQ----PKVEDVA 147
             E    DE          +    + +  E  P     +   P  E +      P  E   
Sbjct: 1019 DEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTP 1078

Query: 148  FKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQ 206
             +TP+     D    +        P   P       P E  E  +P +  SD  +  D+
Sbjct: 1079 SETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDE 1137



 Score = 42.6 bits (98), Expect = 0.031,   Method: Composition-based stats.
 Identities = 21/119 (17%), Positives = 33/119 (27%), Gaps = 4/119 (3%)

Query: 92   QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQ----PKVEDVA 147
             E    DE          +    + +  E  P     +   P  E +      P  E   
Sbjct: 1056 DEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTP 1115

Query: 148  FKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQ 206
             +TP+     D    +        P   P       P E  E  +P +  SD  +  D+
Sbjct: 1116 SETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDE 1174



 Score = 42.6 bits (98), Expect = 0.031,   Method: Composition-based stats.
 Identities = 21/119 (17%), Positives = 33/119 (27%), Gaps = 4/119 (3%)

Query: 92   QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQ----PKVEDVA 147
             E    DE          +    + +  E  P     +   P  E +      P  E   
Sbjct: 1093 DEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTP 1152

Query: 148  FKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQ 206
             +TP+     D    +        P   P       P E  E  +P +  SD  +  D+
Sbjct: 1153 SETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDE 1211



 Score = 38.4 bits (87), Expect = 0.68,   Method: Composition-based stats.
 Identities = 19/98 (19%), Positives = 30/98 (30%), Gaps = 2/98 (2%)

Query: 109  KERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRR 168
            K  +   +     S  P   +   P  E +  P  E    +TP+     D    +     
Sbjct: 968  KAASDEPIPTDTPSDEPTPSDEPTPSDEPT--PSDEPTPSETPEEPIPTDTPSDEPTPSD 1025

Query: 169  PLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQ 206
               P   P       P E  E  +P +  SD  +  D+
Sbjct: 1026 EPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDE 1063



 Score = 38.0 bits (86), Expect = 0.83,   Method: Composition-based stats.
 Identities = 15/116 (12%), Positives = 24/116 (20%), Gaps = 2/116 (1%)

Query: 92   QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTP 151
             E    DE          +    + +  E  P     +   P  E +  P  E      P
Sbjct: 1130 DEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPT--PSDEPTPSDEP 1187

Query: 152  DISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQD 207
              S   +             P   P       P +          +      +  D
Sbjct: 1188 TPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTD 1243



 Score = 37.6 bits (85), Expect = 1.2,   Method: Composition-based stats.
 Identities = 17/108 (15%), Positives = 25/108 (23%), Gaps = 4/108 (3%)

Query: 92   QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQ----PKVEDVA 147
             E    DE          E  +  +     S  P   +   P  E +      P  E   
Sbjct: 1173 DEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTP 1232

Query: 148  FKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQE 195
             +TP+     D    +        P   P       P +        E
Sbjct: 1233 SETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPE 1280



 Score = 37.6 bits (85), Expect = 1.2,   Method: Composition-based stats.
 Identities = 17/108 (15%), Positives = 25/108 (23%), Gaps = 4/108 (3%)

Query: 92   QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQ----PKVEDVA 147
             E    DE          E  +  +     S  P   +   P  E +      P  E   
Sbjct: 1216 DEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTP 1275

Query: 148  FKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQE 195
             +TP+     D    +        P   P       P +        E
Sbjct: 1276 SETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPE 1323



 Score = 37.6 bits (85), Expect = 1.2,   Method: Composition-based stats.
 Identities = 17/108 (15%), Positives = 25/108 (23%), Gaps = 4/108 (3%)

Query: 92   QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQ----PKVEDVA 147
             E    DE          E  +  +     S  P   +   P  E +      P  E   
Sbjct: 1259 DEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTP 1318

Query: 148  FKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQE 195
             +TP+     D    +        P   P       P +        E
Sbjct: 1319 SETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPE 1366



 Score = 37.6 bits (85), Expect = 1.2,   Method: Composition-based stats.
 Identities = 17/108 (15%), Positives = 25/108 (23%), Gaps = 4/108 (3%)

Query: 92   QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQ----PKVEDVA 147
             E    DE          E  +  +     S  P   +   P  E +      P  E   
Sbjct: 1302 DEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTP 1361

Query: 148  FKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQE 195
             +TP+     D    +        P   P       P +        E
Sbjct: 1362 SETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPE 1409



 Score = 36.1 bits (81), Expect = 2.9,   Method: Composition-based stats.
 Identities = 18/116 (15%), Positives = 26/116 (22%), Gaps = 2/116 (1%)

Query: 92   QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTP 151
             E    DE          +    + +  E  P     +   P  E +  P  E      P
Sbjct: 1339 DEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPT--PSDEPTPSDEP 1396

Query: 152  DISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQD 207
              S E   S           P   P       P +        E  + +      D
Sbjct: 1397 TPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSETPEEPTPSDEPTPSD 1452


>gi|145482197|ref|XP_001427121.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124394200|emb|CAK59723.1| unnamed protein product [Paramecium tetraurelia]
          Length = 1734

 Score = 42.6 bits (98), Expect = 0.031,   Method: Composition-based stats.
 Identities = 20/116 (17%), Positives = 41/116 (35%), Gaps = 4/116 (3%)

Query: 84   VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV 143
            +     Q +   ++ +Q +   ++ K+         +  P     +  EP  E   QP+ 
Sbjct: 1052 LKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEP 1111

Query: 144  EDVAFKTPDISREKDV--SYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELN 197
                 K P+  +E+       K + ++P  P+  P  K    P E  +   P +  
Sbjct: 1112 PKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQP--KQPEPPKEQPKQPEPPKEQ 1165



 Score = 42.2 bits (97), Expect = 0.041,   Method: Composition-based stats.
 Identities = 20/116 (17%), Positives = 41/116 (35%), Gaps = 4/116 (3%)

Query: 84   VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV 143
            +     Q +   ++ +Q +   ++ K+         +  P     +  EP  E   QP+ 
Sbjct: 1022 LKEQPKQPEPPKEQPKQPEPPKEQPKQPEPLKEQPKQPEPPKEQPKQPEPPKEQPKQPEP 1081

Query: 144  EDVAFKTPDISREKDV--SYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELN 197
                 K P+  +E+       K + ++P  P+  P  K    P E  +   P +  
Sbjct: 1082 PKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQP--KQPEPPKEQPKQPEPPKEQ 1135



 Score = 42.2 bits (97), Expect = 0.042,   Method: Composition-based stats.
 Identities = 21/114 (18%), Positives = 41/114 (35%), Gaps = 4/114 (3%)

Query: 86   MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVED 145
                Q +   ++ +Q + L ++ K+         +  P     +  EP  E   QP+   
Sbjct: 1034 EQPKQPEPPKEQPKQPEPLKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPK 1093

Query: 146  VAFKTPDISREKDV--SYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELN 197
               K P+  +E+       K + ++P  P+  P  K    P E  +   P +  
Sbjct: 1094 EQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQP--KQPEPPKEQPKQPEPPKEQ 1145



 Score = 41.8 bits (96), Expect = 0.060,   Method: Composition-based stats.
 Identities = 20/119 (16%), Positives = 40/119 (33%), Gaps = 4/119 (3%)

Query: 86   MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVED 145
                Q +   ++ +Q +   ++ K+         +  P     +  EP  E   QP+   
Sbjct: 1074 EQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPK 1133

Query: 146  VAFKTPDISREKDV--SYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
               K P+  +E+       K + ++P  P+  P  K    P E  +   P +       
Sbjct: 1134 EQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQP--KQPEPPKEQPKQPEPPKEQPKQQE 1190



 Score = 41.8 bits (96), Expect = 0.061,   Method: Composition-based stats.
 Identities = 20/114 (17%), Positives = 40/114 (35%), Gaps = 4/114 (3%)

Query: 86   MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVED 145
                Q +   ++ +Q +   ++ K+         +  P     +  EP  E   QP+   
Sbjct: 1064 EQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPK 1123

Query: 146  VAFKTPDISREKDV--SYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELN 197
               K P+  +E+       K + ++P  P+  P  K    P E  +   P +  
Sbjct: 1124 EQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQP--KQPEPPKEQPKQPEPPKEQ 1175



 Score = 41.4 bits (95), Expect = 0.074,   Method: Composition-based stats.
 Identities = 21/123 (17%), Positives = 41/123 (33%), Gaps = 4/123 (3%)

Query: 86   MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVED 145
                Q +   ++ +Q +   ++ K+         +  P     +  EP  E   QP+   
Sbjct: 1084 EQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPK 1143

Query: 146  VAFKTPDISREKDV--SYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASS 203
               K P+  +E+       K + ++P  P+  P  K    P E  +   P +        
Sbjct: 1144 EQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQP--KQPEPPKEQPKQQEPPKQPEQPKEQ 1201

Query: 204  VDQ 206
              Q
Sbjct: 1202 PKQ 1204



 Score = 41.1 bits (94), Expect = 0.092,   Method: Composition-based stats.
 Identities = 23/113 (20%), Positives = 41/113 (36%), Gaps = 5/113 (4%)

Query: 88   QAQIQEKLQRDEQDDLLVKEQKERAQNA-LSEFEASPCPLIEEGKEPIFENSIQPKVEDV 146
            Q +  E L+   +     KEQ ++ +       +  P     +  EP  E   QP+    
Sbjct: 1045 QPKQPEPLKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKE 1104

Query: 147  AFKTPDISREKDV--SYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELN 197
              K P+  +E+       K + ++P  P+  P  K    P E  +   P +  
Sbjct: 1105 QPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQP--KQPEPPKEQPKQPEPPKEQ 1155



 Score = 39.1 bits (89), Expect = 0.39,   Method: Composition-based stats.
 Identities = 22/133 (16%), Positives = 48/133 (36%), Gaps = 9/133 (6%)

Query: 86   MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVED 145
                Q +   ++ +Q +   ++ K+         +  P     +  EP  E   QP+   
Sbjct: 1104 EQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPK 1163

Query: 146  VAFKTPDISREKDVSYKKVR--------RRRPLRPRVFPNA-KSGNQPVEATETIVPQEL 196
               K P+  +E+    +  +         ++P +P+  P   +S  QP+ + E     E 
Sbjct: 1164 EQPKQPEPPKEQPKQPEPPKEQPKQQEPPKQPEQPKEQPKQPESPKQPLPSKEQPKQPEP 1223

Query: 197  NSDNASSVDQDCK 209
              +     +Q+ K
Sbjct: 1224 TKEPLKKPEQEIK 1236



 Score = 34.5 bits (77), Expect = 9.1,   Method: Composition-based stats.
 Identities = 12/71 (16%), Positives = 24/71 (33%)

Query: 88   QAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVA 147
            Q +  ++  +  +      +Q+E  +      E    P   +   P  E   QP+     
Sbjct: 1168 QPEPPKEQPKQPEPPKEQPKQQEPPKQPEQPKEQPKQPESPKQPLPSKEQPKQPEPTKEP 1227

Query: 148  FKTPDISREKD 158
             K P+   +K 
Sbjct: 1228 LKKPEQEIKKP 1238


>gi|123477278|ref|XP_001321807.1| hypothetical protein [Trichomonas vaginalis G3]
 gi|121904641|gb|EAY09584.1| hypothetical protein TVAG_056280 [Trichomonas vaginalis G3]
          Length = 1677

 Score = 42.6 bits (98), Expect = 0.031,   Method: Composition-based stats.
 Identities = 18/107 (16%), Positives = 37/107 (34%), Gaps = 7/107 (6%)

Query: 98   DEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREK 157
            D ++     E   +     ++    P    EE  +   E +  P       + P  + E+
Sbjct: 1495 DPENPTPDPENPTQNPEEPTQNPEEPTQNPEEPTQNPEEPTQNP-------EEPTQNPEE 1547

Query: 158  DVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSV 204
                 +   + P+ P V P   S    V + +       N +N++S+
Sbjct: 1548 PTQNPEEPTKEPVHPTVEPLKPSSTSNVPSNDDSEDPSNNIENSASL 1594


>gi|171681806|ref|XP_001905846.1| hypothetical protein [Podospora anserina S mat+]
 gi|170940862|emb|CAP66512.1| unnamed protein product [Podospora anserina S mat+]
          Length = 1198

 Score = 42.6 bits (98), Expect = 0.033,   Method: Composition-based stats.
 Identities = 21/97 (21%), Positives = 36/97 (37%), Gaps = 5/97 (5%)

Query: 114 NALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPR 173
              ++FE  P P +E   EP  E   +P  E      P+   E      +++    + P+
Sbjct: 847 EPPTDFEMQPEPQLEPQPEPHVEAHPEPPAEAQPELQPEPQIE---PQPELQAAPRVEPQ 903

Query: 174 VFPNAKSGNQ--PVEATETIVPQELNSDNASSVDQDC 208
             P    G +  PV      V    ++D++ S   D 
Sbjct: 904 TQPAQTDGAEETPVPQVTGPVASHDDADDSRSDMDDF 940


>gi|307330702|ref|ZP_07609840.1| conserved hypothetical protein [Streptomyces violaceusniger Tu
           4113]
 gi|306883681|gb|EFN14729.1| conserved hypothetical protein [Streptomyces violaceusniger Tu
           4113]
          Length = 891

 Score = 42.6 bits (98), Expect = 0.034,   Method: Composition-based stats.
 Identities = 26/93 (27%), Positives = 33/93 (35%), Gaps = 7/93 (7%)

Query: 110 ERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRP 169
            RA   LSE E    P  E G EP      QP+V   A   P    + +V          
Sbjct: 621 HRAIGLLSETETGTQPEPETGAEPEVGTGTQPEVGTGAQSEPGTEAQPEVGTGAE----- 675

Query: 170 LRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
             P  +P A++  +P   T T   Q   S  A 
Sbjct: 676 --PEAWPTAETQPRPRVHTRTAEAQAAGSGAAD 706


>gi|301614770|ref|XP_002936857.1| PREDICTED: probable G-protein coupled receptor 124-like [Xenopus
           (Silurana) tropicalis]
          Length = 623

 Score = 42.6 bits (98), Expect = 0.035,   Method: Composition-based stats.
 Identities = 20/121 (16%), Positives = 38/121 (31%)

Query: 82  RIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQP 141
           R ++  Q Q Q    R EQ   L   Q++    A  + +A P    +E  +P+     Q 
Sbjct: 15  RPLAPRQEQAQPLAPRQEQAQPLAPRQEQAQPLAPRQEQAQPLAPRQEQAQPLAPRQEQA 74

Query: 142 KVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNA 201
           +      +       +    + +  R+     + P  +         E   P     + A
Sbjct: 75  QPLAPRQEQAQPLAPRQEQAQPLAPRQEQAQPLAPRQEQAQPLAPRQEQAQPLAPRQEQA 134

Query: 202 S 202
            
Sbjct: 135 Q 135



 Score = 41.4 bits (95), Expect = 0.086,   Method: Composition-based stats.
 Identities = 19/119 (15%), Positives = 37/119 (31%)

Query: 84  VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV 143
           ++  Q Q Q    R EQ   L   Q++    A  + +A P    +E  +P+     Q + 
Sbjct: 27  LAPRQEQAQPLAPRQEQAQPLAPRQEQAQPLAPRQEQAQPLAPRQEQAQPLAPRQEQAQP 86

Query: 144 EDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
                +       +    + +  R+     + P  +         E   P     + A 
Sbjct: 87  LAPRQEQAQPLAPRQEQAQPLAPRQEQAQPLAPRQEQAQPLAPRQEQAQPLAPRQEQAQ 145



 Score = 41.4 bits (95), Expect = 0.086,   Method: Composition-based stats.
 Identities = 19/119 (15%), Positives = 37/119 (31%)

Query: 84  VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV 143
           ++  Q Q Q    R EQ   L   Q++    A  + +A P    +E  +P+     Q + 
Sbjct: 37  LAPRQEQAQPLAPRQEQAQPLAPRQEQAQPLAPRQEQAQPLAPRQEQAQPLAPRQEQAQP 96

Query: 144 EDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
                +       +    + +  R+     + P  +         E   P     + A 
Sbjct: 97  LAPRQEQAQPLAPRQEQAQPLAPRQEQAQPLAPRQEQAQPLAPRQEQAQPLAPRQEQAQ 155



 Score = 41.1 bits (94), Expect = 0.090,   Method: Composition-based stats.
 Identities = 18/120 (15%), Positives = 38/120 (31%)

Query: 83  IVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPK 142
           +++  Q Q +    R EQ   L   Q++    A  + +A P    +E  +P+     Q +
Sbjct: 6   VLAPRQEQARPLAPRQEQAQPLAPRQEQAQPLAPRQEQAQPLAPRQEQAQPLAPRQEQAQ 65

Query: 143 VEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
                 +       +    + +  R+     + P  +         E   P     + A 
Sbjct: 66  PLAPRQEQAQPLAPRQEQAQPLAPRQEQAQPLAPRQEQAQPLAPRQEQAQPLAPRQEQAQ 125



 Score = 39.9 bits (91), Expect = 0.20,   Method: Composition-based stats.
 Identities = 18/112 (16%), Positives = 35/112 (31%)

Query: 84  VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV 143
           ++  Q Q Q    R EQ   L   Q++    A  + +A P    +E  +P+     Q + 
Sbjct: 47  LAPRQEQAQPLAPRQEQAQPLAPRQEQAQPLAPRQEQAQPLAPRQEQAQPLAPRQEQAQP 106

Query: 144 EDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQE 195
                +       +    + +  R+     + P  +         E   P  
Sbjct: 107 LAPRQEQAQPLAPRQEQAQPLAPRQEQAQPLAPRQEQAQPLAPRQEQAQPLA 158



 Score = 38.8 bits (88), Expect = 0.53,   Method: Composition-based stats.
 Identities = 18/114 (15%), Positives = 36/114 (31%)

Query: 84  VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV 143
           ++  Q Q Q    R EQ   L   Q++    A  + +A P    +E  +P+     Q + 
Sbjct: 57  LAPRQEQAQPLAPRQEQAQPLAPRQEQAQPLAPRQEQAQPLAPRQEQAQPLAPRQEQAQP 116

Query: 144 EDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELN 197
                +       +    + +  R+     + P  +         E  V  +  
Sbjct: 117 LAPRQEQAQPLAPRQEQAQPLAPRQEQAQPLAPRQEQAQPLAPRQERRVAIQAQ 170



 Score = 36.4 bits (82), Expect = 2.5,   Method: Composition-based stats.
 Identities = 21/103 (20%), Positives = 37/103 (35%), Gaps = 5/103 (4%)

Query: 84  VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV 143
           ++  Q Q Q    R EQ   L   Q++    A  + +A P    +E  +P+      P+ 
Sbjct: 87  LAPRQEQAQPLAPRQEQAQPLAPRQEQAQPLAPRQEQAQPLAPRQEQAQPLA-----PRQ 141

Query: 144 EDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVE 186
           E      P   + + ++ ++ RR      R         Q  E
Sbjct: 142 EQAQPLAPRQEQAQPLAPRQERRVAIQAQRQERRVAVQAQRQE 184


>gi|293569937|ref|ZP_06681024.1| surface protein, putative [Enterococcus faecium E1071]
 gi|291587685|gb|EFF19562.1| surface protein, putative [Enterococcus faecium E1071]
          Length = 389

 Score = 42.6 bits (98), Expect = 0.035,   Method: Composition-based stats.
 Identities = 20/129 (15%), Positives = 39/129 (30%), Gaps = 7/129 (5%)

Query: 88  QAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKE------PIFENSIQP 141
           + + + K +    ++   +++ E       + E  P P  E   E      P  +   +P
Sbjct: 173 KPENENKPEVPPTENPDGEQKPEIEPGEEPDTETQPEPDNESKPEITPGEKPDVDPEEKP 232

Query: 142 KVEDVAFKTPDISREKDVSYKKVRR-RRPLRPRVFPNAKSGNQPVEATETIVPQELNSDN 200
            V              + +         P +P V P  K    P   T+          N
Sbjct: 233 DVTPEPDTDSGNQTVPETNPDTDNETENPEKPEVDPEEKPDVTPEPDTDARDQGIPEKIN 292

Query: 201 ASSVDQDCK 209
             ++ +D K
Sbjct: 293 KKTIQEDGK 301



 Score = 34.9 bits (78), Expect = 6.7,   Method: Composition-based stats.
 Identities = 25/122 (20%), Positives = 40/122 (32%), Gaps = 2/122 (1%)

Query: 87  AQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDV 146
           +Q Q  E+    +    LV+E  ++ +N     E  P    +  ++P  E   +P  E  
Sbjct: 149 SQRQTIEQDSAIDSGGDLVEEPTDKPENENKP-EVPPTENPDGEQKPEIEPGEEPDTETQ 207

Query: 147 AFKTPDISRE-KDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVD 205
                +   E        V           P+  SGNQ V  T      E  +     VD
Sbjct: 208 PEPDNESKPEITPGEKPDVDPEEKPDVTPEPDTDSGNQTVPETNPDTDNETENPEKPEVD 267

Query: 206 QD 207
            +
Sbjct: 268 PE 269


>gi|195426626|ref|XP_002061413.1| GK20738 [Drosophila willistoni]
 gi|194157498|gb|EDW72399.1| GK20738 [Drosophila willistoni]
          Length = 1187

 Score = 42.6 bits (98), Expect = 0.036,   Method: Composition-based stats.
 Identities = 15/99 (15%), Positives = 33/99 (33%), Gaps = 2/99 (2%)

Query: 99   EQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDV--AFKTPDISRE 156
            ++ +   K  + + Q  +            +  +PI      P+ E      K+ +I   
Sbjct: 961  DKKEKTRKLSERQEQVQVPPPPIKEQTPPPQQSKPIEATPKSPQDEATSPLNKSYNIDLS 1020

Query: 157  KDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQE 195
                    +  +  R R+   +KS   P  +T+   P +
Sbjct: 1021 SWTPQPSQKLSQKERKRLSSESKSWRSPAPSTQVATPPQ 1059


>gi|324500658|gb|ADY40303.1| Unknown [Ascaris suum]
          Length = 1483

 Score = 42.6 bits (98), Expect = 0.037,   Method: Composition-based stats.
 Identities = 20/87 (22%), Positives = 33/87 (37%), Gaps = 1/87 (1%)

Query: 86   MAQAQIQEKLQRDEQDDLLVKEQKE-RAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
             +Q + + KL  D+    +     E + Q   +  EASP P+ E   +     S +PK E
Sbjct: 1384 ASQPEPEPKLPNDKDGQQVSGPNIESKPQPTSANNEASPEPIPEPTTQSGSNPSAEPKPE 1443

Query: 145  DVAFKTPDISREKDVSYKKVRRRRPLR 171
                  P+ +   +   K   R  P  
Sbjct: 1444 IGPQAEPEPTNITNNRTKGCERSNPSA 1470


>gi|213512353|ref|NP_001135283.1| Hematopoietic lineage cell-specific protein [Salmo salar]
 gi|209155998|gb|ACI34231.1| Hematopoietic lineage cell-specific protein [Salmo salar]
          Length = 511

 Score = 42.6 bits (98), Expect = 0.037,   Method: Composition-based stats.
 Identities = 26/129 (20%), Positives = 53/129 (41%), Gaps = 2/129 (1%)

Query: 46  TAQHIAERYSVLARDAMSAGD-YVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLL 104
           +     E+   L   +  AG+     EN  + ++  NR  +  +   ++  ++ EQ++  
Sbjct: 253 SPTSAYEKTLPLEASSAGAGNLKARFENLARSSDEENRKRAEEERARRQAREKREQEEAR 312

Query: 105 VKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKV 164
            ++Q++ ++   +E    P P+ E+   PI E    P  E      P+ +R+        
Sbjct: 313 RRQQEQNSREEEAEQH-QPPPVEEQRPPPIEEQRPPPVEEQRPPPFPEANRKPQPPQLPT 371

Query: 165 RRRRPLRPR 173
            R  P  PR
Sbjct: 372 ARALPQIPR 380


>gi|141852|gb|AAA21932.1| sialidase [Actinomyces viscosus]
          Length = 901

 Score = 42.2 bits (97), Expect = 0.040,   Method: Composition-based stats.
 Identities = 19/106 (17%), Positives = 25/106 (23%), Gaps = 9/106 (8%)

Query: 108 QKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSY------ 161
           QK    +      A+P     E   P    S +P         P+ S   + S       
Sbjct: 663 QKPAEPSPAPSPTAAPSAAPTEKPAPSAAPSAEPTQAPAPSSAPEPSAAPEPSSAPAPEP 722

Query: 162 ---KKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSV 204
                        P   P    G     A ET          A +V
Sbjct: 723 TTAPSTEPTPAPAPSSAPEQTDGPTAAPAPETSSAPAAEPTQAPTV 768



 Score = 38.0 bits (86), Expect = 0.81,   Method: Composition-based stats.
 Identities = 18/79 (22%), Positives = 25/79 (31%), Gaps = 9/79 (11%)

Query: 118 EFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPD--------ISREKDVSYKKVRRRRP 169
           E  A+P P      EP    S +P         P+         + E   +      + P
Sbjct: 707 EPSAAPEPSSAPAPEPTTAPSTEPTPAPAPSSAPEQTDGPTAAPAPETSSAPAAEPTQAP 766

Query: 170 -LRPRVFPNAKSGNQPVEA 187
            + P V P    G QP  A
Sbjct: 767 TVAPSVEPTQAPGAQPSSA 785


>gi|313904164|ref|ZP_07837543.1| hypothetical protein EubceDRAFT_0258 [Eubacterium cellulosolvens 6]
 gi|313470966|gb|EFR66289.1| hypothetical protein EubceDRAFT_0258 [Eubacterium cellulosolvens 6]
          Length = 701

 Score = 42.2 bits (97), Expect = 0.040,   Method: Composition-based stats.
 Identities = 26/162 (16%), Positives = 51/162 (31%), Gaps = 4/162 (2%)

Query: 47  AQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVK 106
              + + Y   + +  + G   +A+ + +  E     V M           +    +  +
Sbjct: 233 PHSLKKFYKDYSGENQTDGCPALADIYFEGTEDEWAAVEMYSVDENWDGYNESSKWVKSE 292

Query: 107 EQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDI-SREKDVSYKKVR 165
           +     +  L   +A P P  E         + +P+       T +  +       ++ +
Sbjct: 293 DNSLGDEITLRFQDAQPTPTEEPEATATPVPTEEPEATATPVPTEEPEATVTPAPTEEPK 352

Query: 166 RRRPLRPRVFPNAKSGNQPV---EATETIVPQELNSDNASSV 204
                 P   P A +   P    EAT T VP E     A+ V
Sbjct: 353 ATATPVPTEEPEATATPVPTEEPEATATPVPTEEPEATATPV 394


>gi|15618622|ref|NP_224908.1| FHA domain-containing protein [Chlamydophila pneumoniae CWL029]
 gi|15836244|ref|NP_300768.1| FHA domain-containing protein [Chlamydophila pneumoniae J138]
 gi|16752328|ref|NP_444586.1| hypothetical protein CP0034 [Chlamydophila pneumoniae AR39]
 gi|4377015|gb|AAD18851.1| adenylate cyclase-like protein [Chlamydophila pneumoniae CWL029]
 gi|7188974|gb|AAF37929.1| conserved hypothetical protein [Chlamydophila pneumoniae AR39]
 gi|8979084|dbj|BAA98919.1| FHA domain [Chlamydophila pneumoniae J138]
          Length = 845

 Score = 42.2 bits (97), Expect = 0.042,   Method: Composition-based stats.
 Identities = 34/190 (17%), Positives = 69/190 (36%), Gaps = 32/190 (16%)

Query: 35  DSN--GYDVKVRGTAQHIA-----ERYS--VLARDAMSAGDYVVAENHLQHAEHYNRIVS 85
           DSN  G D++ R T++        E+ +    + D +++GD  +A+            ++
Sbjct: 126 DSNEQGKDLEPRQTSETNHSPKPKEKLTKDQGSSDPITSGDQELADAF----------LA 175

Query: 86  MAQAQIQEKL--------QRDEQDDLLVKEQKERAQNALSEFEASPCPLIEE--GKEPIF 135
            A+A+  +          +    + L  KEQ  +      E    P   I E  G  P  
Sbjct: 176 SAKAEKNQPRAKVAKKGLKESSNESLNPKEQNAKDSPKGEERTNKPQNAIMEDNGASPRQ 235

Query: 136 EN---SIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIV 192
           +    S +P +++ A     +   K V  K  ++  P  P      + G++   +     
Sbjct: 236 DPQPKSAEPSLKNTARDETPLKENKPVEEKANKKATPDSPEKKDQPEEGSKKEGSKIEAT 295

Query: 193 PQELNSDNAS 202
           P +   ++  
Sbjct: 296 PLDSQKESED 305


>gi|303259653|ref|ZP_07345629.1| Zinc metalloprotease zmpC precursor, putative [Streptococcus
           pneumoniae SP-BS293]
 gi|303264556|ref|ZP_07350475.1| Zinc metalloprotease zmpC precursor, putative [Streptococcus
           pneumoniae BS397]
 gi|302639205|gb|EFL69664.1| Zinc metalloprotease zmpC precursor, putative [Streptococcus
           pneumoniae SP-BS293]
 gi|302645926|gb|EFL76154.1| Zinc metalloprotease zmpC precursor, putative [Streptococcus
           pneumoniae BS397]
          Length = 1669

 Score = 42.2 bits (97), Expect = 0.043,   Method: Composition-based stats.
 Identities = 16/98 (16%), Positives = 27/98 (27%), Gaps = 12/98 (12%)

Query: 117 SEFEASPCPLIEEGKEPIFENSIQPK------------VEDVAFKTPDISREKDVSYKKV 164
           ++ E +P P      EP     +QP+                A  TP   +  D    + 
Sbjct: 369 TKEEVAPKPTQPVTPEPEEVKPVQPEKIEKKPADGIGQPRPEAEATPGEKQIPDKPEAEP 428

Query: 165 RRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
           ++  P  P V    +             P    +  A 
Sbjct: 429 KQPEPATPAVESGGEENLTHAPQGTESQPPSKETAEAK 466



 Score = 36.8 bits (83), Expect = 2.0,   Method: Composition-based stats.
 Identities = 30/189 (15%), Positives = 62/189 (32%), Gaps = 36/189 (19%)

Query: 25  KNLNPLVRNYDSNGYDVKV---RGTAQHIAERYSVLARDAMSAGDYVVA--ENHLQHAEH 79
           K   P     +S G +      +GT      + +  A+D+   G  V +  E +  HA  
Sbjct: 429 KQPEPATPAVESGGEENLTHAPQGTESQPPSKETAEAKDSEPEGPAVESGGEENQTHAPQ 488

Query: 80  YNRIVSMAQAQIQEKLQ----------RDEQDDLLVKEQKERA-----QNALSEFEASPC 124
                  ++   + K            R+E      ++ +E       +      E++P 
Sbjct: 489 GTESKQPSKETAETKDSEPAPPAVESGREEDQSPAEQKGEENQLENPVEGVKDTGESAPQ 548

Query: 125 PLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQP 184
              ++ ++P  + +  P+V       P+ + + +          PL P+  P       P
Sbjct: 549 EPQKQPEQP-EQTAPSPEVNPSQGNEPEPAVQPE----------PLAPQEQP-----TVP 592

Query: 185 VEATETIVP 193
              T+  V 
Sbjct: 593 SPVTKETVL 601


>gi|149002353|ref|ZP_01827295.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae SP14-BS69]
 gi|147759668|gb|EDK66659.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae SP14-BS69]
          Length = 1883

 Score = 42.2 bits (97), Expect = 0.043,   Method: Composition-based stats.
 Identities = 26/141 (18%), Positives = 46/141 (32%), Gaps = 24/141 (17%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
           +  QA+ + ++   E+     +  KE  ++ +   + +  P +EEGKE   E +   +V 
Sbjct: 186 NQEQARTENQVVETEEAPKTEESPKEEPKSEIKPTDDT-LPKVEEGKEASAEPATVEEVG 244

Query: 145 DVAFKTPDISR-EKDVSYKKVRRRR---------PLRPR----------VFPNAKSGNQP 184
                 P+     K  S    +            P+ PR            P A    + 
Sbjct: 245 GEVESKPEEKVAVKPESQPSDKPAEESKVEQAGEPVAPREDEKAPVEPEKQPEAPEEEKA 304

Query: 185 VEAT---ETIVPQELNSDNAS 202
           VE T   E   P     +   
Sbjct: 305 VEETPKQEESTPDTKAEETVE 325


>gi|289620739|emb|CBI52749.1| unnamed protein product [Sordaria macrospora]
          Length = 1359

 Score = 42.2 bits (97), Expect = 0.044,   Method: Composition-based stats.
 Identities = 19/99 (19%), Positives = 37/99 (37%), Gaps = 1/99 (1%)

Query: 75  QHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPI 134
           QH  HY R+ +  +A  Q   + +EQ+          AQ+        P P +     P+
Sbjct: 135 QHERHYERVQTEVRALEQAVARGEEQERRAKIPDGVPAQDGPVAAH-KPSPALGPIPSPV 193

Query: 135 FENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPR 173
                 P++ + A   P  +    ++  ++   +   PR
Sbjct: 194 SVQGPGPRLPNGAGHGPSPAASPRIASPRLPPPQTQSPR 232


>gi|111658665|ref|ZP_01409308.1| hypothetical protein SpneT_02000171 [Streptococcus pneumoniae
           TIGR4]
 gi|76363500|sp|Q9L7Q2|ZMPB_STRPN RecName: Full=Zinc metalloprotease zmpB; Flags: Precursor
          Length = 1906

 Score = 42.2 bits (97), Expect = 0.044,   Method: Composition-based stats.
 Identities = 31/155 (20%), Positives = 50/155 (32%), Gaps = 31/155 (20%)

Query: 83  IVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPC----PLIEEGKEPIFENS 138
           I +  QA+ + ++   E+       + E +     + E  P     P +EEGKE   E +
Sbjct: 184 ITNQEQARTENQVVETEEAPKEEAPKTEESPKEEPKSEVKPTDDTLPKVEEGKEDSAEPA 243

Query: 139 IQPKVEDVAFKTPDISR-EKDVSYKKVRRRR---------PLRPR----------VFPNA 178
              +V       P+     K  S    +            P+ PR            P A
Sbjct: 244 PVEEVGGEVESKPEEKVAVKPESQPSDKPAEESKVEQAGEPVAPREDEKAPVEPEKQPEA 303

Query: 179 KSGNQPVEAT---ETIVP----QELNSDNASSVDQ 206
               + VE T   E   P    +E       +V+Q
Sbjct: 304 PEEEKAVEETPKQEESTPDTKAEETVEPKEETVNQ 338



 Score = 40.3 bits (92), Expect = 0.15,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 43/132 (32%), Gaps = 14/132 (10%)

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFE----NSIQPKVE 144
            +  EK   + +      E+++  +    + E++P    EE  EP  E    +  QPKVE
Sbjct: 287 PREDEKAPVEPEKQPEAPEEEKAVEETPKQEESTPDTKAEETVEPKEETVNQSIEQPKVE 346

Query: 145 -DVAFKTPDISREKDVSYKKV---------RRRRPLRPRVFPNAKSGNQPVEATETIVPQ 194
                K  + + E  V                  P+ P   P      + VE T     +
Sbjct: 347 TPAVEKQTEPTEEPKVEQAGEPVAPREDEQAPTAPVEPEKQPEVPEEEKAVEETPKPEDK 406

Query: 195 ELNSDNASSVDQ 206
                    VD+
Sbjct: 407 IKGIGTKEPVDK 418


>gi|124430470|dbj|BAF46261.1| putative zinc metalloprotease [Streptococcus pneumoniae]
          Length = 1876

 Score = 42.2 bits (97), Expect = 0.047,   Method: Composition-based stats.
 Identities = 28/149 (18%), Positives = 50/149 (33%), Gaps = 28/149 (18%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
           +  QA+ + ++   E+     +  KE  ++ +   + +  P +EEGKE   E +   +V 
Sbjct: 161 NQEQARTENQVVETEEAPKTEESPKEEPKSEIKPTDDT-LPKVEEGKEASAEPATVEEVG 219

Query: 145 DVAFKTPDISR-EKDVSYKKVRRRR-------------------PLRPRVFPNAKSGNQP 184
                 P+     K  S    +                      P+ P   P A    + 
Sbjct: 220 GEVESKPEEKVAVKPESQPSDKPAEESKVEQAGEPVAPREDEKAPVEPEKQPEAPEEEKA 279

Query: 185 VEAT---ETIVP----QELNSDNASSVDQ 206
           VE T   E   P    +E       +V+Q
Sbjct: 280 VEETPKQEESTPDTKAEETVEPKEETVNQ 308



 Score = 40.3 bits (92), Expect = 0.17,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 43/132 (32%), Gaps = 14/132 (10%)

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFE----NSIQPKVE 144
            +  EK   + +      E+++  +    + E++P    EE  EP  E    +  QPKVE
Sbjct: 257 PREDEKAPVEPEKQPEAPEEEKAVEETPKQEESTPDTKAEETVEPKEETVNQSIEQPKVE 316

Query: 145 -DVAFKTPDISREKDVSYKKV---------RRRRPLRPRVFPNAKSGNQPVEATETIVPQ 194
                K  + + E  V                  P+ P   P      + VE T     +
Sbjct: 317 TPAVEKQTEPTEEPKVEQAGEPVAPREDEQAPTAPVEPEKQPEVPEEEKAVEETPKPEDK 376

Query: 195 ELNSDNASSVDQ 206
                    VD+
Sbjct: 377 IKGIGTKEPVDK 388


>gi|149510027|ref|XP_001517017.1| PREDICTED: similar to DENN/MADD domain containing 1C
           [Ornithorhynchus anatinus]
          Length = 914

 Score = 42.2 bits (97), Expect = 0.049,   Method: Composition-based stats.
 Identities = 15/83 (18%), Positives = 28/83 (33%), Gaps = 2/83 (2%)

Query: 124 CPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQ 183
            P+      P+ E+  QP+        P+   E  +  K         P+  P+  S   
Sbjct: 803 EPIPAPQPAPLPESMPQPEPVPEPMSQPEPMSEPMLEPKIEPPGFLNTPQ--PSEISAFS 860

Query: 184 PVEATETIVPQELNSDNASSVDQ 206
              A+  + P   +  N+   +Q
Sbjct: 861 QHPASTLLGPPSQSPQNSGMWNQ 883


>gi|324328807|gb|ADY24067.1| cell surface protein [Bacillus thuringiensis serovar finitimus
            YBT-020]
          Length = 3567

 Score = 42.2 bits (97), Expect = 0.050,   Method: Composition-based stats.
 Identities = 18/90 (20%), Positives = 36/90 (40%), Gaps = 1/90 (1%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
             + + K +  ++ ++  +E KE         E    P   +  E   E+  +P+V+    
Sbjct: 3425 KEPEVKPEEPKEPEVKPEEPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDP 3484

Query: 149  KTPDISREKDVSYKKVRRRRPLRPRVFPNA 178
            K P++  E+     +V+   P  P V P  
Sbjct: 3485 KEPEVKPEEPKEP-EVKPEDPKEPEVKPEN 3513



 Score = 40.7 bits (93), Expect = 0.13,   Method: Composition-based stats.
 Identities = 21/109 (19%), Positives = 42/109 (38%), Gaps = 3/109 (2%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
             + + K +  ++ ++  ++ KE         E    P   +  E   E+  +P+V+    
Sbjct: 3276 KESEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDP 3335

Query: 149  KTPDISREKDVSYKKVRRRRPLRPRVFPNA--KSGNQPVEATETIVPQE 195
            K P++  E      +V+   P  P V P    +   +P +  E  V  E
Sbjct: 3336 KEPEVKPEDPKEP-EVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPE 3383



 Score = 36.8 bits (83), Expect = 2.1,   Method: Composition-based stats.
 Identities = 16/86 (18%), Positives = 34/86 (39%), Gaps = 1/86 (1%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
             + + K +  ++ ++  ++ KE         E    P   +  E   E+  +P+V+    
Sbjct: 3316 KEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDP 3375

Query: 149  KTPDISREKDVSYKKVRRRRPLRPRV 174
            K P++  E      +V+   P  P V
Sbjct: 3376 KEPEVKPEDPKEP-EVKPEDPKEPEV 3400



 Score = 34.9 bits (78), Expect = 8.1,   Method: Composition-based stats.
 Identities = 21/81 (25%), Positives = 29/81 (35%), Gaps = 5/81 (6%)

Query: 119  FEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKV--RRRRPLRPRVFP 176
                P    EE KEP  +   +PK  +V  + P     K    K+   +   P  P V P
Sbjct: 3423 DPKEPEVKPEEPKEPEVK-PEEPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKP 3481

Query: 177  NA--KSGNQPVEATETIVPQE 195
                +   +P E  E  V  E
Sbjct: 3482 EDPKEPEVKPEEPKEPEVKPE 3502


>gi|154495867|ref|ZP_02034563.1| hypothetical protein BACCAP_00147 [Bacteroides capillosus ATCC
           29799]
 gi|150275065|gb|EDN02113.1| hypothetical protein BACCAP_00147 [Bacteroides capillosus ATCC
           29799]
          Length = 414

 Score = 41.8 bits (96), Expect = 0.051,   Method: Composition-based stats.
 Identities = 14/99 (14%), Positives = 30/99 (30%), Gaps = 16/99 (16%)

Query: 104 LVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKK 163
           + K++K   Q    + + +  P  E+  +P       P+        P+   E+     +
Sbjct: 1   MKKKRKNGGQQRPQQAQKASPPKPEKDLQPQEPEQPTPETAAAPVSQPEPVPERQAEAPQ 60

Query: 164 VRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
           V+                 +P    +T  P +     A 
Sbjct: 61  VKP----------------EPARTQDTPQPPKKAEKRAE 83


>gi|228918621|ref|ZP_04082058.1| Surface layer protein [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
 gi|228841029|gb|EEM86234.1| Surface layer protein [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
          Length = 446

 Score = 41.8 bits (96), Expect = 0.054,   Method: Composition-based stats.
 Identities = 18/105 (17%), Positives = 41/105 (39%), Gaps = 4/105 (3%)

Query: 104 LVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKK 163
             ++  +   N+++  E    P ++   +P  +  ++P  +           + D   + 
Sbjct: 206 TREQYSQFLYNSINAVEKETKPEVKPDPKPEEKPEVKPDPKPETKPEEKPEVKPDPKPEP 265

Query: 164 VRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQDC 208
                 ++P V P+ K   +P E  E  +P  LN  N ++ D + 
Sbjct: 266 KP---EVKPEVKPDPKPETKPEEKPEIKLPVGLNE-NLATKDMEF 306


>gi|118478607|ref|YP_895758.1| cell wall anchor domain-containing protein [Bacillus thuringiensis
           str. Al Hakam]
 gi|118417832|gb|ABK86251.1| LPXTG-motif cell wall anchor domain protein [Bacillus thuringiensis
           str. Al Hakam]
          Length = 617

 Score = 41.8 bits (96), Expect = 0.058,   Method: Composition-based stats.
 Identities = 12/98 (12%), Positives = 38/98 (38%)

Query: 66  DYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCP 125
           + +  E   Q  + +    +  + +  +  Q   ++      ++E+ +   ++      P
Sbjct: 143 NKMSQETLQQTLDKFGTCKTAEEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTDDPKQEKP 202

Query: 126 LIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKK 163
              +  +P  E   +PK +D   + PD ++  +   ++
Sbjct: 203 EEPKTDDPKQEKPEEPKTDDSKQENPDGTKTPEQPKQE 240



 Score = 37.6 bits (85), Expect = 1.1,   Method: Composition-based stats.
 Identities = 20/136 (14%), Positives = 42/136 (30%), Gaps = 12/136 (8%)

Query: 81  NRIVSMAQAQIQEKLQRD---------EQDDLLVKEQKERAQNALSEFEASPCPLIEEGK 131
            R VS      QE LQ+           ++      ++E+ +   ++      P   +  
Sbjct: 136 FRFVSDWNKMSQETLQQTLDKFGTCKTAEEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTD 195

Query: 132 EPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETI 191
           +P  E   +PK +D   + P+   E      K       +    P  ++   P       
Sbjct: 196 DPKQEKPEEPKTDDPKQEKPE---EPKTDDSKQENPDGTKTPEQPKQENIQVPAAQVNDA 252

Query: 192 VPQELNSDNASSVDQD 207
           + +         ++ D
Sbjct: 253 ISKTSEKMLQDGIESD 268


>gi|221056476|ref|XP_002259376.1| Subtilisin-like protease 2 [Plasmodium knowlesi strain H]
 gi|193809447|emb|CAQ40149.1| Subtilisin-like protease 2, putative [Plasmodium knowlesi strain H]
          Length = 1341

 Score = 41.8 bits (96), Expect = 0.058,   Method: Composition-based stats.
 Identities = 21/95 (22%), Positives = 35/95 (36%), Gaps = 10/95 (10%)

Query: 75  QHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQ-----KERAQNALSEFEASPCPLIEE 129
           Q AE         Q  +QE  QR+EQ+    +EQ     +E+  +  S   A       E
Sbjct: 274 QRAEQ-----EANQRAVQETNQREEQEANQREEQEANQREEQEADEESNQRAEQEANQRE 328

Query: 130 GKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKV 164
            +E   E++ + + E          +E D    + 
Sbjct: 329 EQEADEESNQRAEQEADEESNQRAEQEADEEADQE 363



 Score = 37.6 bits (85), Expect = 0.99,   Method: Composition-based stats.
 Identities = 17/75 (22%), Positives = 29/75 (38%), Gaps = 1/75 (1%)

Query: 86  MAQAQIQEKLQRDEQD-DLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
             Q + QE  QR+EQ+ D    ++ E+  N   E EA         +E   E++ + + E
Sbjct: 296 ANQREEQEANQREEQEADEESNQRAEQEANQREEQEADEESNQRAEQEADEESNQRAEQE 355

Query: 145 DVAFKTPDISREKDV 159
                  +   E   
Sbjct: 356 ADEEADQEAEYELKE 370


>gi|15900565|ref|NP_345169.1| zinc metalloprotease ZmpB, putative [Streptococcus pneumoniae
           TIGR4]
 gi|6911257|gb|AAF31454.1|AF221126_3 putative zinc metalloprotease [Streptococcus pneumoniae]
 gi|14972138|gb|AAK74809.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae TIGR4]
          Length = 1881

 Score = 41.8 bits (96), Expect = 0.058,   Method: Composition-based stats.
 Identities = 31/155 (20%), Positives = 50/155 (32%), Gaps = 31/155 (20%)

Query: 83  IVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPC----PLIEEGKEPIFENS 138
           I +  QA+ + ++   E+       + E +     + E  P     P +EEGKE   E +
Sbjct: 159 ITNQEQARTENQVVETEEAPKEEAPKTEESPKEEPKSEVKPTDDTLPKVEEGKEDSAEPA 218

Query: 139 IQPKVEDVAFKTPDISR-EKDVSYKKVRRRR---------PLRPR----------VFPNA 178
              +V       P+     K  S    +            P+ PR            P A
Sbjct: 219 PVEEVGGEVESKPEEKVAVKPESQPSDKPAEESKVEQAGEPVAPREDEKAPVEPEKQPEA 278

Query: 179 KSGNQPVEAT---ETIVP----QELNSDNASSVDQ 206
               + VE T   E   P    +E       +V+Q
Sbjct: 279 PEEEKAVEETPKQEESTPDTKAEETVEPKEETVNQ 313



 Score = 40.3 bits (92), Expect = 0.19,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 43/132 (32%), Gaps = 14/132 (10%)

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFE----NSIQPKVE 144
            +  EK   + +      E+++  +    + E++P    EE  EP  E    +  QPKVE
Sbjct: 262 PREDEKAPVEPEKQPEAPEEEKAVEETPKQEESTPDTKAEETVEPKEETVNQSIEQPKVE 321

Query: 145 -DVAFKTPDISREKDVSYKKV---------RRRRPLRPRVFPNAKSGNQPVEATETIVPQ 194
                K  + + E  V                  P+ P   P      + VE T     +
Sbjct: 322 TPAVEKQTEPTEEPKVEQAGEPVAPREDEQAPTAPVEPEKQPEVPEEEKAVEETPKPEDK 381

Query: 195 ELNSDNASSVDQ 206
                    VD+
Sbjct: 382 IKGIGTKEPVDK 393


>gi|291452650|ref|ZP_06592040.1| membrane protein oxaA [Streptomyces albus J1074]
 gi|291355599|gb|EFE82501.1| membrane protein oxaA [Streptomyces albus J1074]
          Length = 431

 Score = 41.8 bits (96), Expect = 0.062,   Method: Composition-based stats.
 Identities = 24/121 (19%), Positives = 50/121 (41%), Gaps = 8/121 (6%)

Query: 83  IVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPK 142
           +V    A+ +++ + + +    + +    AQ   +    S   ++EE  EP  E   QP+
Sbjct: 291 LVKAIVAKGRDRNEYERKFINGLTKAGLAAQADGTIGPKSGTAVVEEDGEPAEEAPAQPR 350

Query: 143 VEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
            +    ++         S ++ +   P RP     A SG    E+T ++   +  S++ S
Sbjct: 351 RQQPKRQS--------KSQRQAQPTTPQRPGQRTRASSGRAAGESTTSLEKSQGGSEDTS 402

Query: 203 S 203
           S
Sbjct: 403 S 403


>gi|196042586|ref|ZP_03109825.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus
           03BB108]
 gi|229185551|ref|ZP_04312731.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus BGSC
           6E1]
 gi|196026070|gb|EDX64738.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus
           03BB108]
 gi|228597946|gb|EEK55586.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus BGSC
           6E1]
          Length = 607

 Score = 41.8 bits (96), Expect = 0.063,   Method: Composition-based stats.
 Identities = 12/98 (12%), Positives = 38/98 (38%)

Query: 66  DYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCP 125
           + +  E   Q  + +    +  + +  +  Q   ++      ++E+ +   ++      P
Sbjct: 133 NKMSQETLQQTLDKFGTCKTAEEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTDDPKQEKP 192

Query: 126 LIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKK 163
              +  +P  E   +PK +D   + PD ++  +   ++
Sbjct: 193 EEPKTDDPKQEKPEEPKTDDSKQENPDGTKTPEQPKQE 230



 Score = 37.6 bits (85), Expect = 1.1,   Method: Composition-based stats.
 Identities = 20/136 (14%), Positives = 42/136 (30%), Gaps = 12/136 (8%)

Query: 81  NRIVSMAQAQIQEKLQRD---------EQDDLLVKEQKERAQNALSEFEASPCPLIEEGK 131
            R VS      QE LQ+           ++      ++E+ +   ++      P   +  
Sbjct: 126 FRFVSDWNKMSQETLQQTLDKFGTCKTAEEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTD 185

Query: 132 EPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETI 191
           +P  E   +PK +D   + P+   E      K       +    P  ++   P       
Sbjct: 186 DPKQEKPEEPKTDDPKQEKPE---EPKTDDSKQENPDGTKTPEQPKQENIQVPAAQVNDA 242

Query: 192 VPQELNSDNASSVDQD 207
           + +         ++ D
Sbjct: 243 ISKTSEKMLQDGIESD 258


>gi|192447397|ref|NP_001122259.1| procollagen C-endopeptidase enhancer-like [Danio rerio]
 gi|190338748|gb|AAI63490.1| Similar to procollagen C-endopeptidase enhancer [Danio rerio]
 gi|190339011|gb|AAI63473.1| Similar to procollagen C-endopeptidase enhancer [Danio rerio]
          Length = 538

 Score = 41.8 bits (96), Expect = 0.063,   Method: Composition-based stats.
 Identities = 17/88 (19%), Positives = 29/88 (32%), Gaps = 6/88 (6%)

Query: 116 LSEFEASPCPLIEEGKEPIFENSIQPKV------EDVAFKTPDISREKDVSYKKVRRRRP 169
            S   A P P+          + I PK       +     TP  +            ++ 
Sbjct: 329 RSNPAAKPKPVRPTPPTRRSGSKITPKPAVKVTAKPATKPTPKPAIRPQPKPTSTTAKQE 388

Query: 170 LRPRVFPNAKSGNQPVEATETIVPQELN 197
           ++P V P AK+ ++P   T +      N
Sbjct: 389 VKPGVKPTAKTISKPGNRTTSRTASAGN 416


>gi|329964651|ref|ZP_08301705.1| hypothetical protein HMPREF9446_03312 [Bacteroides fluxus YIT
           12057]
 gi|328525051|gb|EGF52103.1| hypothetical protein HMPREF9446_03312 [Bacteroides fluxus YIT
           12057]
          Length = 516

 Score = 41.8 bits (96), Expect = 0.063,   Method: Composition-based stats.
 Identities = 16/99 (16%), Positives = 38/99 (38%), Gaps = 4/99 (4%)

Query: 88  QAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVA 147
           QA+ +E   + + +      +  +  +A +     P P+  E  +P+  +  +P +  VA
Sbjct: 38  QAEFEEFKNKADAEFETFLRETWKKYDAFAPV---PAPVRPEPPKPVIFDKARPAMPPVA 94

Query: 148 FKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVE 186
            K P   +  +     V  +  + P+        ++P  
Sbjct: 95  VK-PGALKIPEAPVPAVGGKVAVDPKHPDLPAIQDKPAP 132


>gi|241663881|ref|YP_002982241.1| hypothetical protein Rpic12D_2295 [Ralstonia pickettii 12D]
 gi|240865908|gb|ACS63569.1| conserved hypothetical protein [Ralstonia pickettii 12D]
          Length = 518

 Score = 41.8 bits (96), Expect = 0.065,   Method: Composition-based stats.
 Identities = 20/114 (17%), Positives = 41/114 (35%), Gaps = 4/114 (3%)

Query: 56  VLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNA 115
            +A DA +         + +HA+H+  + S  Q Q+ +K   D +  L  + +    +  
Sbjct: 369 KIAADATAKEVRAKLAVYQEHADHHF-LFSDLQ-QLIQKPMDDFRLTLTSRIEAHVREQQ 426

Query: 116 LSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRP 169
                A+   + +   E   E+++           P  S     S  +  + RP
Sbjct: 427 ERANRAAQEAVAQSQAESSVESTVTGS--QSPVAAPAPSVTPLFSKPRAAQDRP 478


>gi|254565275|ref|XP_002489748.1| MAP kinase kinase that plays a pivotal role in the osmosensing
           signal-transduction pathway [Pichia pastoris GS115]
 gi|238029544|emb|CAY67467.1| MAP kinase kinase that plays a pivotal role in the osmosensing
           signal-transduction pathway [Pichia pastoris GS115]
 gi|328350164|emb|CCA36564.1| hypothetical protein PP7435_Chr1-0407 [Pichia pastoris CBS 7435]
          Length = 638

 Score = 41.8 bits (96), Expect = 0.066,   Method: Composition-based stats.
 Identities = 19/120 (15%), Positives = 39/120 (32%)

Query: 87  AQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDV 146
           A+ +  ++ +R +QD     +      +      +SP         P    +++P  +  
Sbjct: 58  ARVRAFQEKRRTQQDKNETSDDTSSPNSLAESPFSSPGVAPAHADSPKTTWNVKPSPQSP 117

Query: 147 AFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQ 206
               PD      +  K V  ++P +    PN     +P         +  N  + S   Q
Sbjct: 118 VEFEPDRYTLPKIKPKVVLPQQPKKSLSEPNTLHRTKPKPNLSLSQLKSYNEVDESKKSQ 177


>gi|123397176|ref|XP_001301042.1| hypothetical protein [Trichomonas vaginalis G3]
 gi|121882169|gb|EAX88112.1| conserved hypothetical protein [Trichomonas vaginalis G3]
          Length = 438

 Score = 41.4 bits (95), Expect = 0.068,   Method: Composition-based stats.
 Identities = 14/82 (17%), Positives = 20/82 (24%), Gaps = 3/82 (3%)

Query: 116 LSEFEASPCPLIEEGKEPIFENSIQP--KVEDVAFKTPDISREKDVSYKKVRRRRPLRPR 173
                 +P P   E   P+ E   QP     +   + P    E               P 
Sbjct: 294 FDPSTPTPVPEPTEEPTPVPEPKEQPSEAPTEQPSEAPTPVPE-PTEQPSEAPTPVPEPT 352

Query: 174 VFPNAKSGNQPVEATETIVPQE 195
             P  +   +PV         E
Sbjct: 353 DKPTPEPTEKPVPDPTNAPVPE 374



 Score = 40.7 bits (93), Expect = 0.12,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 24/74 (32%), Gaps = 2/74 (2%)

Query: 122 SPCPLIEEGKEPIFENSIQPKVEDVAFKTP-DISREKDVSYKKVRRRRPLRPRVFPNAKS 180
            P P+ E  ++P    + QP         P +   E      +   +    P   P    
Sbjct: 308 EPTPVPEPKEQPSEAPTEQPSEAPTPVPEPTEQPSEAPTPVPEPTDKPTPEPTEKPVPDP 367

Query: 181 GNQPVEA-TETIVP 193
            N PV   T+  VP
Sbjct: 368 TNAPVPEPTKEPVP 381



 Score = 36.4 bits (82), Expect = 2.2,   Method: Composition-based stats.
 Identities = 12/81 (14%), Positives = 24/81 (29%), Gaps = 1/81 (1%)

Query: 110 ERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREK-DVSYKKVRRRR 168
           E  +      E    P     ++P    +  P+  +   + P    E  D    +   + 
Sbjct: 304 EPTEEPTPVPEPKEQPSEAPTEQPSEAPTPVPEPTEQPSEAPTPVPEPTDKPTPEPTEKP 363

Query: 169 PLRPRVFPNAKSGNQPVEATE 189
              P   P  +   +PV   +
Sbjct: 364 VPDPTNAPVPEPTKEPVPDPD 384


>gi|194884465|ref|XP_001976268.1| GG22777 [Drosophila erecta]
 gi|190659455|gb|EDV56668.1| GG22777 [Drosophila erecta]
          Length = 1145

 Score = 41.4 bits (95), Expect = 0.069,   Method: Composition-based stats.
 Identities = 19/97 (19%), Positives = 34/97 (35%), Gaps = 3/97 (3%)

Query: 98   DEQDDLLVKEQKERAQNALSEFEASPCP--LIEEGKEPIFENSIQPKVEDVAFK-TPDIS 154
            +E++        E+  +   +  A P P     E ++P  +  I+ + ED      P+  
Sbjct: 1045 EEEEASTNNTSHEQEDDDPDQERAPPSPLSATSESEQPQMDADIKREPEDQKEDFDPESV 1104

Query: 155  REKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETI 191
              K  +   V+      P   P A     P  A  T+
Sbjct: 1105 SVKPPTKAAVKADPEENPPAEPVASVAATPTRARRTV 1141


>gi|266620637|ref|ZP_06113572.1| putative von Willebrand factor type A domain protein [Clostridium
           hathewayi DSM 13479]
 gi|288867752|gb|EFD00051.1| putative von Willebrand factor type A domain protein [Clostridium
           hathewayi DSM 13479]
          Length = 2963

 Score = 41.4 bits (95), Expect = 0.071,   Method: Composition-based stats.
 Identities = 25/116 (21%), Positives = 42/116 (36%), Gaps = 3/116 (2%)

Query: 93  EKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQ-PKVEDVAFK-T 150
           EK   DE  + L  ++  + Q   +  E      +EE KEP  E   Q P+ E+   +  
Sbjct: 170 EKPALDENGNALEGDKPAQNQEEATAPE-EENGSVEETKEPETEAPTQVPETEESIQEPE 228

Query: 151 PDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQ 206
            +   ++  +    +      P      K    PV+  ET  P+      A  V +
Sbjct: 229 TEAPVQEPETTAPAKEPETEAPTQEEIEKPTQAPVQEPETQAPETEAVTQAPEVQE 284


>gi|195446212|ref|XP_002070679.1| GK10899 [Drosophila willistoni]
 gi|194166764|gb|EDW81665.1| GK10899 [Drosophila willistoni]
          Length = 487

 Score = 41.4 bits (95), Expect = 0.071,   Method: Composition-based stats.
 Identities = 14/76 (18%), Positives = 25/76 (32%), Gaps = 4/76 (5%)

Query: 126 LIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPL----RPRVFPNAKSG 181
            ++ G++P+ +   QP  +      P  ++         R    +     PR  P   S 
Sbjct: 150 PLQRGRQPVRQPPRQPDFQPELETEPQFAQVPARRPLAPRPAVEVPTFTEPRPLPRPTSN 209

Query: 182 NQPVEATETIVPQELN 197
                 T T    +LN
Sbjct: 210 AGFNPGTTTGSSTDLN 225


>gi|33596637|ref|NP_884280.1| autotransporter [Bordetella parapertussis 12822]
 gi|33573338|emb|CAE37322.1| autotransporter [Bordetella parapertussis]
          Length = 538

 Score = 41.4 bits (95), Expect = 0.072,   Method: Composition-based stats.
 Identities = 17/86 (19%), Positives = 27/86 (31%), Gaps = 3/86 (3%)

Query: 112 AQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLR 171
              A      +  P  E   EP  + + QP VE      P    E     ++ R +   R
Sbjct: 152 PAEAPQAGPDASKPQPEGPPEP--DGNPQPDVEPGPEVEPGPEVE-PGPQEQPRPQPDAR 208

Query: 172 PRVFPNAKSGNQPVEATETIVPQELN 197
           P+  P+A+         + I      
Sbjct: 209 PQDEPHAQPLPPAGSPGDGIYMPRSG 234



 Score = 37.6 bits (85), Expect = 1.1,   Method: Composition-based stats.
 Identities = 15/73 (20%), Positives = 24/73 (32%), Gaps = 3/73 (4%)

Query: 115 ALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKD---VSYKKVRRRRPLR 171
           A  E    P P  E  +     +  QP+        P    E         +V      +
Sbjct: 141 ADGEDGGLPSPPAEAPQAGPDASKPQPEGPPEPDGNPQPDVEPGPEVEPGPEVEPGPQEQ 200

Query: 172 PRVFPNAKSGNQP 184
           PR  P+A+  ++P
Sbjct: 201 PRPQPDARPQDEP 213


>gi|71654163|ref|XP_815706.1| trans-sialidase [Trypanosoma cruzi strain CL Brener]
 gi|71654165|ref|XP_815707.1| trans-sialidase [Trypanosoma cruzi strain CL Brener]
 gi|70880781|gb|EAN93855.1| trans-sialidase, putative [Trypanosoma cruzi]
 gi|70880782|gb|EAN93856.1| trans-sialidase, putative [Trypanosoma cruzi]
          Length = 907

 Score = 41.4 bits (95), Expect = 0.073,   Method: Composition-based stats.
 Identities = 16/101 (15%), Positives = 33/101 (32%), Gaps = 20/101 (19%)

Query: 116 LSEFEASPCPLIEEG------------KEPIFENSIQPKVEDVAFKTPDISREKDVSYKK 163
            S   A P P  ++              EP      +P+  +   + P+ +  +    + 
Sbjct: 726 PSPATAGPQPTDQKSLSASSVPSGGALSEPAASRPEEPEPAESRPEEPEPAESRPEEPEP 785

Query: 164 VRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSV 204
            R     +P     A   +    +T+       +SD+A +V
Sbjct: 786 AREGTADQP-----ASVTSSDAASTDVG---ASSSDDAQTV 818


>gi|196040583|ref|ZP_03107883.1| cell surface protein [Bacillus cereus NVH0597-99]
 gi|196028715|gb|EDX67322.1| cell surface protein [Bacillus cereus NVH0597-99]
          Length = 3592

 Score = 41.4 bits (95), Expect = 0.076,   Method: Composition-based stats.
 Identities = 22/109 (20%), Positives = 44/109 (40%), Gaps = 3/109 (2%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
             + + K +  ++ ++  ++ KE         E    P   +  E   E+  +P+V+    
Sbjct: 3360 KEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDP 3419

Query: 149  KTPDISREKDVSYKKVRRRRPLRPRVFPNA--KSGNQPVEATETIVPQE 195
            K P++  E D    +V+   P  P V P    +   +P ++ E  V  E
Sbjct: 3420 KEPEVKPE-DSKEPEVKPEDPKEPEVKPEDPKEPEVKPEDSKEPEVKPE 3467



 Score = 41.4 bits (95), Expect = 0.082,   Method: Composition-based stats.
 Identities = 21/109 (19%), Positives = 42/109 (38%), Gaps = 3/109 (2%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
             + + K +  ++ ++  ++ KE         E    P   +  E   E+  +P+V+    
Sbjct: 3320 KEPEVKPEDPKEPEVKPEDSKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDP 3379

Query: 149  KTPDISREKDVSYKKVRRRRPLRPRVFPNA--KSGNQPVEATETIVPQE 195
            K P++  E      +V+   P  P V P    +   +P +  E  V  E
Sbjct: 3380 KEPEVKPEDPKEP-EVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPE 3427



 Score = 41.1 bits (94), Expect = 0.099,   Method: Composition-based stats.
 Identities = 21/109 (19%), Positives = 43/109 (39%), Gaps = 3/109 (2%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
             + + K +  ++ ++  ++ KE         E    P   +  E   E+  +P+V+    
Sbjct: 3370 KEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDS 3429

Query: 149  KTPDISREKDVSYKKVRRRRPLRPRVFP--NAKSGNQPVEATETIVPQE 195
            K P++  E      +V+   P  P V P  + +   +P +  E  V  E
Sbjct: 3430 KEPEVKPEDPKEP-EVKPEDPKEPEVKPEDSKEPEVKPEDPKEPEVKPE 3477



 Score = 41.1 bits (94), Expect = 0.11,   Method: Composition-based stats.
 Identities = 21/109 (19%), Positives = 42/109 (38%), Gaps = 3/109 (2%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
             + + K +  ++ ++  ++ KE         E    P   +  E   E+  +P+V+    
Sbjct: 3280 KEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDS 3339

Query: 149  KTPDISREKDVSYKKVRRRRPLRPRVFPNA--KSGNQPVEATETIVPQE 195
            K P++  E      +V+   P  P V P    +   +P +  E  V  E
Sbjct: 3340 KEPEVKPEDPKEP-EVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPE 3387



 Score = 40.7 bits (93), Expect = 0.12,   Method: Composition-based stats.
 Identities = 22/109 (20%), Positives = 43/109 (39%), Gaps = 3/109 (2%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
             + + K +  ++ ++  ++ KE         E    P   +  E   E+  +P+V+    
Sbjct: 3270 KEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDP 3329

Query: 149  KTPDISREKDVSYKKVRRRRPLRPRVFPNA--KSGNQPVEATETIVPQE 195
            K P++  E D    +V+   P  P V P    +   +P +  E  V  E
Sbjct: 3330 KEPEVKPE-DSKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPE 3377



 Score = 40.7 bits (93), Expect = 0.13,   Method: Composition-based stats.
 Identities = 22/109 (20%), Positives = 43/109 (39%), Gaps = 3/109 (2%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
             + + K +  ++ ++  ++ KE         E    P   +  E   E+S +P+V+    
Sbjct: 3410 KEPEVKPEDPKEPEVKPEDSKEPEVKPEDPKEPEVKPEDPKEPEVKPEDSKEPEVKPEDP 3469

Query: 149  KTPDISREKDVSYKKVRRRRPLRPRVFPNA--KSGNQPVEATETIVPQE 195
            K P++  E      +V+   P  P V P    +   +P +  E  V  E
Sbjct: 3470 KEPEVKPEDPKEP-EVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPE 3517



 Score = 39.5 bits (90), Expect = 0.26,   Method: Composition-based stats.
 Identities = 21/109 (19%), Positives = 42/109 (38%), Gaps = 3/109 (2%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
             + + K +  ++ ++  ++ KE         E    P   +  E   E+  +P+V+    
Sbjct: 3400 KEPEVKPEDPKEPEVKPEDPKEPEVKPEDSKEPEVKPEDPKEPEVKPEDPKEPEVKPEDS 3459

Query: 149  KTPDISREKDVSYKKVRRRRPLRPRVFPNA--KSGNQPVEATETIVPQE 195
            K P++  E      +V+   P  P V P    +   +P +  E  V  E
Sbjct: 3460 KEPEVKPEDPKEP-EVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPE 3507



 Score = 38.8 bits (88), Expect = 0.46,   Method: Composition-based stats.
 Identities = 16/90 (17%), Positives = 34/90 (37%), Gaps = 1/90 (1%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
             + + K +  ++ ++  ++ KE         E    P   +  E   E+  +P+V+    
Sbjct: 3440 KEPEVKPEDPKEPEVKPEDSKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDP 3499

Query: 149  KTPDISREKDVSYKKVRRRRPLRPRVFPNA 178
            K P++  E      +V+      P V P  
Sbjct: 3500 KEPEVKPEDPKEP-EVKPEDLKEPEVKPEN 3528


>gi|49478820|ref|YP_038951.1| cell surface anchor [Bacillus thuringiensis serovar konkukian str.
            97-27]
 gi|49330376|gb|AAT61022.1| conserved hypothetical protein, possible cell surface anchor
            [Bacillus thuringiensis serovar konkukian str. 97-27]
          Length = 3471

 Score = 41.4 bits (95), Expect = 0.077,   Method: Composition-based stats.
 Identities = 21/109 (19%), Positives = 42/109 (38%), Gaps = 3/109 (2%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
             + + K +  ++ ++  ++ KE         E    P   +  E   E+  +P+V+    
Sbjct: 3269 KEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDP 3328

Query: 149  KTPDISREKDVSYKKVRRRRPLRPRVFPNA--KSGNQPVEATETIVPQE 195
            K P++  E      +V+   P  P V P    +   +P +  E  V  E
Sbjct: 3329 KEPEVKPEDPKEP-EVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPE 3376



 Score = 41.4 bits (95), Expect = 0.083,   Method: Composition-based stats.
 Identities = 21/121 (17%), Positives = 45/121 (37%), Gaps = 3/121 (2%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
             + + K +  ++ ++  ++ KE         E    P   +  E   E+  +P+V+    
Sbjct: 3309 KEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDP 3368

Query: 149  KTPDISREKDVSYKKVRRRRPLRPRVFPNA--KSGNQPVEATETIVPQELNSDNASSVDQ 206
            K P++  E      +V+   P  P V P    +   +P +  E  V  E        + +
Sbjct: 3369 KEPEVKPEDPKEP-EVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKLEKPEVRLEKLIK 3427

Query: 207  D 207
            +
Sbjct: 3428 E 3428


>gi|298489998|ref|YP_003720175.1| hypothetical protein Aazo_0549 ['Nostoc azollae' 0708]
 gi|298231916|gb|ADI63052.1| conserved hypothetical protein ['Nostoc azollae' 0708]
          Length = 501

 Score = 41.4 bits (95), Expect = 0.078,   Method: Composition-based stats.
 Identities = 21/111 (18%), Positives = 40/111 (36%), Gaps = 1/111 (0%)

Query: 88  QAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVA 147
           QAQ+++    + +     + Q E+      E   +P P +E+   P  E S  P+ +   
Sbjct: 363 QAQVEKPPTPEVEVSPTPQPQVEKPPTPEVEVSPTPQPQVEKPPTPEIEVSPTPQAQVEK 422

Query: 148 FKTPDISREKDVSYKKVRRRRP-LRPRVFPNAKSGNQPVEATETIVPQELN 197
             TP+I        +  +   P +     P A+    P    E     ++ 
Sbjct: 423 PPTPEIEVSPTPQAQVEKPPTPEIEVSPTPQAQVEKPPTPEIEVSPTPQIQ 473



 Score = 41.4 bits (95), Expect = 0.086,   Method: Composition-based stats.
 Identities = 20/111 (18%), Positives = 37/111 (33%), Gaps = 1/111 (0%)

Query: 88  QAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVA 147
           Q Q+ +    + +     + Q E+      E   +P P +E+   P  E S  P+ +   
Sbjct: 345 QPQVGKPPTPEIEVSPTPQAQVEKPPTPEVEVSPTPQPQVEKPPTPEVEVSPTPQPQVEK 404

Query: 148 FKTPDISREKDVSYKKVRRRRP-LRPRVFPNAKSGNQPVEATETIVPQELN 197
             TP+I        +  +   P +     P A+    P    E     +  
Sbjct: 405 PPTPEIEVSPTPQAQVEKPPTPEIEVSPTPQAQVEKPPTPEIEVSPTPQAQ 455



 Score = 37.2 bits (84), Expect = 1.4,   Method: Composition-based stats.
 Identities = 19/120 (15%), Positives = 42/120 (35%), Gaps = 4/120 (3%)

Query: 88  QAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVA 147
           Q Q+++    + +     + Q E+      E   +P   +E+   P  E S  P+     
Sbjct: 381 QPQVEKPPTPEVEVSPTPQPQVEKPPTPEIEVSPTPQAQVEKPPTPEIEVSPTPQ---AQ 437

Query: 148 FKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETI-VPQELNSDNASSVDQ 206
            + P     +     + +  +P  P +  +     QP    +    P E    + S +++
Sbjct: 438 VEKPPTPEIEVSPTPQAQVEKPPTPEIEVSPTPQIQPAPEPQETPSPIESIQKDQSKLEK 497



 Score = 36.8 bits (83), Expect = 1.7,   Method: Composition-based stats.
 Identities = 12/76 (15%), Positives = 23/76 (30%), Gaps = 1/76 (1%)

Query: 123 PCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRP-LRPRVFPNAKSG 181
           P P + +   P  E S  P+ +     TP++        +  +   P +     P  +  
Sbjct: 344 PQPQVGKPPTPEIEVSPTPQAQVEKPPTPEVEVSPTPQPQVEKPPTPEVEVSPTPQPQVE 403

Query: 182 NQPVEATETIVPQELN 197
             P    E     +  
Sbjct: 404 KPPTPEIEVSPTPQAQ 419


>gi|311259672|ref|XP_003128209.1| PREDICTED: receptor-interacting serine/threonine-protein kinase
           1-like [Sus scrofa]
          Length = 664

 Score = 41.4 bits (95), Expect = 0.079,   Method: Composition-based stats.
 Identities = 19/105 (18%), Positives = 30/105 (28%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
           S A    +E+ +R   D    +   E AQ+   +  A   P           +  QP  +
Sbjct: 398 SAAYGGEEERRRRVSHDPFAQQRPHEPAQSPAVKGLACAGPGSAAQHPAGLSSHPQPLYQ 457

Query: 145 DVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATE 189
                 P     + +      RR    P           PV  T+
Sbjct: 458 SHGSHKPQGLGARPLDLGAADRRVWYMPSQGHRPSLYKTPVPETD 502


>gi|308178988|ref|YP_003918394.1| RNA polymerase sigma factor [Arthrobacter arilaitensis Re117]
 gi|307746451|emb|CBT77423.1| possible RNA polymerase sigma factor [Arthrobacter arilaitensis
           Re117]
          Length = 830

 Score = 41.4 bits (95), Expect = 0.080,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 28/71 (39%), Gaps = 1/71 (1%)

Query: 120 EASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRP-LRPRVFPNA 178
           E +  P +E   EP  E +++P VE     TP+ + E  V       + P + P   P  
Sbjct: 576 EPTQEPTVEPTPEPTAEPTVEPTVEPAVEPTPEPTAEPTVEPTVEPTQEPTVEPTQEPTV 635

Query: 179 KSGNQPVEATE 189
           +   +P     
Sbjct: 636 EPAVEPTPEPT 646



 Score = 39.5 bits (90), Expect = 0.28,   Method: Composition-based stats.
 Identities = 16/71 (22%), Positives = 24/71 (33%), Gaps = 1/71 (1%)

Query: 120 EASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLR-PRVFPNA 178
           E +  P +E   EP  E + +P VE     T + + E            P   P V P  
Sbjct: 540 EPTAEPTVEPTPEPTVEPTPEPTVEPTVEPTQEPTVEPTQEPTVEPTPEPTAEPTVEPTV 599

Query: 179 KSGNQPVEATE 189
           +   +P     
Sbjct: 600 EPAVEPTPEPT 610



 Score = 38.8 bits (88), Expect = 0.46,   Method: Composition-based stats.
 Identities = 19/85 (22%), Positives = 31/85 (36%), Gaps = 3/85 (3%)

Query: 124 CPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLR-PRVFPNAKSGN 182
            P +E   EP  E +++P  E     TP+ + E  V   +     P + P V P  +   
Sbjct: 532 EPTVEPTPEPTAEPTVEPTPEPTVEPTPEPTVEPTVEPTQEPTVEPTQEPTVEPTPEPTA 591

Query: 183 QPV--EATETIVPQELNSDNASSVD 205
           +P      E  V          +V+
Sbjct: 592 EPTVEPTVEPAVEPTPEPTAEPTVE 616



 Score = 38.8 bits (88), Expect = 0.50,   Method: Composition-based stats.
 Identities = 19/89 (21%), Positives = 31/89 (34%), Gaps = 6/89 (6%)

Query: 120 EASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRP-LRPRVFPNA 178
           E +P P +E   EP  E +++P  E     T + + E            P + P V P  
Sbjct: 548 EPTPEPTVEPTPEPTVEPTVEPTQEPTVEPTQEPTVEPTPEPTAEPTVEPTVEPAVEPTP 607

Query: 179 KSGNQP-----VEATETIVPQELNSDNAS 202
           +   +P     VE T+    +        
Sbjct: 608 EPTAEPTVEPTVEPTQEPTVEPTQEPTVE 636



 Score = 38.8 bits (88), Expect = 0.53,   Method: Composition-based stats.
 Identities = 18/76 (23%), Positives = 30/76 (39%), Gaps = 2/76 (2%)

Query: 124 CPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK-KVRRRRPLRPRVFPNAKSGN 182
            P +E  +EP  E + +P VE     TP+ + E  V    +      + P   P  +   
Sbjct: 616 EPTVEPTQEPTVEPTQEPTVEPAVEPTPEPTAEPTVEPTVEPTPEPTVEPTQEPTVEPTQ 675

Query: 183 QP-VEATETIVPQELN 197
           +P VE T+    +   
Sbjct: 676 EPTVEPTQEPTVEPTQ 691



 Score = 37.6 bits (85), Expect = 1.0,   Method: Composition-based stats.
 Identities = 19/85 (22%), Positives = 29/85 (34%), Gaps = 2/85 (2%)

Query: 120 EASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRP-LRPRVFPNA 178
           E +P P  E   EP  E + +P VE     T + + E            P + P   P  
Sbjct: 604 EPTPEPTAEPTVEPTVEPTQEPTVEPTQEPTVEPAVEPTPEPTAEPTVEPTVEPTPEPTV 663

Query: 179 KSGNQP-VEATETIVPQELNSDNAS 202
           +   +P VE T+    +        
Sbjct: 664 EPTQEPTVEPTQEPTVEPTQEPTVE 688



 Score = 37.2 bits (84), Expect = 1.6,   Method: Composition-based stats.
 Identities = 16/72 (22%), Positives = 26/72 (36%), Gaps = 3/72 (4%)

Query: 124 CPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQ 183
            P +E   EP  E +++P  E  A  T + + E  V          + P V P  +   +
Sbjct: 520 EPTVEPTPEPTVEPTVEPTPEPTAEPTVEPTPEPTVEPT---PEPTVEPTVEPTQEPTVE 576

Query: 184 PVEATETIVPQE 195
           P +        E
Sbjct: 577 PTQEPTVEPTPE 588



 Score = 36.8 bits (83), Expect = 1.9,   Method: Composition-based stats.
 Identities = 18/77 (23%), Positives = 28/77 (36%), Gaps = 1/77 (1%)

Query: 120 EASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRP-LRPRVFPNA 178
           E +  P  E   EP  E +++P  E     T + + E  V         P + P V P  
Sbjct: 600 EPAVEPTPEPTAEPTVEPTVEPTQEPTVEPTQEPTVEPAVEPTPEPTAEPTVEPTVEPTP 659

Query: 179 KSGNQPVEATETIVPQE 195
           +   +P +       QE
Sbjct: 660 EPTVEPTQEPTVEPTQE 676



 Score = 36.4 bits (82), Expect = 2.6,   Method: Composition-based stats.
 Identities = 15/72 (20%), Positives = 27/72 (37%), Gaps = 1/72 (1%)

Query: 120 EASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRP-LRPRVFPNA 178
           E +  P +E  +EP  E +++P  E  A  T + + E          + P + P   P  
Sbjct: 620 EPTQEPTVEPTQEPTVEPAVEPTPEPTAEPTVEPTVEPTPEPTVEPTQEPTVEPTQEPTV 679

Query: 179 KSGNQPVEATET 190
           +   +P      
Sbjct: 680 EPTQEPTVEPTQ 691



 Score = 34.5 bits (77), Expect = 8.6,   Method: Composition-based stats.
 Identities = 17/90 (18%), Positives = 26/90 (28%), Gaps = 7/90 (7%)

Query: 120 EASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAK 179
           E +P P  E   EP  E + +P VE     T + ++E  V   +     P +        
Sbjct: 640 EPTPEPTAEPTVEPTVEPTPEPTVEPTQEPTVEPTQEPTVEPTQEPTVEPTQEPTVEPTP 699

Query: 180 SGNQPV-------EATETIVPQELNSDNAS 202
                           E     E   D + 
Sbjct: 700 EPTPEPTVEPTQEPTAEPSAEPEDGQDGSE 729


>gi|308181695|ref|YP_003925823.1| cell surface protein precursor [Lactobacillus plantarum subsp.
            plantarum ST-III]
 gi|308047186|gb|ADN99729.1| cell surface protein precursor [Lactobacillus plantarum subsp.
            plantarum ST-III]
          Length = 1365

 Score = 41.4 bits (95), Expect = 0.081,   Method: Composition-based stats.
 Identities = 20/123 (16%), Positives = 37/123 (30%), Gaps = 10/123 (8%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIF----ENSIQPKV- 143
             Q ++  Q +E        Q E   +     +       E+  +P      E   QP+  
Sbjct: 1173 GQPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEP 1232

Query: 144  ----EDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPN-AKSGNQPVEATETIVPQELNS 198
                +    + P  S +     K  +     +P    + A       E + T  P +  S
Sbjct: 1233 GQHEQPSQPEEPGQSEKPGELQKPSQPADSEQPDGLSDQANLSRNQAEQSRTSQPSQAES 1292

Query: 199  DNA 201
            D +
Sbjct: 1293 DQS 1295


>gi|255947910|ref|XP_002564722.1| Pc22g06970 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211591739|emb|CAP97985.1| Pc22g06970 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 4045

 Score = 41.4 bits (95), Expect = 0.082,   Method: Composition-based stats.
 Identities = 29/155 (18%), Positives = 55/155 (35%), Gaps = 21/155 (13%)

Query: 38   GYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQH----AEHYNRIVSMAQ----- 88
            G   + RG   H A ++        +  +    E  +      AE   RI++        
Sbjct: 2786 GPPTRTRGDDPHTAVKFG-----LGTTRNRWQEEARISFSSPYAERTQRIINTILKLLVP 2840

Query: 89   -AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENS------IQP 141
             A+ +EK ++   ++   + Q ERA+    +  A+     E  ++   EN+       Q 
Sbjct: 2841 PAKEEEKQRQKLVEEERKRLQAERAEKERQDRIAAEEKQRELKQKEEEENARLQAEKEQQ 2900

Query: 142  KVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFP 176
            + E  A    +   +   +   V    P +P V P
Sbjct: 2901 EAERQAAGVDEPMEDVQETDTAVETAGPSQPEVQP 2935


>gi|297712627|ref|XP_002832847.1| PREDICTED: disintegrin and metalloproteinase domain-containing
           protein 29-like, partial [Pongo abelii]
          Length = 858

 Score = 41.4 bits (95), Expect = 0.085,   Method: Composition-based stats.
 Identities = 18/103 (17%), Positives = 39/103 (37%), Gaps = 3/103 (2%)

Query: 94  KLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDI 153
           K Q+D Q     +E+K + Q      ++ P  +  + + P+  +  QP+V     + P  
Sbjct: 705 KKQQDVQTPSAKEEEKIQHQPHELPPQSQPWVMPSQSQPPVMPSQSQPQVTPSQSQPP-- 762

Query: 154 SREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQEL 196
                 S  +V   +   P +    +    P ++   + P + 
Sbjct: 763 -VTPSQSQPRVMPSQSQPPVMPSQRQPQLMPSQSQPPVTPSQS 804


>gi|171685180|ref|XP_001907531.1| hypothetical protein [Podospora anserina S mat+]
 gi|170942551|emb|CAP68202.1| unnamed protein product [Podospora anserina S mat+]
          Length = 615

 Score = 41.4 bits (95), Expect = 0.087,   Method: Composition-based stats.
 Identities = 19/102 (18%), Positives = 34/102 (33%), Gaps = 1/102 (0%)

Query: 77  AEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPL-IEEGKEPIF 135
           AE   ++      ++ E  Q  + D     +     ++      A P P    E  +P+ 
Sbjct: 302 AEVLRKLQDSNDKELAEDGQPVKNDQEEASKDATADKDVEMSDAAEPQPEKPAEEAKPVE 361

Query: 136 ENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPN 177
           E   +PK E          R+   +Y   +RR  + P     
Sbjct: 362 ETPQEPKPEKELSPVDAAVRDIKAAYVAAKRRYRISPARIER 403


>gi|218906126|ref|YP_002453960.1| conserved repeat domain protein [Bacillus cereus AH820]
 gi|218537015|gb|ACK89413.1| conserved repeat domain protein [Bacillus cereus AH820]
          Length = 3521

 Score = 41.4 bits (95), Expect = 0.087,   Method: Composition-based stats.
 Identities = 21/109 (19%), Positives = 42/109 (38%), Gaps = 3/109 (2%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
             + + K +  ++ ++  ++ KE         E    P   +  E   E+  +P+V+    
Sbjct: 3329 KEPEVKPEDPKEPEVKTEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDP 3388

Query: 149  KTPDISREKDVSYKKVRRRRPLRPRVFPNA--KSGNQPVEATETIVPQE 195
            K P++  E      +V+   P  P V P    +   +P +  E  V  E
Sbjct: 3389 KEPEVKPEDPKEP-EVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPE 3436



 Score = 40.7 bits (93), Expect = 0.15,   Method: Composition-based stats.
 Identities = 21/109 (19%), Positives = 42/109 (38%), Gaps = 3/109 (2%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
             + + K +  ++ ++  ++ KE         E    P   +  E   E+  +P+V+    
Sbjct: 3319 KEPEVKPEDPKEPEVKPEDPKEPEVKTEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDP 3378

Query: 149  KTPDISREKDVSYKKVRRRRPLRPRVFPNA--KSGNQPVEATETIVPQE 195
            K P++  E      +V+   P  P V P    +   +P +  E  V  E
Sbjct: 3379 KEPEVKPEDPKEP-EVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPE 3426



 Score = 40.3 bits (92), Expect = 0.18,   Method: Composition-based stats.
 Identities = 17/88 (19%), Positives = 35/88 (39%), Gaps = 1/88 (1%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
             + + K +  ++ ++  ++ KE         E    P   +  E   E+  +P+V+    
Sbjct: 3369 KEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDP 3428

Query: 149  KTPDISREKDVSYKKVRRRRPLRPRVFP 176
            K P++  E      +V+   P  P V P
Sbjct: 3429 KEPEVKPEDPKEP-EVKPEDPKEPEVKP 3455



 Score = 39.1 bits (89), Expect = 0.37,   Method: Composition-based stats.
 Identities = 21/109 (19%), Positives = 42/109 (38%), Gaps = 3/109 (2%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
             + + K +  ++ ++  ++ KE         E    P   +  E   E+  +P+V+    
Sbjct: 3269 KEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDP 3328

Query: 149  KTPDISREKDVSYKKVRRRRPLRPRVFPNA--KSGNQPVEATETIVPQE 195
            K P++  E      +V+   P  P V P    +   +P +  E  V  E
Sbjct: 3329 KEPEVKPEDPKEP-EVKTEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPE 3376



 Score = 38.0 bits (86), Expect = 0.89,   Method: Composition-based stats.
 Identities = 20/109 (18%), Positives = 41/109 (37%), Gaps = 3/109 (2%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
             + + K +  ++ ++  ++ KE         E        +  E   E+  +P+V+    
Sbjct: 3309 KEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKTEDPKEPEVKPEDPKEPEVKPEDP 3368

Query: 149  KTPDISREKDVSYKKVRRRRPLRPRVFPNA--KSGNQPVEATETIVPQE 195
            K P++  E      +V+   P  P V P    +   +P +  E  V  E
Sbjct: 3369 KEPEVKPEDPKEP-EVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPE 3416


>gi|291240146|ref|XP_002739984.1| PREDICTED: AGAP006513-PA-like [Saccoglossus kowalevskii]
          Length = 2072

 Score = 41.1 bits (94), Expect = 0.088,   Method: Composition-based stats.
 Identities = 23/122 (18%), Positives = 36/122 (29%), Gaps = 25/122 (20%)

Query: 93   EKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPD 152
            E   + EQ    V E K + ++     E+ P P      EP  E   QP++E      P 
Sbjct: 1866 ESEPKPEQQPESVPEPKPKQESGP---ESRPQP----EPEPQLEPDPQPQLEPEPILQPQ 1918

Query: 153  ISREKDVSYKK--------------VRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
                 +   K                  +  L P +      G QP    +     +   
Sbjct: 1919 QEPGTEPQPKSEPQKPEPEPQPVIEPEIQTHLEPELEWEPDPGFQPAPERK----PDSED 1974

Query: 199  DN 200
            D+
Sbjct: 1975 DD 1976



 Score = 38.4 bits (87), Expect = 0.63,   Method: Composition-based stats.
 Identities = 18/108 (16%), Positives = 39/108 (36%), Gaps = 9/108 (8%)

Query: 85   SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
            +    + ++KL   E  +   KE +   ++   + +  P    +  ++P      +PK E
Sbjct: 1827 NEIDNEPKQKLIESESGEESDKEPEPEPESEEQQPQLEPESEPKPEQQPESVPEPKPKQE 1886

Query: 145  DVAFK----TPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEAT 188
                      P+   E D    ++     L+P+  P    G +P   +
Sbjct: 1887 SGPESRPQPEPEPQLEPD-PQPQLEPEPILQPQQEP----GTEPQPKS 1929


>gi|329940710|ref|ZP_08289990.1| integral membrane protein [Streptomyces griseoaurantiacus M045]
 gi|329300004|gb|EGG43902.1| integral membrane protein [Streptomyces griseoaurantiacus M045]
          Length = 693

 Score = 41.1 bits (94), Expect = 0.088,   Method: Composition-based stats.
 Identities = 19/98 (19%), Positives = 32/98 (32%), Gaps = 11/98 (11%)

Query: 80  YNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALS---EFEASPCPLIEEGKEPIFE 136
           Y R+   A  +  E   R+  D+   ++ +       +     +A P P  +E + P   
Sbjct: 563 YLRVPQEAGRETDEGAGRERADEREPEDARPYPAGGPAGGEPEDARP-PGAQEPRAPGVH 621

Query: 137 NSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRV 174
            +            P +           RR RP RP V
Sbjct: 622 GAP-------TVIAPLVPPGPTGQPGAKRRGRPGRPTV 652


>gi|159029505|emb|CAO87654.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 384

 Score = 41.1 bits (94), Expect = 0.091,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 34/93 (36%), Gaps = 6/93 (6%)

Query: 103 LLVKEQKERAQNALS-EFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSY 161
            L KE+ E  Q   + E  ASP P+I     P+   S +      +  TP  +     S 
Sbjct: 46  YLAKEKPETPQPQANLETAASPAPIIPSPIAPLTAPSPKLSPSPQSSATPKSAPSPQSSL 105

Query: 162 KKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQ 194
              ++  P     FP +     P  A + +  Q
Sbjct: 106 SAPKKLAP-----FPQSSPNTSPAAAAKPVTRQ 133


>gi|322511129|gb|ADX06442.1| hypothetical protein 162275982 [Organic Lake phycodnavirus 2]
          Length = 1108

 Score = 41.1 bits (94), Expect = 0.093,   Method: Composition-based stats.
 Identities = 19/131 (14%), Positives = 42/131 (32%), Gaps = 1/131 (0%)

Query: 73  HLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKE 132
           +  + + Y + ++      +   + D  +   + +  E+        ++   P +    E
Sbjct: 629 YKSNLDKYLKDMNDINK-YKRYYEIDNNELDEMIDYAEKTIEQYHLSDSESEPDVSSDDE 687

Query: 133 PIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIV 192
           P  ++  +P V        D   + DVS           P   PN K+ +          
Sbjct: 688 PPSDSESEPDVSSDDEPPSDSESDPDVSSDDEPSNNKNSPDDPPNNKNSSDEPPTDSESD 747

Query: 193 PQELNSDNASS 203
           P   + D  S+
Sbjct: 748 PDVSSDDEPSN 758


>gi|208702071|ref|YP_002267409.1| surface layer protein [Bacillus cereus H3081.97]
 gi|208657926|gb|ACI30296.1| surface layer protein [Bacillus cereus H3081.97]
          Length = 425

 Score = 41.1 bits (94), Expect = 0.095,   Method: Composition-based stats.
 Identities = 17/76 (22%), Positives = 28/76 (36%), Gaps = 1/76 (1%)

Query: 124 CPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQ 183
             +    KE   E    PK E    + P++  +      K   +  ++P   P  K   +
Sbjct: 204 NSINAVEKETKPEVKPDPKPETKPEEKPEVKPDPK-PETKPEEKPEVKPDPKPETKPETK 262

Query: 184 PVEATETIVPQELNSD 199
           P E  ET +P  L+  
Sbjct: 263 PEEKPETNLPTSLDKV 278


>gi|332981722|ref|YP_004463163.1| hypothetical protein Mahau_1144 [Mahella australiensis 50-1 BON]
 gi|332699400|gb|AEE96341.1| hypothetical protein Mahau_1144 [Mahella australiensis 50-1 BON]
          Length = 254

 Score = 41.1 bits (94), Expect = 0.096,   Method: Composition-based stats.
 Identities = 12/81 (14%), Positives = 23/81 (28%), Gaps = 1/81 (1%)

Query: 84  VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV 143
           +  +        Q+ + D    ++Q     N            +EE  EP  +N +QP  
Sbjct: 42  LGTSTPPTNASQQQGDVDQQPAQQQPGTDDNTAQPNAPDAQQPVEEQSEPGTDNPVQPDN 101

Query: 144 E-DVAFKTPDISREKDVSYKK 163
                  T           ++
Sbjct: 102 ALPDQSGTAQPGEVLPAEPER 122


>gi|297675169|ref|XP_002815564.1| PREDICTED: caspase recruitment domain-containing protein 6-like
            [Pongo abelii]
          Length = 1037

 Score = 41.1 bits (94), Expect = 0.096,   Method: Composition-based stats.
 Identities = 16/107 (14%), Positives = 32/107 (29%), Gaps = 2/107 (1%)

Query: 85   SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
            +  Q    +   R     L +        +     +++P  +     +P      QPK  
Sbjct: 911  ASQQGAQMKTQSRASNPALQIVSHPMSKSSHFKSDQSNPSTVKHSQPKPFHSVPSQPKPS 970

Query: 145  DVAFKTPDISREKDVSYKK--VRRRRPLRPRVFPNAKSGNQPVEATE 189
                     S+ K    K    +  +P  P+  P+     QP  ++ 
Sbjct: 971  QTKSCQSQPSQTKPSPCKSTQPKPSQPWPPQSKPSQPRPTQPKSSST 1017


>gi|225866903|ref|YP_002752281.1| cell surface protein [Bacillus cereus 03BB102]
 gi|225790215|gb|ACO30432.1| cell surface protein [Bacillus cereus 03BB102]
          Length = 3428

 Score = 41.1 bits (94), Expect = 0.097,   Method: Composition-based stats.
 Identities = 17/88 (19%), Positives = 35/88 (39%), Gaps = 1/88 (1%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
             + + K +  ++ ++  ++ KE         E    P   +  E   E+  +P+V+    
Sbjct: 3276 KEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDP 3335

Query: 149  KTPDISREKDVSYKKVRRRRPLRPRVFP 176
            K P++  E      +V+   P  P V P
Sbjct: 3336 KEPEVKPEDPKEP-EVKPEDPKEPEVKP 3362


>gi|229134164|ref|ZP_04262983.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus
           BDRD-ST196]
 gi|228649337|gb|EEL05353.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus
           BDRD-ST196]
          Length = 603

 Score = 41.1 bits (94), Expect = 0.098,   Method: Composition-based stats.
 Identities = 17/83 (20%), Positives = 29/83 (34%), Gaps = 5/83 (6%)

Query: 129 EGKEPIFENSIQPK--VEDVAFKTPDIS-REKDVSYKKVRRRRPL--RPRVFPNAKSGNQ 183
           E  +P    + +P    E+   + PD    E        +   P   +P   P  K   Q
Sbjct: 163 EEPKPEEPKTEKPDGKPEEPKTEKPDGKPEEPKTEKPDGKPEEPKTEKPDGKPEDKVTEQ 222

Query: 184 PVEATETIVPQELNSDNASSVDQ 206
           P E    I   +LN   + + ++
Sbjct: 223 PKEEKVEIPAAQLNEAISKTSEK 245


>gi|52140598|ref|YP_086232.1| cell surface protein [Bacillus cereus E33L]
 gi|51974067|gb|AAU15617.1| cell surface protein [Bacillus cereus E33L]
          Length = 3472

 Score = 41.1 bits (94), Expect = 0.099,   Method: Composition-based stats.
 Identities = 21/109 (19%), Positives = 42/109 (38%), Gaps = 3/109 (2%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
             + + K +  ++ ++  ++ KE         E    P   +  E   E+  +P+V+    
Sbjct: 3270 KEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDP 3329

Query: 149  KTPDISREKDVSYKKVRRRRPLRPRVFPNA--KSGNQPVEATETIVPQE 195
            K P++  E      +V+   P  P V P    +   +P +  E  V  E
Sbjct: 3330 KEPEVKPEDPKEP-EVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPE 3377



 Score = 41.1 bits (94), Expect = 0.11,   Method: Composition-based stats.
 Identities = 21/121 (17%), Positives = 45/121 (37%), Gaps = 3/121 (2%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
             + + K +  ++ ++  ++ KE         E    P   +  E   E+  +P+V+    
Sbjct: 3310 KEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDP 3369

Query: 149  KTPDISREKDVSYKKVRRRRPLRPRVFPNA--KSGNQPVEATETIVPQELNSDNASSVDQ 206
            K P++  E      +V+   P  P V P    +   +P +  E  V  E        + +
Sbjct: 3370 KEPEVKPEDPKEP-EVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKLEKPEVRLEKLIK 3428

Query: 207  D 207
            +
Sbjct: 3429 E 3429


>gi|328948890|ref|YP_004366227.1| hypothetical protein Tresu_2058 [Treponema succinifaciens DSM 2489]
 gi|328449214|gb|AEB14930.1| protein of unknown function DUF610 YibQ [Treponema succinifaciens
           DSM 2489]
          Length = 389

 Score = 41.1 bits (94), Expect = 0.10,   Method: Composition-based stats.
 Identities = 27/124 (21%), Positives = 53/124 (42%), Gaps = 14/124 (11%)

Query: 83  IVSMAQAQIQEKLQRDEQDDLLVKEQKERAQ-NALSEFEASPCPLIEEGKEPIFEN-SIQ 140
           + S  + + Q K+Q  EQ  L  +++ + A+ N ++E +  P  +  E KE + +   IQ
Sbjct: 51  VFSSPKKEKQPKVQNVEQQVLRQEQKNKFAEKNKVAENKNQPKNVQPEKKEAVQKPLEIQ 110

Query: 141 PKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATET------IVPQ 194
           P+++ V  +     ++     K+  ++        P   S N P + TE        +P 
Sbjct: 111 PEIKKVPVEKKSEEKKPQPVSKQEIKKD------EPKIASVNPPAKKTEEIKVEKYSIPP 164

Query: 195 ELNS 198
             N 
Sbjct: 165 AKNG 168


>gi|228928368|ref|ZP_04091409.1| LPXTG-motif cell wall anchor domain protein [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
 gi|228831415|gb|EEM77011.1| LPXTG-motif cell wall anchor domain protein [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
          Length = 617

 Score = 41.1 bits (94), Expect = 0.10,   Method: Composition-based stats.
 Identities = 12/93 (12%), Positives = 36/93 (38%)

Query: 71  ENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEG 130
           E   Q  + +    +  + +  +  Q   ++      ++E+ +   ++      P   + 
Sbjct: 148 ETLQQTLDKFGTCKTAEEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTDDPKQEKPEEPKT 207

Query: 131 KEPIFENSIQPKVEDVAFKTPDISREKDVSYKK 163
            +P  E   +PK +D   + PD ++  +   ++
Sbjct: 208 DDPKQEKPEEPKTDDSKQENPDGTKTPEQPKQE 240



 Score = 36.4 bits (82), Expect = 2.6,   Method: Composition-based stats.
 Identities = 13/108 (12%), Positives = 34/108 (31%), Gaps = 3/108 (2%)

Query: 100 QDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDV 159
           ++      ++E+ +   ++      P   +  +P  E   +PK +D   + P+   E   
Sbjct: 164 EEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTDDPKQEKPE---EPKT 220

Query: 160 SYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQD 207
              K       +    P  ++   P       + +         ++ D
Sbjct: 221 DDSKQENPDGTKTPEQPKQENIQVPAVQVNDAISKTSEKMLQDGIESD 268


>gi|198458189|ref|XP_002138505.1| GA24356 [Drosophila pseudoobscura pseudoobscura]
 gi|198136253|gb|EDY69063.1| GA24356 [Drosophila pseudoobscura pseudoobscura]
          Length = 8812

 Score = 41.1 bits (94), Expect = 0.10,   Method: Composition-based stats.
 Identities = 18/113 (15%), Positives = 33/113 (29%), Gaps = 10/113 (8%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIE--------EGKEPIFENSIQ 140
            A+  +K    E        +  + +      +  P P  E        E K+P  E + +
Sbjct: 3153 AETDQKKATPEFTQKEPTPEGNQKETTPEPEKKQPTPEPEKKQPTPEPEKKQPTPEPTKE 3212

Query: 141  PKVEDVAFKTPDISREKDVSYKKVRR--RRPLRPRVFPNAKSGNQPVEATETI 191
            P  +      P            +      PL P   P  +   + +E+   I
Sbjct: 3213 PSPQPSEKPEPKPRTAAKEVLPDLEPPFTAPLAPFAEPRTEVETKVIESITEI 3265



 Score = 36.8 bits (83), Expect = 2.0,   Method: Composition-based stats.
 Identities = 22/125 (17%), Positives = 40/125 (32%), Gaps = 15/125 (12%)

Query: 84   VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIE----------EGKEP 133
            +   +A+   K+              E       +  A P P+ E            KEP
Sbjct: 3110 LEEPKAEEFIKVTETVTTVTTRDSDPETKNAIPEKLTAKPQPVAETDQKKATPEFTQKEP 3169

Query: 134  IFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRP-----LRPRVFPNAKSGNQPVEAT 188
              E + +    +   K P    EK     +  +++P       P   P+ K   +P  A 
Sbjct: 3170 TPEGNQKETTPEPEKKQPTPEPEKKQPTPEPEKKQPTPEPTKEPSPQPSEKPEPKPRTAA 3229

Query: 189  ETIVP 193
            + ++P
Sbjct: 3230 KEVLP 3234


>gi|124430472|dbj|BAF46262.1| putative zinc metalloprotease [Streptococcus pneumoniae]
          Length = 1876

 Score = 41.1 bits (94), Expect = 0.10,   Method: Composition-based stats.
 Identities = 29/149 (19%), Positives = 51/149 (34%), Gaps = 28/149 (18%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
           +  QA+ + ++   E+     +  KE  ++ +   + +  P +EEGKE   E +   +V 
Sbjct: 161 NQEQARTENQVVETEEAPKTEESPKEEPKSEIKPTDDT-LPKVEEGKEASAEPATVEEVG 219

Query: 145 DVAFKTPDISR-EKDVSYKKVRRRR---------PLRPR----------VFPNAKSGNQP 184
                 P+     K  S    +            P+ PR            P A    + 
Sbjct: 220 GEVESKPEEKVAVKPESQPSDKPAEESKVEQAGEPVAPREDEKAPVEPEKQPEAPEEEKA 279

Query: 185 VEAT---ETIVP----QELNSDNASSVDQ 206
           VE T   E   P    +E       +V+Q
Sbjct: 280 VEETPKQEESTPDTKAEETVEPKEETVNQ 308



 Score = 40.3 bits (92), Expect = 0.17,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 43/132 (32%), Gaps = 14/132 (10%)

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFE----NSIQPKVE 144
            +  EK   + +      E+++  +    + E++P    EE  EP  E    +  QPKVE
Sbjct: 257 PREDEKAPVEPEKQPEAPEEEKAVEETPKQEESTPDTKAEETVEPKEETVNQSIEQPKVE 316

Query: 145 -DVAFKTPDISREKDVSYKKV---------RRRRPLRPRVFPNAKSGNQPVEATETIVPQ 194
                K  + + E  V                  P+ P   P      + VE T     +
Sbjct: 317 TPAVEKQTEPTEEPKVEQAGEPVAPREDEQAPTAPVEPEKQPEVPEEEKAVEETPKPEDK 376

Query: 195 ELNSDNASSVDQ 206
                    VD+
Sbjct: 377 IKGIGTKEPVDK 388


>gi|307126859|ref|YP_003878890.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae 670-6B]
 gi|306483921|gb|ADM90790.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae 670-6B]
 gi|332077091|gb|EGI87553.1| LPXTG-motif cell wall anchor domain protein [Streptococcus
           pneumoniae GA17545]
          Length = 1969

 Score = 41.1 bits (94), Expect = 0.11,   Method: Composition-based stats.
 Identities = 25/112 (22%), Positives = 45/112 (40%), Gaps = 5/112 (4%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
           +  QA+ + ++   E+     +  KE  ++ +   + +  P +EEGKE   E +   +V 
Sbjct: 186 NQEQARTENQVVETEEAPKTEESPKEEPKSEIKPTDDT-LPKVEEGKEDSAEPAPVEEVG 244

Query: 145 DVAFKTPDISR-EKDVSYKKVRRRRPLR--PRVFPNAKSGNQPVEATETIVP 193
                 P+     K  S    +     +  P V   AK   QPV+ T+   P
Sbjct: 245 GEVESKPEEKVAVKPESQPSDKPAEESKVEPPV-EQAKGPEQPVQPTQAEQP 295


>gi|228936802|ref|ZP_04099588.1| LPXTG-motif cell wall anchor domain protein [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228822847|gb|EEM68693.1| LPXTG-motif cell wall anchor domain protein [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
          Length = 607

 Score = 41.1 bits (94), Expect = 0.11,   Method: Composition-based stats.
 Identities = 12/93 (12%), Positives = 36/93 (38%)

Query: 71  ENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEG 130
           E   Q  + +    +  + +  +  Q   ++      ++E+ +   ++      P   + 
Sbjct: 138 ETLQQTLDKFGTCKTAEEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTDDPKQEKPEEPKT 197

Query: 131 KEPIFENSIQPKVEDVAFKTPDISREKDVSYKK 163
            +P  E   +PK +D   + PD ++  +   ++
Sbjct: 198 DDPKQEKPEEPKTDDSKQENPDGTKTPEQPKQE 230



 Score = 36.4 bits (82), Expect = 2.6,   Method: Composition-based stats.
 Identities = 13/108 (12%), Positives = 34/108 (31%), Gaps = 3/108 (2%)

Query: 100 QDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDV 159
           ++      ++E+ +   ++      P   +  +P  E   +PK +D   + P+   E   
Sbjct: 154 EEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTDDPKQEKPE---EPKT 210

Query: 160 SYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQD 207
              K       +    P  ++   P       + +         ++ D
Sbjct: 211 DDSKQENPDGTKTPEQPKQENIQVPAVQVNDAISKTSEKMLQDGIESD 258


>gi|123468802|ref|XP_001317617.1| secalin precursor [Trichomonas vaginalis G3]
 gi|121900355|gb|EAY05394.1| secalin precursor, putative [Trichomonas vaginalis G3]
          Length = 440

 Score = 41.1 bits (94), Expect = 0.11,   Method: Composition-based stats.
 Identities = 24/129 (18%), Positives = 51/129 (39%), Gaps = 5/129 (3%)

Query: 83  IVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPK 142
           +++  +     +L++D+   L      +  Q+   + E  P P +E+   P  E    P+
Sbjct: 151 LLTQLEQDPSPQLEQDQSPQLEQDLLTQLEQDQSPQLEQDPSPQLEQDPSPQLEQDPSPQ 210

Query: 143 VE----DVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
           +E        + P    E+D S +  +   P   +  P+ +    P    E  +  +L  
Sbjct: 211 LEQDPSPQLEQDPSPQLEQDPSPQLEQDPSPQLEQ-DPSPQLEQDPSPQLEQDLLTQLEQ 269

Query: 199 DNASSVDQD 207
           D +  ++QD
Sbjct: 270 DPSPQLEQD 278



 Score = 39.5 bits (90), Expect = 0.27,   Method: Composition-based stats.
 Identities = 24/114 (21%), Positives = 45/114 (39%), Gaps = 5/114 (4%)

Query: 94  KLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDI 153
           +L++D    L      +  Q+   + E  P P +E+   P  E    P++E    + P  
Sbjct: 266 QLEQDPSPQLEQDPSPQLEQDPSPQLEQDPSPQLEQDPSPQLEQDPSPQLE----QDPSP 321

Query: 154 SREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQD 207
             E+D S +  +   P   +  P+ +    P    E     +L  D +  ++QD
Sbjct: 322 QLEQDPSPQLEQDPSPQLEQ-DPSPQLEQDPSPQLEQDPSPQLEQDQSPQLEQD 374



 Score = 38.4 bits (87), Expect = 0.63,   Method: Composition-based stats.
 Identities = 26/129 (20%), Positives = 55/129 (42%), Gaps = 9/129 (6%)

Query: 83  IVSMAQAQIQE----KLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENS 138
           ++   Q+Q+++    +L++D    L   +  +  Q+ L++ E    P +E+   P  E  
Sbjct: 139 VLINGQSQLEQDLLTQLEQDPSPQLEQDQSPQLEQDLLTQLEQDQSPQLEQDPSPQLEQD 198

Query: 139 IQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
             P++E    + P    E+D S +  +   P   +  P+ +    P    E     +L  
Sbjct: 199 PSPQLE----QDPSPQLEQDPSPQLEQDPSPQLEQ-DPSPQLEQDPSPQLEQDPSPQLEQ 253

Query: 199 DNASSVDQD 207
           D +  ++QD
Sbjct: 254 DPSPQLEQD 262


>gi|319892390|ref|YP_004149265.1| Fibronectin binding protein FnbB [Staphylococcus pseudintermedius
            HKU10-03]
 gi|317162086|gb|ADV05629.1| Fibronectin binding protein FnbB [Staphylococcus pseudintermedius
            HKU10-03]
          Length = 1243

 Score = 41.1 bits (94), Expect = 0.11,   Method: Composition-based stats.
 Identities = 19/122 (15%), Positives = 38/122 (31%), Gaps = 11/122 (9%)

Query: 88   QAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVA 147
            Q  + +   ++  D      +K   +           P  +E   P   +  QP+ ++  
Sbjct: 1099 QPDVPQPEPKNPDD-----REKPAPEQPDVPQPEPKNPDDKEKPAPEQPDVPQPEPKNPD 1153

Query: 148  FKTPDISREKDVSYKKVR------RRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNA 201
             K      + D    K        + +P  P         ++    T+  +PQ   S + 
Sbjct: 1154 DKEKPAPEQPDAPQPKPMLPGEKVKPKPTHPGEAMQTTPQDKSTSQTDEALPQTGESSSQ 1213

Query: 202  SS 203
            SS
Sbjct: 1214 SS 1215


>gi|218904456|ref|YP_002452290.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus AH820]
 gi|218536875|gb|ACK89273.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus AH820]
          Length = 607

 Score = 41.1 bits (94), Expect = 0.11,   Method: Composition-based stats.
 Identities = 12/93 (12%), Positives = 36/93 (38%)

Query: 71  ENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEG 130
           E   Q  + +    +  + +  +  Q   ++      ++E+ +   ++      P   + 
Sbjct: 138 ETLQQTLDKFGTCKTAEEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTDDPKQEKPEEPKT 197

Query: 131 KEPIFENSIQPKVEDVAFKTPDISREKDVSYKK 163
            +P  E   +PK +D   + PD ++  +   ++
Sbjct: 198 DDPKQEKPEEPKTDDSKQENPDGTKTPEQPKQE 230



 Score = 36.4 bits (82), Expect = 2.8,   Method: Composition-based stats.
 Identities = 13/108 (12%), Positives = 34/108 (31%), Gaps = 3/108 (2%)

Query: 100 QDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDV 159
           ++      ++E+ +   ++      P   +  +P  E   +PK +D   + P+   E   
Sbjct: 154 EEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTDDPKQEKPE---EPKT 210

Query: 160 SYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQD 207
              K       +    P  ++   P       + +         ++ D
Sbjct: 211 DDSKQENPDGTKTPEQPKQENIQVPAVQVNDAISKTSEKMLQDGIESD 258


>gi|241841259|ref|XP_002415325.1| Jumonji/ARID domain-containing protein, putative [Ixodes scapularis]
 gi|215509537|gb|EEC18990.1| Jumonji/ARID domain-containing protein, putative [Ixodes scapularis]
          Length = 1356

 Score = 41.1 bits (94), Expect = 0.11,   Method: Composition-based stats.
 Identities = 25/147 (17%), Positives = 43/147 (29%), Gaps = 19/147 (12%)

Query: 78   EHYNRIVSMAQA---------QIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIE 128
            +H  RI+   +             E     E      K  K+R           P P  +
Sbjct: 1076 QHIWRILQATKPPGDPFSPFEAFPEFEDYAEFAKKPEKRIKKRKVEQPEGARPQPRPKPK 1135

Query: 129  EGKEPIFENSIQPKVEDVAFKTPDISREK----------DVSYKKVRRRRPLRPRVFPNA 178
              K    E +  P     +   P+ ++                +KVR  + +RP+    A
Sbjct: 1136 LQKRASKEEASSPSPGAGSASGPETAKPTGKRPAKEPGRREPERKVRPPKKVRPKEEGGA 1195

Query: 179  KSGNQPVEATETIVPQELNSDNASSVD 205
            ++G + V     + P       A   D
Sbjct: 1196 QTGVERVVKRRRVAPSHSGGAEAQEQD 1222


>gi|149005779|ref|ZP_01829518.1| zinc metalloprotease ZmpB, putative [Streptococcus pneumoniae
           SP18-BS74]
 gi|147762719|gb|EDK69679.1| zinc metalloprotease ZmpB, putative [Streptococcus pneumoniae
           SP18-BS74]
          Length = 1721

 Score = 41.1 bits (94), Expect = 0.11,   Method: Composition-based stats.
 Identities = 25/112 (22%), Positives = 45/112 (40%), Gaps = 5/112 (4%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
           +  QA+ + ++   E+     +  KE  ++ +   + +  P +EEGKE   E +   +V 
Sbjct: 186 NQEQARTENQVVETEEAPKTEESPKEEPKSEIKPTDDT-LPKVEEGKEDSAEPAPVEEVG 244

Query: 145 DVAFKTPDISR-EKDVSYKKVRRRRPLR--PRVFPNAKSGNQPVEATETIVP 193
                 P+     K  S    +     +  P V   AK   QPV+ T+   P
Sbjct: 245 GEVESKPEEKVAVKPESQPSDKPAEESKVEPPV-EQAKGPEQPVQPTQAEQP 295



 Score = 38.0 bits (86), Expect = 0.94,   Method: Composition-based stats.
 Identities = 23/131 (17%), Positives = 36/131 (27%), Gaps = 11/131 (8%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEF------EASPCPLIEEGKE-PIFEN 137
              Q +I +   + E        +    Q            EA+  P+ E   E P  E 
Sbjct: 291 QAEQPRIPKDSSQPEDPKEDRGAEDTPKQEDTQPEVVETKDEAANQPVEEPKVETPAVEK 350

Query: 138 SIQPKV----EDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVP 193
             +PKV    E V     + +        +    + +     P  K      +       
Sbjct: 351 QTEPKVEQVGEPVEPSEDEKAPVSPEKQPEAPEEKAVEETPKPEDKIKGIGTKEPVDKSE 410

Query: 194 QELNSDNASSV 204
                D ASSV
Sbjct: 411 LNNQIDKASSV 421


>gi|229122849|ref|ZP_04252058.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus
           95/8201]
 gi|228660713|gb|EEL16344.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus
           95/8201]
          Length = 607

 Score = 41.1 bits (94), Expect = 0.11,   Method: Composition-based stats.
 Identities = 12/93 (12%), Positives = 36/93 (38%)

Query: 71  ENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEG 130
           E   Q  + +    +  + +  +  Q   ++      ++E+ +   ++      P   + 
Sbjct: 138 ETLQQTLDKFGTCKTAEEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTDDPKQEKPEEPKT 197

Query: 131 KEPIFENSIQPKVEDVAFKTPDISREKDVSYKK 163
            +P  E   +PK +D   + PD ++  +   ++
Sbjct: 198 DDPKQEKPEEPKTDDSKQENPDGTKTPEQPKQE 230



 Score = 36.1 bits (81), Expect = 2.8,   Method: Composition-based stats.
 Identities = 13/108 (12%), Positives = 34/108 (31%), Gaps = 3/108 (2%)

Query: 100 QDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDV 159
           ++      ++E+ +   ++      P   +  +P  E   +PK +D   + P+   E   
Sbjct: 154 EEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTDDPKQEKPE---EPKT 210

Query: 160 SYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQD 207
              K       +    P  ++   P       + +         ++ D
Sbjct: 211 DDSKQENPDGTKTPEQPKQENIQVPAVQVNDAISKTSEKMLQDGIESD 258


>gi|313902900|ref|ZP_07836296.1| Enoyl-CoA hydratase/isomerase [Thermaerobacter subterraneus DSM
           13965]
 gi|313466835|gb|EFR62353.1| Enoyl-CoA hydratase/isomerase [Thermaerobacter subterraneus DSM
           13965]
          Length = 289

 Score = 40.7 bits (93), Expect = 0.11,   Method: Composition-based stats.
 Identities = 23/113 (20%), Positives = 46/113 (40%), Gaps = 9/113 (7%)

Query: 82  RIVSMAQAQ----IQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFEN 137
           R+++ A+A+    +   +  +E D    +  +  A+ + S   A+   ++     P  + 
Sbjct: 168 RLLNAAEARAVGLVTHVVPHEEVDPFARRLAENMARLSPSSIRAAKRSVLLSQPAPPPDP 227

Query: 138 SIQPKV----EDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVE 186
           + +P      ED   +      EK    +  R  RPLRP + P++     P E
Sbjct: 228 AGEPVPYYIDEDDFREGVRAFLEKRA-PRFDRPARPLRPALSPDSPCSTGPAE 279


>gi|196033145|ref|ZP_03100558.1| cell surface protein [Bacillus cereus W]
 gi|195994574|gb|EDX58529.1| cell surface protein [Bacillus cereus W]
          Length = 3521

 Score = 40.7 bits (93), Expect = 0.11,   Method: Composition-based stats.
 Identities = 21/109 (19%), Positives = 42/109 (38%), Gaps = 3/109 (2%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
             + + K +  ++ ++  ++ KE         E    P   +  E   E+  +P+V+    
Sbjct: 3269 KEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDP 3328

Query: 149  KTPDISREKDVSYKKVRRRRPLRPRVFPNA--KSGNQPVEATETIVPQE 195
            K P++  E      +V+   P  P V P    +   +P +  E  V  E
Sbjct: 3329 KEPEVKPEDPKEP-EVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPE 3376



 Score = 40.7 bits (93), Expect = 0.11,   Method: Composition-based stats.
 Identities = 21/109 (19%), Positives = 42/109 (38%), Gaps = 3/109 (2%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
             + + K +  ++ ++  ++ KE         E    P   +  E   E+  +P+V+    
Sbjct: 3309 KEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDP 3368

Query: 149  KTPDISREKDVSYKKVRRRRPLRPRVFPNA--KSGNQPVEATETIVPQE 195
            K P++  E      +V+   P  P V P    +   +P +  E  V  E
Sbjct: 3369 KEPEVKPEDPKEP-EVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPE 3416



 Score = 40.7 bits (93), Expect = 0.11,   Method: Composition-based stats.
 Identities = 21/109 (19%), Positives = 42/109 (38%), Gaps = 3/109 (2%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
             + + K +  ++ ++  ++ KE         E    P   +  E   E+  +P+V+    
Sbjct: 3349 KEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDP 3408

Query: 149  KTPDISREKDVSYKKVRRRRPLRPRVFPNA--KSGNQPVEATETIVPQE 195
            K P++  E      +V+   P  P V P    +   +P +  E  V  E
Sbjct: 3409 KEPEVKPEDPKEP-EVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPE 3456


>gi|239980791|ref|ZP_04703315.1| putative inner membrane protein translocase component YidC
           [Streptomyces albus J1074]
          Length = 414

 Score = 40.7 bits (93), Expect = 0.12,   Method: Composition-based stats.
 Identities = 24/121 (19%), Positives = 50/121 (41%), Gaps = 8/121 (6%)

Query: 83  IVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPK 142
           +V    A+ +++ + + +    + +    AQ   +    S   ++EE  EP  E   QP+
Sbjct: 274 LVKAIVAKGRDRNEYERKFINGLTKAGLAAQADGTIGPKSGTAVVEEDGEPAEEAPAQPR 333

Query: 143 VEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
            +    ++         S ++ +   P RP     A SG    E+T ++   +  S++ S
Sbjct: 334 RQQPKRQS--------KSQRQAQPTTPQRPGQRTRASSGRAAGESTTSLEKSQGGSEDTS 385

Query: 203 S 203
           S
Sbjct: 386 S 386


>gi|292397678|ref|YP_003517744.1| mucin-like protein [Lymantria xylina MNPV]
 gi|291065395|gb|ADD73713.1| mucin-like protein [Lymantria xylina MNPV]
          Length = 1054

 Score = 40.7 bits (93), Expect = 0.12,   Method: Composition-based stats.
 Identities = 19/94 (20%), Positives = 24/94 (25%), Gaps = 1/94 (1%)

Query: 103 LLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK 162
                  E   N     E  P P  E   EP  E   +P  E V     +   E      
Sbjct: 385 FNCHANPEFEVNTEPAAEPVPEPAAEPVPEPAAEPVPEPAAEPVPEPAAEPVPEPAAEPV 444

Query: 163 KVRRRRPL-RPRVFPNAKSGNQPVEATETIVPQE 195
                 P+  P   P  +   +PV         E
Sbjct: 445 PELAAEPVPEPAAEPVPEPAAEPVPEPAAEPVPE 478



 Score = 38.0 bits (86), Expect = 0.87,   Method: Composition-based stats.
 Identities = 19/93 (20%), Positives = 28/93 (30%), Gaps = 3/93 (3%)

Query: 115 ALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPL-RPR 173
                E  P P  E   EP  E   +P  E V     +   E            P+  P 
Sbjct: 405 PEPAAEPVPEPAAEPVPEPAAEPVPEPAAEPVPEPAAEPVPELAAEPVPEPAAEPVPEPA 464

Query: 174 VFPNAKSGNQPVEATETIVPQELNSDNASSVDQ 206
             P  +   +PV         E  ++  S+ D+
Sbjct: 465 AEPVPEPAAEPVPEPAAEPVPEPAAE--STTDK 495



 Score = 37.6 bits (85), Expect = 1.1,   Method: Composition-based stats.
 Identities = 15/77 (19%), Positives = 27/77 (35%), Gaps = 1/77 (1%)

Query: 120 EASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNA- 178
           E +  P+ E   EP+ E + +P  E  A   P+ + E             L  +   +  
Sbjct: 446 ELAAEPVPEPAAEPVPEPAAEPVPEPAAEPVPEPAAEPVPEPAAESTTDKLASKRKYSTL 505

Query: 179 KSGNQPVEATETIVPQE 195
           KS  +P    +     +
Sbjct: 506 KSFVKPKSTFDKHKKPK 522



 Score = 35.3 bits (79), Expect = 5.9,   Method: Composition-based stats.
 Identities = 16/83 (19%), Positives = 23/83 (27%), Gaps = 1/83 (1%)

Query: 114 NALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPL-RP 172
           +  + F     P  E   EP  E   +P  E V     +   E            P+  P
Sbjct: 380 SGKNIFNCHANPEFEVNTEPAAEPVPEPAAEPVPEPAAEPVPEPAAEPVPEPAAEPVPEP 439

Query: 173 RVFPNAKSGNQPVEATETIVPQE 195
              P  +   +PV         E
Sbjct: 440 AAEPVPELAAEPVPEPAAEPVPE 462


>gi|326943580|gb|AEA19473.1| Surface layer protein [Bacillus thuringiensis serovar chinensis
           CT-43]
          Length = 494

 Score = 40.7 bits (93), Expect = 0.12,   Method: Composition-based stats.
 Identities = 28/143 (19%), Positives = 51/143 (35%), Gaps = 24/143 (16%)

Query: 67  YVVAENHLQHAEHYNRIVSMAQAQIQE----KLQRDEQDDLLVKEQKERAQNALSEF--- 119
           +V  E + Q    YN I ++ +    E        ++ +     + +E+ +         
Sbjct: 214 HVTREQYSQFL--YNSINAVEKETKPEVKPDPKPEEKPEVKPDPKPEEKPEVKPDPKPEE 271

Query: 120 --EASPCPLIEEGKE----PIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPR 173
             E  P P  EE  E    P  E   + K +    + P++         K   +   +P 
Sbjct: 272 KPEVKPDPKPEEKPEVKPDPKPEEKPEVKPDPKPEEKPEV---------KPDPKPEEKPE 322

Query: 174 VFPNAKSGNQPVEATETIVPQEL 196
           V P+ K   +P E  +T +P  L
Sbjct: 323 VKPDPKPETKPEEKPDTNLPSSL 345


>gi|297562436|ref|YP_003681410.1| hypothetical protein Ndas_3503 [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
 gi|296846884|gb|ADH68904.1| YD repeat protein [Nocardiopsis dassonvillei subsp. dassonvillei
           DSM 43111]
          Length = 2145

 Score = 40.7 bits (93), Expect = 0.12,   Method: Composition-based stats.
 Identities = 12/72 (16%), Positives = 24/72 (33%), Gaps = 1/72 (1%)

Query: 98  DEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREK 157
           +E  +  V       +    +   +P    EEG +   E    P+ E      P+     
Sbjct: 119 EEVAEDYVDTGASEDEEDPQQQGDAPARS-EEGPDAGQEQPESPEPEAETGSAPEAENTT 177

Query: 158 DVSYKKVRRRRP 169
           + + ++V    P
Sbjct: 178 ESAPEEVEETDP 189


>gi|119491120|ref|XP_001263182.1| transcriptional corepressor of histone genes (Hir3), putative
            [Neosartorya fischeri NRRL 181]
 gi|119411342|gb|EAW21285.1| transcriptional corepressor of histone genes (Hir3), putative
            [Neosartorya fischeri NRRL 181]
          Length = 2019

 Score = 40.7 bits (93), Expect = 0.12,   Method: Composition-based stats.
 Identities = 29/128 (22%), Positives = 51/128 (39%), Gaps = 5/128 (3%)

Query: 82   RIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQ-NALSEFEASPCPLIEEGKEPI---FEN 137
            R   +A+  +Q++ +      L  +    +A   A SE  A+  P    G +P    FE 
Sbjct: 1803 RTKGIARRDVQKRAETIVNRKLTPRAPAAKASVPAESEPPATSEPAAPSGNQPSKTSFEM 1862

Query: 138  SIQPK-VEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQEL 196
              Q    + +     D S   ++  +K+ +    R  +FPN +    P   +E  VP  +
Sbjct: 1863 GQQSDIPQSIQDSADDESELSEIDDEKLSKLAAERKLLFPNLRDRISPDPDSEMSVPASI 1922

Query: 197  NSDNASSV 204
            + D A  V
Sbjct: 1923 DGDAADEV 1930


>gi|228948651|ref|ZP_04110929.1| Cell surface protein [Bacillus thuringiensis serovar monterrey BGSC
            4AJ1]
 gi|228810958|gb|EEM57301.1| Cell surface protein [Bacillus thuringiensis serovar monterrey BGSC
            4AJ1]
          Length = 2617

 Score = 40.7 bits (93), Expect = 0.12,   Method: Composition-based stats.
 Identities = 17/88 (19%), Positives = 35/88 (39%), Gaps = 1/88 (1%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
             + + K +  ++ ++  ++ KE         E    P   +  E   E+  +P+V+    
Sbjct: 2465 KEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDP 2524

Query: 149  KTPDISREKDVSYKKVRRRRPLRPRVFP 176
            K P++  E      +V+   P  P V P
Sbjct: 2525 KEPEVKPEDPKEP-EVKPEDPKEPEVKP 2551


>gi|161598675|ref|NP_939364.2| alpha-ketoglutarate decarboxylase [Corynebacterium diphtheriae NCTC
           13129]
          Length = 1237

 Score = 40.7 bits (93), Expect = 0.13,   Method: Composition-based stats.
 Identities = 18/104 (17%), Positives = 35/104 (33%), Gaps = 5/104 (4%)

Query: 88  QAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVA 147
           Q   ++    D++   L ++Q   +         SP P     K+P       P      
Sbjct: 19  QQFQKDPQSVDKEWRDLFEKQGAPSTPGTEAKNTSPQPAAPAKKQPAPAKKPAPTTASAP 78

Query: 148 FKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETI 191
             T   +  K  + K  ++++P      P  ++G  P   +  I
Sbjct: 79  ASTEAKAAPKPENKKPAKKQQPS-----PLERTGELPAAGSSAI 117


>gi|86357279|ref|YP_469171.1| ribonuclease E protein [Rhizobium etli CFN 42]
 gi|86281381|gb|ABC90444.1| ribonuclease E protein [Rhizobium etli CFN 42]
          Length = 961

 Score = 40.7 bits (93), Expect = 0.13,   Method: Composition-based stats.
 Identities = 23/137 (16%), Positives = 44/137 (32%), Gaps = 11/137 (8%)

Query: 79  HYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENS 138
           H     +       +    D Q  L  + ++ R    +   E +P   +    +P     
Sbjct: 66  HGFLAFAEIHPDYYQIPLADRQALLRAEAEEHRRDEDVEHVETAPMVDLSTQDQPDVGIV 125

Query: 139 IQPKVEDVAFKTPDISREKDVSY--------KKVRRRRPLRPRVFPNAKSGNQPVEATET 190
                E V       + E   +          +    +  +PR    ++       ATE 
Sbjct: 126 SAEAPEPVVAADEATTEEIAAAPEIVAPPEVAEEAPAKKAKPR---RSRKKVAETTATED 182

Query: 191 IVPQELNSDNASSVDQD 207
            VP ++ ++ AS+VD D
Sbjct: 183 AVPTDVEAEGASTVDND 199


>gi|302309818|ref|XP_002999576.1| hypothetical protein [Candida glabrata CBS 138]
 gi|196049165|emb|CAR58049.1| unnamed protein product [Candida glabrata]
          Length = 1423

 Score = 40.7 bits (93), Expect = 0.13,   Method: Composition-based stats.
 Identities = 16/97 (16%), Positives = 24/97 (24%), Gaps = 6/97 (6%)

Query: 109 KERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRR 168
           ++         +  P     E  +P       PK ED   + P     K    K  +   
Sbjct: 334 EDPKPEDPKPEDPKPEDPKPEDPKPEDPKPEDPKPEDPKPEDPKPEDPKPEDPKPEKPID 393

Query: 169 PLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVD 205
           P       N      P     + V       + S  D
Sbjct: 394 PKPEEPSHN------PSSVNPSSVNPSSKPVDPSPAD 424



 Score = 37.6 bits (85), Expect = 1.1,   Method: Composition-based stats.
 Identities = 17/92 (18%), Positives = 27/92 (29%), Gaps = 4/92 (4%)

Query: 118 EFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK--KVRRRRPLRPRVF 175
             +  P     E  +P       PK ED   + P     K    K    +   P      
Sbjct: 328 PEDPKPEDPKPEDPKPEDPKPEDPKPEDPKPEDPKPEDPKPEDPKPEDPKPEDPKPEDPK 387

Query: 176 PNAKSGNQPVEATE--TIVPQELNSDNASSVD 205
           P      +P E +   + V     + ++  VD
Sbjct: 388 PEKPIDPKPEEPSHNPSSVNPSSVNPSSKPVD 419



 Score = 36.8 bits (83), Expect = 1.7,   Method: Composition-based stats.
 Identities = 19/111 (17%), Positives = 30/111 (27%), Gaps = 2/111 (1%)

Query: 95  LQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDIS 154
             + E       + ++         +  P     E  +P       PK ED   + P   
Sbjct: 325 YPKPEDPKPEDPKPEDPKPEDPKPEDPKPEDPKPEDPKPEDPKPEDPKPEDPKPEDPKPE 384

Query: 155 REKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVD 205
             K       +   P       N  S N   +  +        S N SSV+
Sbjct: 385 DPKPEKPIDPKPEEPSHNPSSVNPSSVNPSSKPVDPS--PADPSHNPSSVN 433



 Score = 34.9 bits (78), Expect = 7.2,   Method: Composition-based stats.
 Identities = 20/116 (17%), Positives = 35/116 (30%), Gaps = 2/116 (1%)

Query: 92  QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTP 151
             K +  + +D   ++ K             P P   + ++P  E  I PK E+ +    
Sbjct: 345 DPKPEDPKPEDPKPEDPKPEDPKPEDPKPEDPKPEDPKPEDPKPEKPIDPKPEEPSHNPS 404

Query: 152 DISREKDVSYKKVRRRRPLRPRVFPN--AKSGNQPVEATETIVPQELNSDNASSVD 205
            ++        K     P  P   P+    S   P     + V       + S  D
Sbjct: 405 SVNPSSVNPSSKPVDPSPADPSHNPSSVNPSSVNPSSVNPSSVNPSSKPVDPSPAD 460


>gi|156102501|ref|XP_001616943.1| PST-A protein [Plasmodium vivax SaI-1]
 gi|148805817|gb|EDL47216.1| PST-A protein [Plasmodium vivax]
          Length = 558

 Score = 40.7 bits (93), Expect = 0.14,   Method: Composition-based stats.
 Identities = 21/125 (16%), Positives = 37/125 (29%), Gaps = 5/125 (4%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIE--EGKEPIFENSIQPK 142
           +   +    +   +   D   K   E + +   + +  P    E     EP  ++  +  
Sbjct: 211 NEPSSDSDPQSDNEPSSDSDPKSDNEPSSDKEPQSDNEPKSDNEPKSDNEPSSDSDPKSD 270

Query: 143 VEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
            E  + K P    E          +    P+      S N+P    E     E  SDN  
Sbjct: 271 NEPSSDKEPQSDNEPKSDN---EPKSDNEPKSDNEPSSHNEPSSHNEPSSHNEPKSDNEP 327

Query: 203 SVDQD 207
             D +
Sbjct: 328 QSDNE 332


>gi|157100915|emb|CAO91829.1| P-selectin glycoprotein ligand 1 propeptide precursor [Rattus
           norvegicus]
          Length = 420

 Score = 40.7 bits (93), Expect = 0.14,   Method: Composition-based stats.
 Identities = 23/122 (18%), Positives = 40/122 (32%), Gaps = 7/122 (5%)

Query: 84  VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE-ASPCPLIEE--GKEPIFENSIQ 140
           ++  +A+  +   R+ +       + E +Q A  E E + P P   E     P    + Q
Sbjct: 140 LAPTEAETSQPAPREAETSQPAPIKAETSQPAPREAETSQPAPTEAETSQPAPTKAETSQ 199

Query: 141 PKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVE-ATETIVPQELNSD 199
           P   +     P  + E + S          +P   P     +QP    TET         
Sbjct: 200 PAPTEAETSQPAPT-EVETSQPAPTEAETSQPA--PTEAETSQPASTETETTQLPRSQVV 256

Query: 200 NA 201
            +
Sbjct: 257 ES 258


>gi|300743896|ref|ZP_07072916.1| putative TolA domain protein [Rothia dentocariosa M567]
 gi|300380257|gb|EFJ76820.1| putative TolA domain protein [Rothia dentocariosa M567]
          Length = 1225

 Score = 40.7 bits (93), Expect = 0.14,   Method: Composition-based stats.
 Identities = 20/113 (17%), Positives = 41/113 (36%), Gaps = 3/113 (2%)

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
            Q Q K    +Q+D   ++ K+         + +P     + ++P  E+  Q + +    
Sbjct: 823 KQEQPKQDNPQQEDPKQEQPKQEQPKQEQPKQEAPKQDNPKQEQPKQEDPKQEQPKQEDP 882

Query: 149 KTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPV-EATETIVPQELNSDN 200
           K  D     +   +   +  P + +  P      QP   AT+  V     +D+
Sbjct: 883 KQDDNKNIVNPQPENPIQDAPKQEQ--PKQDEQPQPENPATDDQVQPADPNDD 933



 Score = 39.1 bits (89), Expect = 0.41,   Method: Composition-based stats.
 Identities = 15/111 (13%), Positives = 38/111 (34%), Gaps = 1/111 (0%)

Query: 88  QAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVA 147
           Q   +++  + + ++    + K+         + +P     + ++P  E   Q + +  A
Sbjct: 797 QENPKQENPQPQPENPKQDDPKQEDPKQEQPKQDNPQQEDPKQEQPKQEQPKQEQPKQEA 856

Query: 148 FKTPDISRE-KDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELN 197
            K  +  +E       K  + +   P+   N    N   E      P++  
Sbjct: 857 PKQDNPKQEQPKQEDPKQEQPKQEDPKQDDNKNIVNPQPENPIQDAPKQEQ 907



 Score = 36.1 bits (81), Expect = 3.2,   Method: Composition-based stats.
 Identities = 16/107 (14%), Positives = 36/107 (33%), Gaps = 6/107 (5%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKE----RAQNALSEFEASPCPLIEEGKEPIFENSIQ 140
                Q   K ++ +Q+D    + K     + +N + +      P  +E  +P  EN   
Sbjct: 864 QEQPKQEDPKQEQPKQEDPKQDDNKNIVNPQPENPIQDAPKQEQPKQDEQPQP--ENPAT 921

Query: 141 PKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEA 187
                 A    D+   +    +  ++ +P +     +     QP + 
Sbjct: 922 DDQVQPADPNDDLKPNEPKQQENPKQEQPKQEDPKQDNPKQEQPKQE 968



 Score = 35.3 bits (79), Expect = 5.1,   Method: Composition-based stats.
 Identities = 16/102 (15%), Positives = 38/102 (37%), Gaps = 2/102 (1%)

Query: 105 VKEQKERAQNALSEFEASPCPLIEEGKEPIFENS--IQPKVEDVAFKTPDISREKDVSYK 162
            K+ ++  Q    +    P P   +  +P  E+    QPK ++   + P   + K    K
Sbjct: 789 GKKAEQPKQENPKQENPQPQPENPKQDDPKQEDPKQEQPKQDNPQQEDPKQEQPKQEQPK 848

Query: 163 KVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSV 204
           + + ++    +  P  +   Q     E    ++   D+  ++
Sbjct: 849 QEQPKQEAPKQDNPKQEQPKQEDPKQEQPKQEDPKQDDNKNI 890


>gi|254454459|ref|ZP_05067896.1| cell division protein FtsK [Octadecabacter antarcticus 238]
 gi|198268865|gb|EDY93135.1| cell division protein FtsK [Octadecabacter antarcticus 238]
          Length = 975

 Score = 40.7 bits (93), Expect = 0.14,   Method: Composition-based stats.
 Identities = 19/123 (15%), Positives = 39/123 (31%), Gaps = 8/123 (6%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFE----NSIQ 140
           S +    Q    R ++     ++++   +  ++   A P P + +    +      N   
Sbjct: 190 SASYKGAQALNSRVQERREWSRQERAEVEAEMAAVRAIPTPSVAQETARVAAVVRANPAM 249

Query: 141 P----KVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQEL 196
           P      + +    P  S  K +S          +P +F +      P+   E I    L
Sbjct: 250 PTRYEDFDPIEAPAPRTSAPKPLSAPARVTEPAQKPGIFASLLKRADPMPEPELIEKPAL 309

Query: 197 NSD 199
             D
Sbjct: 310 QGD 312


>gi|332249229|ref|XP_003273766.1| PREDICTED: condensin complex subunit 1 isoform 1 [Nomascus
            leucogenys]
          Length = 1401

 Score = 40.7 bits (93), Expect = 0.14,   Method: Composition-based stats.
 Identities = 21/111 (18%), Positives = 40/111 (36%), Gaps = 8/111 (7%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
             + ++KL+      L   E+ E  Q       ++  P      +P+   +      D  F
Sbjct: 1283 DEFEQKLRACHTRGLDGIEELEIGQAGSQRAPSAKKPSTGSRHQPLASTA-----SDNDF 1337

Query: 149  KTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQ---PVEATETIVPQEL 196
             TP+  R         RR    +P+V  ++   ++     E TE   P++ 
Sbjct: 1338 VTPEPRRTTRRHPNTQRRASKKKPKVVFSSDESSEEDLSAEMTEEETPKKT 1388


>gi|331085366|ref|ZP_08334452.1| hypothetical protein HMPREF0987_00755 [Lachnospiraceae bacterium
            9_1_43BFAA]
 gi|330408149|gb|EGG87639.1| hypothetical protein HMPREF0987_00755 [Lachnospiraceae bacterium
            9_1_43BFAA]
          Length = 1108

 Score = 40.7 bits (93), Expect = 0.14,   Method: Composition-based stats.
 Identities = 14/83 (16%), Positives = 27/83 (32%), Gaps = 6/83 (7%)

Query: 115  ALSEFEASPCPLIEEGKEPIFE--NSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRP 172
                    P P     ++P  E  N  QP  E    + P+   + +       +  P +P
Sbjct: 988  PEQPDPEQPDPEQPNPEQPNPEQPNPEQPNPEQPNPEQPNP-EQPNPEQPSPEKPNPEQP 1046

Query: 173  R---VFPNAKSGNQPVEATETIV 192
            +     PN ++  +P +      
Sbjct: 1047 KPDGEKPNGQTAQKPSKGESVKT 1069



 Score = 39.9 bits (91), Expect = 0.23,   Method: Composition-based stats.
 Identities = 19/101 (18%), Positives = 38/101 (37%), Gaps = 2/101 (1%)

Query: 98   DEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREK 157
             EQ D    + ++      +  + +P     E   P   N  QP  E  + + P+   + 
Sbjct: 988  PEQPDPEQPDPEQPNPEQPNPEQPNPEQPNPEQPNPEQPNPEQPNPEQPSPEKPNP-EQP 1046

Query: 158  DVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
                +K   +   +P    + K+G+ PV  T  I+   ++ 
Sbjct: 1047 KPDGEKPNGQTAQKPSKGESVKTGD-PVVVTGLILLLIVSG 1086



 Score = 39.1 bits (89), Expect = 0.39,   Method: Composition-based stats.
 Identities = 14/83 (16%), Positives = 25/83 (30%), Gaps = 4/83 (4%)

Query: 86   MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVED 145
             +  +  +  Q D +     +   E+  N        P P     ++P   N  QP  E 
Sbjct: 985  ASVPEQPDPEQPDPEQPNPEQPNPEQP-NPEQPNPEQPNPEQPNPEQP---NPEQPSPEK 1040

Query: 146  VAFKTPDISREKDVSYKKVRRRR 168
               + P    EK       +  +
Sbjct: 1041 PNPEQPKPDGEKPNGQTAQKPSK 1063


>gi|255326626|ref|ZP_05367703.1| putative secreted protein [Rothia mucilaginosa ATCC 25296]
 gi|255296366|gb|EET75706.1| putative secreted protein [Rothia mucilaginosa ATCC 25296]
          Length = 938

 Score = 40.7 bits (93), Expect = 0.14,   Method: Composition-based stats.
 Identities = 19/88 (21%), Positives = 29/88 (32%), Gaps = 7/88 (7%)

Query: 114 NALSEFEASPCPLIEEGKEPIFENSIQPKVED--VAFKTPDISREKDVSYKKV--RRRRP 169
            A S  E +P P   +  EP    ++ P V       K P+ +            +   P
Sbjct: 598 AANSAPEQTPAPEPTKSAEPTVAPTVAPTVAPTAEPTKAPEPTVAPTAEPSAEPTKPAEP 657

Query: 170 -LRPRVFPNAKSGNQP--VEATETIVPQ 194
            + P V P+A+    P      E  V  
Sbjct: 658 TVAPTVAPSAEPTVAPTVAPTAEPTVAP 685


>gi|118480019|ref|YP_897170.1| cell surface anchor [Bacillus thuringiensis str. Al Hakam]
 gi|118419244|gb|ABK87663.1| conserved hypothetical protein [Bacillus thuringiensis str. Al Hakam]
          Length = 3588

 Score = 40.7 bits (93), Expect = 0.14,   Method: Composition-based stats.
 Identities = 21/109 (19%), Positives = 42/109 (38%), Gaps = 3/109 (2%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
             + + K +  ++ ++  ++ KE         E    P   +  E   E+  +P+V+    
Sbjct: 3276 KEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDP 3335

Query: 149  KTPDISREKDVSYKKVRRRRPLRPRVFPNA--KSGNQPVEATETIVPQE 195
            K P++  E      +V+   P  P V P    +   +P +  E  V  E
Sbjct: 3336 KEPEVKPEDPKEP-EVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPE 3383



 Score = 40.7 bits (93), Expect = 0.14,   Method: Composition-based stats.
 Identities = 21/109 (19%), Positives = 42/109 (38%), Gaps = 3/109 (2%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
             + + K +  ++ ++  ++ KE         E    P   +  E   E+  +P+V+    
Sbjct: 3316 KEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDP 3375

Query: 149  KTPDISREKDVSYKKVRRRRPLRPRVFPNA--KSGNQPVEATETIVPQE 195
            K P++  E      +V+   P  P V P    +   +P +  E  V  E
Sbjct: 3376 KEPEVKPEDPKEP-EVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPE 3423



 Score = 40.7 bits (93), Expect = 0.14,   Method: Composition-based stats.
 Identities = 21/109 (19%), Positives = 42/109 (38%), Gaps = 3/109 (2%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
             + + K +  ++ ++  ++ KE         E    P   +  E   E+  +P+V+    
Sbjct: 3356 KEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDP 3415

Query: 149  KTPDISREKDVSYKKVRRRRPLRPRVFPNA--KSGNQPVEATETIVPQE 195
            K P++  E      +V+   P  P V P    +   +P +  E  V  E
Sbjct: 3416 KEPEVKPEDPKEP-EVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPE 3463



 Score = 40.7 bits (93), Expect = 0.14,   Method: Composition-based stats.
 Identities = 21/109 (19%), Positives = 42/109 (38%), Gaps = 3/109 (2%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
             + + K +  ++ ++  ++ KE         E    P   +  E   E+  +P+V+    
Sbjct: 3396 KEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDP 3455

Query: 149  KTPDISREKDVSYKKVRRRRPLRPRVFPNA--KSGNQPVEATETIVPQE 195
            K P++  E      +V+   P  P V P    +   +P +  E  V  E
Sbjct: 3456 KEPEVKPEDPKEP-EVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPE 3503



 Score = 39.9 bits (91), Expect = 0.22,   Method: Composition-based stats.
 Identities = 17/88 (19%), Positives = 35/88 (39%), Gaps = 1/88 (1%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
             + + K +  ++ ++  ++ KE         E    P   +  E   E+  +P+V+    
Sbjct: 3436 KEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDP 3495

Query: 149  KTPDISREKDVSYKKVRRRRPLRPRVFP 176
            K P++  E      +V+   P  P V P
Sbjct: 3496 KEPEVKPEDPKEP-EVKPEDPKEPEVKP 3522


>gi|159127355|gb|EDP52470.1| transcriptional corepressor of histone genes (Hir3), putative
            [Aspergillus fumigatus A1163]
          Length = 2019

 Score = 40.7 bits (93), Expect = 0.14,   Method: Composition-based stats.
 Identities = 24/94 (25%), Positives = 38/94 (40%), Gaps = 4/94 (4%)

Query: 115  ALSEFEASPCPLIEEGKEP---IFENSIQPK-VEDVAFKTPDISREKDVSYKKVRRRRPL 170
            A SE  A+  P    G +P    FE   Q    + +     D S   ++  +K+ +    
Sbjct: 1837 AESEPPATSEPAAPSGNQPNKTSFEMGQQSDIPQSIQDSADDESELSEIDDEKLSKLAAE 1896

Query: 171  RPRVFPNAKSGNQPVEATETIVPQELNSDNASSV 204
            R  +FPN +    P   +E  VP  ++ D A  V
Sbjct: 1897 RKLLFPNLRDRISPDPDSEMSVPASIDGDAADEV 1930


>gi|38199857|emb|CAE49520.1| 2-oxoglutarate dehydrogenase, E1 and E2 components [Corynebacterium
           diphtheriae]
          Length = 1243

 Score = 40.7 bits (93), Expect = 0.14,   Method: Composition-based stats.
 Identities = 18/104 (17%), Positives = 35/104 (33%), Gaps = 5/104 (4%)

Query: 88  QAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVA 147
           Q   ++    D++   L ++Q   +         SP P     K+P       P      
Sbjct: 25  QQFQKDPQSVDKEWRDLFEKQGAPSTPGTEAKNTSPQPAAPAKKQPAPAKKPAPTTASAP 84

Query: 148 FKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETI 191
             T   +  K  + K  ++++P      P  ++G  P   +  I
Sbjct: 85  ASTEAKAAPKPENKKPAKKQQPS-----PLERTGELPAAGSSAI 123


>gi|227500845|ref|ZP_03930894.1| conserved hypothetical protein [Anaerococcus tetradius ATCC 35098]
 gi|227216949|gb|EEI82334.1| conserved hypothetical protein [Anaerococcus tetradius ATCC 35098]
          Length = 1216

 Score = 40.7 bits (93), Expect = 0.15,   Method: Composition-based stats.
 Identities = 14/91 (15%), Positives = 27/91 (29%), Gaps = 4/91 (4%)

Query: 115 ALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDI---SREKDVSYKKVRRRRPLR 171
           +  +    P P     ++P  +    P  E+   + P     S EK     +       +
Sbjct: 591 SEEKPGEKPAPSPGSEEKPGEKPQPSPGSEEKPGEKPQPGPGSEEKPGEKPQPGPGSEEK 650

Query: 172 PRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
           P   P +K   + +E           S +  
Sbjct: 651 PGEKPQSK-EEKALEENMRKGELAEGSFDGE 680


>gi|70999237|ref|XP_754340.1| transcriptional corepressor of histone genes (Hir3) [Aspergillus
            fumigatus Af293]
 gi|74674532|sp|Q4WYF1|HIR3_ASPFU RecName: Full=Histone transcription regulator 3 homolog
 gi|66851977|gb|EAL92302.1| transcriptional corepressor of histone genes (Hir3), putative
            [Aspergillus fumigatus Af293]
          Length = 2019

 Score = 40.7 bits (93), Expect = 0.15,   Method: Composition-based stats.
 Identities = 24/94 (25%), Positives = 38/94 (40%), Gaps = 4/94 (4%)

Query: 115  ALSEFEASPCPLIEEGKEP---IFENSIQPK-VEDVAFKTPDISREKDVSYKKVRRRRPL 170
            A SE  A+  P    G +P    FE   Q    + +     D S   ++  +K+ +    
Sbjct: 1837 AESEPPATSEPAAPSGNQPNKTSFEMGQQSDIPQSIQDSADDESELSEIDDEKLSKLAAE 1896

Query: 171  RPRVFPNAKSGNQPVEATETIVPQELNSDNASSV 204
            R  +FPN +    P   +E  VP  ++ D A  V
Sbjct: 1897 RKLLFPNLRDRISPDPDSEMSVPASIDGDAADEV 1930


>gi|332249231|ref|XP_003273767.1| PREDICTED: condensin complex subunit 1 isoform 2 [Nomascus
            leucogenys]
          Length = 1362

 Score = 40.7 bits (93), Expect = 0.15,   Method: Composition-based stats.
 Identities = 21/111 (18%), Positives = 40/111 (36%), Gaps = 8/111 (7%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
             + ++KL+      L   E+ E  Q       ++  P      +P+   +      D  F
Sbjct: 1244 DEFEQKLRACHTRGLDGIEELEIGQAGSQRAPSAKKPSTGSRHQPLASTA-----SDNDF 1298

Query: 149  KTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQ---PVEATETIVPQEL 196
             TP+  R         RR    +P+V  ++   ++     E TE   P++ 
Sbjct: 1299 VTPEPRRTTRRHPNTQRRASKKKPKVVFSSDESSEEDLSAEMTEEETPKKT 1349


>gi|319947303|ref|ZP_08021536.1| wall-associated protein [Streptococcus australis ATCC 700641]
 gi|319746545|gb|EFV98805.1| wall-associated protein [Streptococcus australis ATCC 700641]
          Length = 471

 Score = 40.7 bits (93), Expect = 0.15,   Method: Composition-based stats.
 Identities = 16/100 (16%), Positives = 32/100 (32%), Gaps = 6/100 (6%)

Query: 94  KLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDI 153
           +  R E        +KE+         + P P  +   +P      +P+ +      P+ 
Sbjct: 321 REVRLESGSGEGLGEKEQTPPTPDPEPSKPQPDPKPSPDP---EPSRPQPDPKPSPDPEP 377

Query: 154 SREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVP 193
           S+ +           P +P+  P+ K    P  +     P
Sbjct: 378 SKPQPDPKPSPDP-EPSKPQ--PDPKPSPDPEPSKSQPDP 414



 Score = 37.2 bits (84), Expect = 1.5,   Method: Composition-based stats.
 Identities = 17/116 (14%), Positives = 38/116 (32%), Gaps = 6/116 (5%)

Query: 82  RIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQP 141
           R+ S +   + EK Q     D    + +   + +     + P P  +   +P      +P
Sbjct: 324 RLESGSGEGLGEKEQTPPTPDPEPSKPQPDPKPSPDPEPSRPQPDPKPSPDP---EPSKP 380

Query: 142 KVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELN 197
           + +      P+ S+ +           P   +  P+ KS N    + +     +  
Sbjct: 381 QPDPKPSPDPEPSKPQPDPKPSP---DPEPSKSQPDPKSSNSSSTSVKEEEAPKPG 433


>gi|255961097|gb|ACU44424.1| BibA [Streptococcus agalactiae]
          Length = 639

 Score = 40.7 bits (93), Expect = 0.15,   Method: Composition-based stats.
 Identities = 20/102 (19%), Positives = 34/102 (33%), Gaps = 3/102 (2%)

Query: 93  EKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPD 152
           ++  +         +  E     +++ EA P    E   E   E   + K E      P+
Sbjct: 484 DQANQLANKLRDALQSLELKDKKVAKPEAKPEAKPEAKPEAKPEAKPEAKPEAKPEAKPE 543

Query: 153 ISREKDVSYKKVRRRRPLRPRVFPNAKSGNQP--VEATETIV 192
              +      K   +   +P   P AKS  +P    AT+  V
Sbjct: 544 AKPDVK-PEAKPDVKPEAKPEAKPEAKSEAKPEAKPATKKSV 584


>gi|145494181|ref|XP_001433085.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124400201|emb|CAK65688.1| unnamed protein product [Paramecium tetraurelia]
          Length = 428

 Score = 40.3 bits (92), Expect = 0.15,   Method: Composition-based stats.
 Identities = 16/102 (15%), Positives = 38/102 (37%), Gaps = 2/102 (1%)

Query: 92  QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTP 151
           +++ Q ++Q D + K ++E A   +        P      + I     QP+  +   +  
Sbjct: 317 EKRRQENDQMDDIRKVKEEIANKEVDPKLKQIPPQQPAKAQSIIAPKPQPQPINSPKENQ 376

Query: 152 DISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVP 193
            + +++       +   P RP++    + G +P        P
Sbjct: 377 KVQQKQIRPQSAQKPIVPKRPQL--QTQQGKKPPVEPRVAAP 416


>gi|229030991|ref|ZP_04187007.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus
           AH1271]
 gi|228730338|gb|EEL81302.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus
           AH1271]
          Length = 581

 Score = 40.3 bits (92), Expect = 0.15,   Method: Composition-based stats.
 Identities = 15/101 (14%), Positives = 39/101 (38%), Gaps = 2/101 (1%)

Query: 100 QDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDV 159
           ++      ++E+ +   ++      P   +  +P  E   +PK +D   + P+    K  
Sbjct: 154 EEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTDDPKQEKPE--EPKTD 211

Query: 160 SYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDN 200
             K+ +  +P +  +   A   N+ +  T   + Q+    +
Sbjct: 212 DPKQEKPEQPKQENIQIPAAQVNEAISKTSEKMLQDGIESD 252


>gi|304397059|ref|ZP_07378938.1| cell division protein FtsK/SpoIIIE [Pantoea sp. aB]
 gi|304355208|gb|EFM19576.1| cell division protein FtsK/SpoIIIE [Pantoea sp. aB]
          Length = 1179

 Score = 40.3 bits (92), Expect = 0.15,   Method: Composition-based stats.
 Identities = 28/148 (18%), Positives = 53/148 (35%), Gaps = 32/148 (21%)

Query: 70  AENHLQHAEHYNRIVSMAQAQIQEKL----QRDEQDDLLVKEQKERAQNALSEFEASPCP 125
           AE  LQ AE    +    Q++ Q++     Q+DE+D+   + Q   A+    + +    P
Sbjct: 476 AEEALQQAE----LRQAFQSEQQQRYGTSWQQDEEDEQDAQHQDALARQFAEQQQQRYEP 531

Query: 126 LIEEGK------------------------EPIFENSIQPKVEDVAFKTPDISREKDVSY 161
            +++                          EP+F  +  P+ E  A       +  +VS 
Sbjct: 532 EVKKDPVFNIDTASAFDFSPMKDLVDDGPSEPLFTIAATPEPEAPAVSHEPWQQVSEVSQ 591

Query: 162 KKVRRRRPLRPRVFPNAKSGNQPVEATE 189
            +   + P   R  P     + P  ++E
Sbjct: 592 PQAPAQVPAPDRFIPAESDYSTPAASSE 619


>gi|254785927|ref|YP_003073356.1| PT repeat/fibro-slime domain-containing protein [Teredinibacter
           turnerae T7901]
 gi|237685725|gb|ACR12989.1| PT repeat/fibro-slime domain protein [Teredinibacter turnerae
           T7901]
          Length = 1213

 Score = 40.3 bits (92), Expect = 0.16,   Method: Composition-based stats.
 Identities = 22/95 (23%), Positives = 33/95 (34%), Gaps = 8/95 (8%)

Query: 121 ASPCPLIEEGKE--PIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNA 178
           A P P+        P  E SI+P VE  A  + + S E            P        +
Sbjct: 650 AEPTPVPTAEPSVTPSAEPSIEPSVEPSAEPSVEPSVEPSTEPSAEPSAEPTPTPTPSPS 709

Query: 179 KSGNQPV------EATETIVPQELNSDNASSVDQD 207
              + P       +A ET    +LN   ++ +D D
Sbjct: 710 PVNHAPTADAGLDQALETGDVAQLNGSGSTDLDGD 744


>gi|194213148|ref|XP_001916401.1| PREDICTED: dedicator of cytokinesis 6 [Equus caballus]
          Length = 2029

 Score = 40.3 bits (92), Expect = 0.16,   Method: Composition-based stats.
 Identities = 27/131 (20%), Positives = 43/131 (32%), Gaps = 9/131 (6%)

Query: 66  DYVVAENHLQH-AEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPC 124
           D+++A    QH +  Y+ I +  Q + Q  L R   +     ++K   ++A      S  
Sbjct: 105 DWIIAHRRYQHLSAAYSPITTETQRERQRGLSRQVFEQDASGDEKASPEDADDPRHCSGS 164

Query: 125 P---LIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSG 181
           P       G   IF+          A        E+       RR   LR +  P A   
Sbjct: 165 PDDTPRSSGASGIFDLR-----NLAADSLLPSLLERAAPEDVDRRNEALRRQNRPRALLA 219

Query: 182 NQPVEATETIV 192
             P    +  V
Sbjct: 220 LYPAPDEDEAV 230


>gi|331230872|ref|XP_003328100.1| hypothetical protein PGTG_09394 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|309307090|gb|EFP83681.1| hypothetical protein PGTG_09394 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 1266

 Score = 40.3 bits (92), Expect = 0.16,   Method: Composition-based stats.
 Identities = 30/159 (18%), Positives = 65/159 (40%), Gaps = 19/159 (11%)

Query: 49  HIAERYSVLARDAMSAGDY----VVAENHLQ-HAEHYNRIVSMAQAQI---QEKLQRDEQ 100
            +  +++  + +A   GD     +++E  LQ   E    ++S  + +     E    +E 
Sbjct: 596 ELVRKFAEHSNEAKETGDKRANMMMSEEFLQPRQEPTASMISTNRWEAWSPPEMHYGEED 655

Query: 101 DDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVS 160
           ++ L+     R+     + E       +E  +P+ +  +Q K ++   KTP  ++E + +
Sbjct: 656 EENLIGFGLRRSSRTNKDKE-------KESPQPVPKPEVQVKPKEATPKTPPGNQEANKN 708

Query: 161 YKKVRRRRPLRPRVF----PNAKSGNQPVEATETIVPQE 195
               R+R+P  P  +     +  S  +     E   PQE
Sbjct: 709 PSAARKRQPSYPGAWMEGGSDDGSSGKEEPELEESAPQE 747


>gi|95981790|gb|ABF57887.1| ballchen [Drosophila mauritiana]
          Length = 609

 Score = 40.3 bits (92), Expect = 0.16,   Method: Composition-based stats.
 Identities = 22/109 (20%), Positives = 35/109 (32%), Gaps = 8/109 (7%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEF------EASPCPLIEEGKEPIFENS 138
           S    +I    + DE+D    K+  ++   +            +P P  E          
Sbjct: 387 SSLDEEISASEEDDEEDKSYRKKTAKKVTPSARNAKVSPLKRVAPAPAAESSPPGRKRVK 446

Query: 139 IQPKVEDVAFKTPDISREKDVSYK-KVRRRRPLRPR-VFPNAKSGNQPV 185
            +PK       TP  S +   + K   + + P   R   PNAK    P 
Sbjct: 447 TEPKSTPKERATPKTSPKPKGTPKVSPKPQTPTAARLRTPNAKINFSPS 495


>gi|115495611|ref|NP_001069624.1| vacuolar protein sorting-associated protein 4B [Bos taurus]
 gi|122143535|sp|Q0VD48|VPS4B_BOVIN RecName: Full=Vacuolar protein sorting-associated protein 4B
 gi|111304483|gb|AAI19837.1| Vacuolar protein sorting 4 homolog B (S. cerevisiae) [Bos taurus]
 gi|296473707|gb|DAA15822.1| vacuolar protein sorting-associated protein 4B [Bos taurus]
          Length = 444

 Score = 40.3 bits (92), Expect = 0.16,   Method: Composition-based stats.
 Identities = 29/116 (25%), Positives = 41/116 (35%), Gaps = 12/116 (10%)

Query: 51  AERYSVLARDAMS---AGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKE 107
            ++   LA  A     AG+Y  A    QHA  Y   V   +AQ  +  Q          +
Sbjct: 8   LQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLD 67

Query: 108 QKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKK 163
           + E+ +  L + E  P   ++EG         QP   D      D   E D   KK
Sbjct: 68  RAEKLKEYLKKREKKPQKPVKEG---------QPAPADEKGNDSDGEGESDDPEKK 114


>gi|21674601|ref|NP_662666.1| FtsK/SpoIIIE family protein [Chlorobium tepidum TLS]
 gi|34395672|sp|Q8KBK0|FTSK_CHLTE RecName: Full=DNA translocase ftsK
 gi|21647800|gb|AAM73008.1| FtsK/SpoIIIE family protein [Chlorobium tepidum TLS]
          Length = 804

 Score = 40.3 bits (92), Expect = 0.16,   Method: Composition-based stats.
 Identities = 26/108 (24%), Positives = 40/108 (37%), Gaps = 7/108 (6%)

Query: 82  RIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQP 141
           R  +   A + EK QR        K Q+ R     S+ +A+P     E   P+ +    P
Sbjct: 197 RKKAERMAAVLEKEQRKR----DKKAQRARKAGDASKQKAAPFENSPETPAPVMDVEPAP 252

Query: 142 KVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNA--KSGNQPVEA 187
            + + A   P +   +    +      P+RP   P    K G Q  EA
Sbjct: 253 PLLNPAVSEPVVIPAEVEEIRTPEPA-PVRPEEGPEMIIKPGVQEAEA 299


>gi|253997585|ref|YP_003049649.1| Fmu (Sun) domain-containing protein [Methylotenera mobilis JLW8]
 gi|253984264|gb|ACT49122.1| Fmu (Sun) domain protein [Methylotenera mobilis JLW8]
          Length = 514

 Score = 40.3 bits (92), Expect = 0.16,   Method: Composition-based stats.
 Identities = 29/188 (15%), Positives = 64/188 (34%), Gaps = 36/188 (19%)

Query: 39  YDVKVRGTAQHIAE----RYSVLARDAMSA-----------------GDYVVAENHLQHA 77
            D+K R T + +AE    + ++LAR A                     + +  +    H 
Sbjct: 321 PDLKWRQTPEDVAELNVKQTNILARAAKLTKVGGRLVYATCSLLSDENEKIAEQFLATHP 380

Query: 78  EHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSE------FEASPCPLIEEGK 131
           +   ++++ A+   Q++++ D  D L +           +          +P P      
Sbjct: 381 D--FKLLNAAEILAQQQIELDTGDYLKLLPHLHNTDGFFAAVFEKMGATTAPAPSEGNPV 438

Query: 132 EPIFENSIQPKVED-----VAFKTPDISREKDVSYKKVRRRRPLRPR--VFPNAKSGNQP 184
           E + E S +P++          + P  + +K    K+ + +    P+     +AK     
Sbjct: 439 EAMLEASSEPELNSVIEEVAVEEVPAKATKKAAVKKEPKPKVAKAPKDDSATSAKVSKAK 498

Query: 185 VEATETIV 192
              T+   
Sbjct: 499 ASTTKAST 506


>gi|255077330|ref|XP_002502308.1| predicted protein [Micromonas sp. RCC299]
 gi|226517573|gb|ACO63566.1| predicted protein [Micromonas sp. RCC299]
          Length = 2154

 Score = 40.3 bits (92), Expect = 0.17,   Method: Composition-based stats.
 Identities = 22/123 (17%), Positives = 39/123 (31%), Gaps = 1/123 (0%)

Query: 87  AQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDV 146
            +A++  + +   + D   + + E   +A +E E+ P P  E   E   E   +P VE  
Sbjct: 389 MEAEVTPEGEAKVESDAEAQSEAEPDSDAEAEAESKPEPDAEAETESKPEPDAEPDVEAQ 448

Query: 147 AFKTPDISREKDVSYKKVRRRRPLRPRVFPNA-KSGNQPVEATETIVPQELNSDNASSVD 205
           A    D   E        R   P       +  +S   P         +    +    V+
Sbjct: 449 AESESDADVEPKTVADAERFEAPSGDIALGSEFESILDPQPEPVEPSLKTSEEELPEGVE 508

Query: 206 QDC 208
              
Sbjct: 509 HRF 511


>gi|328883309|emb|CCA56548.1| putative membrane protein [Streptomyces venezuelae ATCC 10712]
          Length = 556

 Score = 40.3 bits (92), Expect = 0.17,   Method: Composition-based stats.
 Identities = 15/83 (18%), Positives = 26/83 (31%)

Query: 87  AQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDV 146
             A+        E D    K Q + A++A         P   E + P  E ++ P +   
Sbjct: 1   MVAEPDGSKNGPEVDPEDRKPQSDEARSAFVPPAGVEQPAPPEEEHPTSEFALPPGLSTE 60

Query: 147 AFKTPDISREKDVSYKKVRRRRP 169
               P+ S     +    +   P
Sbjct: 61  PPAEPEGSAFATPATYSAKNSPP 83


>gi|225681683|gb|EEH19967.1| conserved hypothetical protein [Paracoccidioides brasiliensis Pb03]
          Length = 1064

 Score = 40.3 bits (92), Expect = 0.17,   Method: Composition-based stats.
 Identities = 28/133 (21%), Positives = 54/133 (40%), Gaps = 13/133 (9%)

Query: 77  AEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFE 136
           +EHY RI++  +       Q+   D +    Q++ ++ A+S    +P  +     +    
Sbjct: 391 SEHYMRILAQYEQAWLSSQQKQFPDQMHGSPQRDASEGAIS---VNPQQISPPAPQMQPH 447

Query: 137 NSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRP--RVFPN---AKSGNQPVEATETI 191
           N  QP   +  F TP  S+ +       +R    RP   + PN   A+    P++  +  
Sbjct: 448 NHAQPMPVNG-FSTPVQSKSQQRHVNHQQRSSLSRPPESMSPNGRVAQFSASPIQTEKKS 506

Query: 192 VPQ----ELNSDN 200
           VP+    +   D+
Sbjct: 507 VPKTTKSQHGGDD 519


>gi|262370011|ref|ZP_06063338.1| ribonuclease E [Acinetobacter johnsonii SH046]
 gi|262315050|gb|EEY96090.1| ribonuclease E [Acinetobacter johnsonii SH046]
          Length = 1156

 Score = 40.3 bits (92), Expect = 0.17,   Method: Composition-based stats.
 Identities = 29/196 (14%), Positives = 64/196 (32%), Gaps = 10/196 (5%)

Query: 12  GRGSNGGNGSFNRKNLNPLVRNYDSNGY-DVKVRGTAQHIAERYSVLARDAMSAGDYVVA 70
            RG  G  G+     + P    Y ++     K     +   E+     R      +    
Sbjct: 602 SRGQFGQVGTPAAAPIAPNNNVYMNSAPVHAKSEHREEKHVEKEERGTRHNKKRPNKHK- 660

Query: 71  ENHLQHAEHYNRIVSMAQAQIQEKLQR--------DEQDDLLVKEQKERAQNALSEFEAS 122
           E+  Q+A+H N+I        ++  QR        +  +    +  ++R++ +  + +  
Sbjct: 661 ESREQNAQHDNQIHEEIVQVSRQDQQRQDRYEQRPERNEPQRQERHEQRSERSEQQRQDR 720

Query: 123 PCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGN 182
                ++ +EP        +      +  D+  E+  +  +  RR   RP      +  +
Sbjct: 721 SERSEQQRQEPRENKRSSRRQHGEQQQNTDVQNEQQNAMPRRDRRNQPRPERPNRHRDPS 780

Query: 183 QPVEATETIVPQELNS 198
              E     VP  +  
Sbjct: 781 VLNEQATEAVPAVVQE 796


>gi|158285483|ref|XP_308335.3| AGAP007544-PA [Anopheles gambiae str. PEST]
 gi|157020014|gb|EAA03971.3| AGAP007544-PA [Anopheles gambiae str. PEST]
          Length = 741

 Score = 40.3 bits (92), Expect = 0.17,   Method: Composition-based stats.
 Identities = 18/87 (20%), Positives = 28/87 (32%), Gaps = 10/87 (11%)

Query: 126 LIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRP---RVFPNAKSGN 182
            I E   P    + +P     A +T      K     K ++ +P +P   R  P  +  +
Sbjct: 387 TIWEPPSPEASAADEPSTSSKADETKRDDDSKSTPPPKEKQDKPAQPIAFRRKPKPEETS 446

Query: 183 QPVEATE-------TIVPQELNSDNAS 202
            P +A E          P     DN  
Sbjct: 447 TPSKADEIIIDDDSNSTPPPQKDDNGK 473


>gi|311112878|ref|YP_003984100.1| hypothetical protein HMPREF0733_11209 [Rothia dentocariosa ATCC
           17931]
 gi|310944372|gb|ADP40666.1| conserved hypothetical protein [Rothia dentocariosa ATCC 17931]
          Length = 868

 Score = 40.3 bits (92), Expect = 0.18,   Method: Composition-based stats.
 Identities = 14/77 (18%), Positives = 18/77 (23%), Gaps = 4/77 (5%)

Query: 119 FEASPCPLIEEG----KEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRV 174
               P P  E+      EP      Q K  +     P  S E            P     
Sbjct: 248 QPEQPAPAPEKPADPTPEPSQPAPEQSKPAETPAPQPSQSSEAPAPQPSQTSEAPASTPS 307

Query: 175 FPNAKSGNQPVEATETI 191
            P+    +QP       
Sbjct: 308 KPSEAPSSQPAPQPSQS 324


>gi|18495793|emb|CAC87894.1| surface protein [Theileria annulata]
          Length = 314

 Score = 40.3 bits (92), Expect = 0.18,   Method: Composition-based stats.
 Identities = 17/111 (15%), Positives = 36/111 (32%), Gaps = 11/111 (9%)

Query: 102 DLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSY 161
           D    +        + + E S  P  +E  EP  +   QP  E    +   ++ E   + 
Sbjct: 35  DPNDDQHPLDPDQLIDQIEPSEQPAQQEPIEP--QQPTQPSTEPEELEPETVTVEVPETV 92

Query: 162 KKVRRR--------RPLRPRVFPNAKSGNQPVEATETIVP-QELNSDNASS 203
                +        +   P   P  +  ++P        P +  +S +A++
Sbjct: 93  TSEEPKESDQTEEQKHEEPEASPAPEPVDEPAVQPTESTPTKASSSGDAAA 143


>gi|305680824|ref|ZP_07403631.1| glycogen debranching enzyme GlgX [Corynebacterium matruchotii ATCC
           14266]
 gi|305659029|gb|EFM48529.1| glycogen debranching enzyme GlgX [Corynebacterium matruchotii ATCC
           14266]
          Length = 855

 Score = 40.3 bits (92), Expect = 0.18,   Method: Composition-based stats.
 Identities = 23/88 (26%), Positives = 34/88 (38%), Gaps = 3/88 (3%)

Query: 121 ASPCPLI--EEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNA 178
           A P P +  EE +EP  E   + K E      P     ++    K  +         P A
Sbjct: 755 AEPEPAVDTEEQQEPKAEAEPEVKAEAETEAAPQQPESEEPKPAKPAKPAKSTKSAKP-A 813

Query: 179 KSGNQPVEATETIVPQELNSDNASSVDQ 206
           K       ATE  V ++   D A++VD+
Sbjct: 814 KPAKPTEPATEPAVDKQETPDPATTVDK 841


>gi|298386287|ref|ZP_06995843.1| transcription termination factor Rho [Bacteroides sp. 1_1_14]
 gi|298260664|gb|EFI03532.1| transcription termination factor Rho [Bacteroides sp. 1_1_14]
          Length = 740

 Score = 40.3 bits (92), Expect = 0.18,   Method: Composition-based stats.
 Identities = 26/124 (20%), Positives = 42/124 (33%), Gaps = 5/124 (4%)

Query: 83  IVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKE--PIFENSIQ 140
           I    +    EKL+ + + D   + +    +       A+    + + KE  P  +   Q
Sbjct: 62  IAGATKRVAAEKLKEERKGDKNKRSRTAAPKKEEKVAPAAKNAEVTKNKENAPAAKPQQQ 121

Query: 141 PKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPN--AKSGNQPVEATETIVPQELNS 198
           PK E           E        +R+   RPR   N   K+ N+ VE  + IV      
Sbjct: 122 PKEEAANKAKEAPVAEPKAEKAAPKRK-VGRPRKDANIAEKAENKEVENAKPIVKPAEEK 180

Query: 199 DNAS 202
             A 
Sbjct: 181 AVAE 184


>gi|314944074|ref|ZP_07850738.1| conserved domain protein [Enterococcus faecium TX0133C]
 gi|313597349|gb|EFR76194.1| conserved domain protein [Enterococcus faecium TX0133C]
          Length = 285

 Score = 40.3 bits (92), Expect = 0.18,   Method: Composition-based stats.
 Identities = 17/110 (15%), Positives = 34/110 (30%), Gaps = 7/110 (6%)

Query: 88  QAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKE------PIFENSIQP 141
           + + + K +    ++   +++ E       + E  P P  E   E      P  +   +P
Sbjct: 173 KPENENKPEVPPTENPDGEQKPEIEPGEEPDTETQPEPDNESKPEITPGEKPDVDPEEKP 232

Query: 142 KVEDVAFKTPDISREKDVSYKKVRR-RRPLRPRVFPNAKSGNQPVEATET 190
            V              + +         P +P V P  K    P   T++
Sbjct: 233 DVTPEPDTDSGNQTVPETNPDTDNETENPEKPEVAPEEKPDVTPEPDTDS 282


>gi|271968506|ref|YP_003342702.1| ribonuclease E [Streptosporangium roseum DSM 43021]
 gi|270511681|gb|ACZ89959.1| Ribonuclease E [Streptosporangium roseum DSM 43021]
          Length = 922

 Score = 40.3 bits (92), Expect = 0.18,   Method: Composition-based stats.
 Identities = 23/115 (20%), Positives = 39/115 (33%), Gaps = 6/115 (5%)

Query: 87  AQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDV 146
           AQ    ++  R +                    +A+P P+ EE  EP+ E + +P  E  
Sbjct: 92  AQETAPKRATRRKAATTASTAPATTPARRSRAKKAAPEPVAEEAPEPVVETAPEPVAE-- 149

Query: 147 AFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNA 201
             + P   +      K V++  P  P   P A       E     +   + +D A
Sbjct: 150 --EAPAPVKRSRTRRKAVQQDVPAEPE--PVADISEAEAEEVAASLLLAMPADEA 200


>gi|170095671|ref|XP_001879056.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164646360|gb|EDR10606.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 857

 Score = 40.3 bits (92), Expect = 0.18,   Method: Composition-based stats.
 Identities = 14/74 (18%), Positives = 21/74 (28%), Gaps = 8/74 (10%)

Query: 123 PCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGN 182
           P P + E  +P+   + +P    V  + P           K R      P  F       
Sbjct: 367 PQPTVSETPQPVVSETPRP----VVSEMPQPIVSDPYPLAKGRP----APLDFHRELPPQ 418

Query: 183 QPVEATETIVPQEL 196
            P+     I P   
Sbjct: 419 SPIHFETPITPPAS 432


>gi|158294235|ref|XP_315475.4| AGAP005471-PA [Anopheles gambiae str. PEST]
 gi|157015470|gb|EAA11731.4| AGAP005471-PA [Anopheles gambiae str. PEST]
          Length = 5295

 Score = 40.3 bits (92), Expect = 0.19,   Method: Composition-based stats.
 Identities = 19/94 (20%), Positives = 36/94 (38%), Gaps = 7/94 (7%)

Query: 115  ALSEFEASPCPLIEEGKEPIFENSI---QPKVEDVAFKTPDISREKDVSYKKVRRRRPLR 171
             + + +A+P P  +   EP+   +    QP       K P+ ++  +         +P  
Sbjct: 1166 PVEQAKATPEPPKKVVSEPVKVEAPKATQPAKAPEPVKAPEPTKPTETPKPVQEPAKPAE 1225

Query: 172  PRVFPNAKSGNQPVEATETIVPQELNSDNASSVD 205
            P   P A   N+P E+ +   P ++    A   D
Sbjct: 1226 P-TKPLA---NKPAESPKVAEPAKVEEQPARRPD 1255



 Score = 35.7 bits (80), Expect = 4.7,   Method: Composition-based stats.
 Identities = 16/98 (16%), Positives = 27/98 (27%), Gaps = 7/98 (7%)

Query: 118  EFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKK-----VRRRRPLRP 172
                 P    E   +P+ +    P+        P        +        V+   P +P
Sbjct: 1151 PEPTKPSKPAEPIAKPVEQAKATPEPPKKVVSEPVKVEAPKATQPAKAPEPVKAPEPTKP 1210

Query: 173  RVFPNAKSGNQPVEATETIVPQELNSDNASSVDQDCKV 210
               P  K   +P +  E   P       +  V +  KV
Sbjct: 1211 TETP--KPVQEPAKPAEPTKPLANKPAESPKVAEPAKV 1246


>gi|56460222|ref|YP_155503.1| chemotaxis-specific histidine kinase [Idiomarina loihiensis L2TR]
 gi|56179232|gb|AAV81954.1| Chemotaxis-specific histidine kinase [Idiomarina loihiensis L2TR]
          Length = 716

 Score = 40.3 bits (92), Expect = 0.19,   Method: Composition-based stats.
 Identities = 15/83 (18%), Positives = 29/83 (34%)

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
            + QEK +   +DD +  ++ E   + L     +P P  ++          +PK +    
Sbjct: 229 EKKQEKQKEPAKDDEITDDEFESLLDELHGSGKAPTPKGDKPANEPAPKKPEPKAQPKPA 288

Query: 149 KTPDISREKDVSYKKVRRRRPLR 171
             P    E     K   + +P  
Sbjct: 289 AKPASKPEPKPEPKSEPKAKPAA 311



 Score = 36.4 bits (82), Expect = 2.6,   Method: Composition-based stats.
 Identities = 21/120 (17%), Positives = 43/120 (35%), Gaps = 13/120 (10%)

Query: 98  DEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFK-------- 149
           +E  D +  ++ E   + L     +P    E+ +E   E +   ++ D  F+        
Sbjct: 200 NEDSDEISDDEFESLLDELHGSGKAPQ-SAEKKQEKQKEPAKDDEITDDEFESLLDELHG 258

Query: 150 ---TPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQ 206
               P    +K  +    ++  P + +  P AK  ++P    E     +     A  VD+
Sbjct: 259 SGKAPTPKGDKPANEPAPKKPEP-KAQPKPAAKPASKPEPKPEPKSEPKAKPAAAQPVDK 317


>gi|257878314|ref|ZP_05657967.1| cell wall surface adhesion protein [Enterococcus faecium 1,230,933]
 gi|257889485|ref|ZP_05669138.1| cell wall surface adhesion protein [Enterococcus faecium 1,231,410]
 gi|260559864|ref|ZP_05832043.1| gram-positive cocci surface protein [Enterococcus faecium C68]
 gi|314938632|ref|ZP_07845912.1| LPXTG-motif protein cell wall anchor domain protein [Enterococcus
           faecium TX0133a04]
 gi|314951086|ref|ZP_07854148.1| LPXTG-motif protein cell wall anchor domain protein [Enterococcus
           faecium TX0133A]
 gi|314992328|ref|ZP_07857762.1| LPXTG-motif protein cell wall anchor domain protein [Enterococcus
           faecium TX0133B]
 gi|257812542|gb|EEV41300.1| cell wall surface adhesion protein [Enterococcus faecium 1,230,933]
 gi|257825845|gb|EEV52471.1| cell wall surface adhesion protein [Enterococcus faecium 1,231,410]
 gi|260074088|gb|EEW62411.1| gram-positive cocci surface protein [Enterococcus faecium C68]
 gi|313593144|gb|EFR71989.1| LPXTG-motif protein cell wall anchor domain protein [Enterococcus
           faecium TX0133B]
 gi|313596720|gb|EFR75565.1| LPXTG-motif protein cell wall anchor domain protein [Enterococcus
           faecium TX0133A]
 gi|313642020|gb|EFS06600.1| LPXTG-motif protein cell wall anchor domain protein [Enterococcus
           faecium TX0133a04]
          Length = 429

 Score = 40.3 bits (92), Expect = 0.19,   Method: Composition-based stats.
 Identities = 21/132 (15%), Positives = 41/132 (31%), Gaps = 9/132 (6%)

Query: 88  QAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKE------PIFENSIQP 141
           + + + K +    ++   +++ E       + E  P P  E   E      P  +   +P
Sbjct: 173 KPENENKPEVPPTENPDGEQKPEIEPGEEPDTETQPEPDNESKPEITPGEKPDVDPEEKP 232

Query: 142 KVEDVAFKTPDISREKDVSYKKVRR-RRPLRPRVFPNAKSGNQPVEATET--IVPQELNS 198
            V              + +         P +P V P  K    P   T++      E N 
Sbjct: 233 DVTPEPDTDSGNQTVPETNPDTDNETENPEKPEVAPEEKPDVTPEPDTDSGNQTVPETNP 292

Query: 199 DNASSVDQDCKV 210
           D  +  +   K+
Sbjct: 293 DTDNETENPEKL 304


>gi|167533243|ref|XP_001748301.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163773113|gb|EDQ86756.1| predicted protein [Monosiga brevicollis MX1]
          Length = 832

 Score = 39.9 bits (91), Expect = 0.20,   Method: Composition-based stats.
 Identities = 21/87 (24%), Positives = 32/87 (36%), Gaps = 4/87 (4%)

Query: 96  QRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISR 155
           Q + Q +   + Q E    +  E E    P  E   +P  E   QP+ E  +   P+   
Sbjct: 218 QPELQPESEPQSQPEPEPQSQPEPEPQSQPEPESQPQPEPEPQSQPEPEPQSQPEPEPEL 277

Query: 156 EKDV----SYKKVRRRRPLRPRVFPNA 178
           + DV    + K   +  P  P   P A
Sbjct: 278 QADVANNNAPKAEIKATPDAPETLPEA 304



 Score = 35.3 bits (79), Expect = 6.0,   Method: Composition-based stats.
 Identities = 18/120 (15%), Positives = 37/120 (30%), Gaps = 3/120 (2%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
           +  +A  + K     + +  +  + E       E E    P  E   +P  E   QP+ E
Sbjct: 191 ASEEAPTEAKSVTTPEIESNISSKPEPQPELQPESEPQSQPEPEPQSQPEPEPQSQPEPE 250

Query: 145 DVAFKTPDISREK-DVSYKKVRRRRPLRPRVFPNA--KSGNQPVEATETIVPQELNSDNA 201
                 P+   +       +      L+  V  N   K+  +        +P+   + + 
Sbjct: 251 SQPQPEPEPQSQPEPEPQSQPEPEPELQADVANNNAPKAEIKATPDAPETLPEADATADT 310



 Score = 34.9 bits (78), Expect = 7.5,   Method: Composition-based stats.
 Identities = 16/101 (15%), Positives = 29/101 (28%), Gaps = 1/101 (0%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
           S    Q     Q           + +       E   S  P  +   +P  E   QP+ E
Sbjct: 175 SSEMPQTDTSNQYGNDASEEAPTEAKSVTTPEIESNISSKPEPQPELQPESEPQSQPEPE 234

Query: 145 DVAFKTPDISREK-DVSYKKVRRRRPLRPRVFPNAKSGNQP 184
             +   P+   +    S  +       +P   P ++   +P
Sbjct: 235 PQSQPEPEPQSQPEPESQPQPEPEPQSQPEPEPQSQPEPEP 275


>gi|225684244|gb|EEH22528.1| DNA ligase [Paracoccidioides brasiliensis Pb03]
          Length = 847

 Score = 39.9 bits (91), Expect = 0.20,   Method: Composition-based stats.
 Identities = 23/118 (19%), Positives = 46/118 (38%), Gaps = 14/118 (11%)

Query: 100 QDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFE----NSIQPKVEDVAFKTPDISR 155
           +++       E+  ++ SE  +     ++  K P+ E    + IQP  +     TP+  R
Sbjct: 94  KEESDANSGSEKVPDSRSENSSPGSKKLKRDKTPVEEESEESDIQPATKRRKRSTPEKKR 153

Query: 156 EKDVSYKKVRRRRPLRPRVFPNAKSGN------QPVEATETIVPQELNSDNASSVDQD 207
                  K   ++P+  +    +KS        +PV+ T+         D+  SV+ D
Sbjct: 154 A--SPKPKTADKKPVASKAKGRSKSPQSPKKVKEPVDETKEST--SAEKDDVDSVNDD 207


>gi|260841795|ref|XP_002614096.1| hypothetical protein BRAFLDRAFT_118428 [Branchiostoma floridae]
 gi|229299486|gb|EEN70105.1| hypothetical protein BRAFLDRAFT_118428 [Branchiostoma floridae]
          Length = 3158

 Score = 39.9 bits (91), Expect = 0.20,   Method: Composition-based stats.
 Identities = 21/122 (17%), Positives = 42/122 (34%), Gaps = 6/122 (4%)

Query: 87  AQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGK-EPIFENSIQPKVED 145
            Q  +    +  +++D  V++   +        +  P         +P  E+   P+   
Sbjct: 732 NQESVDHSKEPPQEEDEEVEDSGRKPTETSRPEDPKPQKASSVPSRQPPPESKPIPEPIP 791

Query: 146 VAFKTPD-ISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIV----PQELNSDN 200
           +  K P    RE  +S   V   +  RP   P+ +  +QP   T+       P    + N
Sbjct: 792 MPSKEPSPPPREVPMSAPPVVNSQSPRPPSQPSPRPPSQPPPRTQESAMTSNPPSSQAAN 851

Query: 201 AS 202
           + 
Sbjct: 852 SQ 853


>gi|329945597|ref|ZP_08293330.1| PT repeat protein [Actinomyces sp. oral taxon 170 str. F0386]
 gi|328528600|gb|EGF55565.1| PT repeat protein [Actinomyces sp. oral taxon 170 str. F0386]
          Length = 740

 Score = 39.9 bits (91), Expect = 0.21,   Method: Composition-based stats.
 Identities = 17/86 (19%), Positives = 25/86 (29%), Gaps = 5/86 (5%)

Query: 112 AQNALSEFEASPCPLIEEGKEPIFE----NSIQPKVEDVAFKTPDISREK-DVSYKKVRR 166
            Q+       SP P  E  +EP  E     + QP  +  A   P+ + E      +    
Sbjct: 188 KQSPDVISPPSPEPTAEPSEEPSVEPTTAPTAQPTPDPTAGPEPEPTTEPAPEPTQAPSP 247

Query: 167 RRPLRPRVFPNAKSGNQPVEATETIV 192
              + P   P       PV       
Sbjct: 248 SPTVMPSAQPTPTVAPDPVSTPTNAT 273


>gi|229162197|ref|ZP_04290166.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus
           R309803]
 gi|228621247|gb|EEK78104.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus
           R309803]
          Length = 601

 Score = 39.9 bits (91), Expect = 0.21,   Method: Composition-based stats.
 Identities = 15/101 (14%), Positives = 39/101 (38%), Gaps = 2/101 (1%)

Query: 100 QDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDV 159
           ++      ++E+ +   ++      P   +  +P  E   +PK +D   + P+    K  
Sbjct: 154 EEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTDDPKQEKPE--EPKTD 211

Query: 160 SYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDN 200
             K+ +  +P +  +   A   N+ +  T   + Q+    +
Sbjct: 212 DPKQEKPEQPKQENIQVPAAQVNEAISKTSEKMLQDGIESD 252


>gi|283783091|ref|YP_003373845.1| pullulanase, type I [Gardnerella vaginalis 409-05]
 gi|283441814|gb|ADB14280.1| pullulanase, type I [Gardnerella vaginalis 409-05]
          Length = 1888

 Score = 39.9 bits (91), Expect = 0.21,   Method: Composition-based stats.
 Identities = 15/112 (13%), Positives = 36/112 (32%), Gaps = 5/112 (4%)

Query: 92   QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV-EDVAFKT 150
             E  ++ E      ++  E+ +      +        +  +P  + +  PK  E      
Sbjct: 1611 DEPGKQPENPSEPGEKPGEKPKPGEDPSKKP---EKPKPDQPGTKPAPAPKPGEHQQVPA 1667

Query: 151  PDISREKDVSYKKVRRRRPLRPRVFP-NAKSGNQPVEATETIVPQELNSDNA 201
            P        S ++ +  +P  P   P  ++   +P  A          +++A
Sbjct: 1668 PAPKPTPSESSEQSKPSKPSVPSEKPVPSEKTEKPAPADSAKPAPAKPAESA 1719


>gi|189235546|ref|XP_966368.2| PREDICTED: similar to GA15696-PA [Tribolium castaneum]
          Length = 4263

 Score = 39.9 bits (91), Expect = 0.21,   Method: Composition-based stats.
 Identities = 21/115 (18%), Positives = 37/115 (32%), Gaps = 2/115 (1%)

Query: 97  RDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQ--PKVEDVAFKTPDIS 154
            +E    L +E KE  Q           P  +E  E   E   Q     +    + P+ +
Sbjct: 497 EEETSSKLKEESKETKQVESLPQVEESKPRQKEEPEKRKETGPQVVEDTKSRPKEEPEKN 556

Query: 155 REKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQDCK 209
           +      K   + +P +P+V    +    P     T    +   D    V ++ K
Sbjct: 557 KHVVEESKPTPKEKPQKPKVVEEKQKETCPQVVENTRSKPKEEPDKTKQVVEESK 611



 Score = 37.2 bits (84), Expect = 1.4,   Method: Composition-based stats.
 Identities = 19/128 (14%), Positives = 41/128 (32%), Gaps = 12/128 (9%)

Query: 89  AQIQEKLQRDEQDDLLVKEQKERA------------QNALSEFEASPCPLIEEGKEPIFE 136
            Q +E  +R E    +V++ K R             ++  +  E    P + E K+    
Sbjct: 526 RQKEEPEKRKETGPQVVEDTKSRPKEEPEKNKHVVEESKPTPKEKPQKPKVVEEKQKETC 585

Query: 137 NSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQEL 196
             +         + PD +++     K   +  P +P+     +    P    +T    + 
Sbjct: 586 PQVVENTRSKPKEEPDKTKQVVEESKPRAKEEPQKPKGVEEKQKETCPHVVEDTRSKPKE 645

Query: 197 NSDNASSV 204
             +    V
Sbjct: 646 EPERTKQV 653


>gi|161528344|ref|YP_001582170.1| hypothetical protein Nmar_0836 [Nitrosopumilus maritimus SCM1]
 gi|160339645|gb|ABX12732.1| hypothetical protein Nmar_0836 [Nitrosopumilus maritimus SCM1]
          Length = 268

 Score = 39.9 bits (91), Expect = 0.21,   Method: Composition-based stats.
 Identities = 21/118 (17%), Positives = 40/118 (33%), Gaps = 7/118 (5%)

Query: 83  IVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIE--EGKEPIFENSIQ 140
           ++S      + +LQ ++  +    +Q +     + E    P P++E     EP+ E + +
Sbjct: 2   VLSEVNKDEEAQLQWEK--EAKRIQQIKNPTEPVVEPTPEPEPVVEPTPEPEPVVEPTPE 59

Query: 141 PKVEDVAFKTPDISREK-DVSYKKVRRRRPLRPRVFPNAKSGN--QPVEATETIVPQE 195
           P+        P+   E        V       P V P  +     +P    E     E
Sbjct: 60  PEPVVEPTPEPEPVVEPTPEPEPVVEPTPEPEPVVEPTPEPEPVVEPTPEPEESQLPE 117



 Score = 38.4 bits (87), Expect = 0.72,   Method: Composition-based stats.
 Identities = 21/113 (18%), Positives = 40/113 (35%), Gaps = 5/113 (4%)

Query: 93  EKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPD 152
            ++ +DE+  L  +++ +R Q   +  E    P  E   EP+ E + +P+        P+
Sbjct: 4   SEVNKDEEAQLQWEKEAKRIQQIKNPTEPVVEPTPE--PEPVVEPTPEPEPVVEPTPEPE 61

Query: 153 ISREK-DVSYKKVRRRRPLRPRVFPNAKSGN--QPVEATETIVPQELNSDNAS 202
              E        V       P V P  +     +P    E +V      + + 
Sbjct: 62  PVVEPTPEPEPVVEPTPEPEPVVEPTPEPEPVVEPTPEPEPVVEPTPEPEESQ 114


>gi|168704584|ref|ZP_02736861.1| hypothetical protein GobsU_33925 [Gemmata obscuriglobus UQM 2246]
          Length = 815

 Score = 39.9 bits (91), Expect = 0.21,   Method: Composition-based stats.
 Identities = 20/92 (21%), Positives = 27/92 (29%), Gaps = 6/92 (6%)

Query: 104 LVKEQKERAQNALSEFEASPCPLIEEGKEPIFEN--SIQPKVEDVAFKT----PDISREK 157
              + K  A         +P P    G  P+       QPKVE          P    + 
Sbjct: 537 TRIDPKPAAGGGPVNPAMNPQPRPPVGPNPVINPATPPQPKVEPKQPAASTGRPQPKVDP 596

Query: 158 DVSYKKVRRRRPLRPRVFPNAKSGNQPVEATE 189
                 V R +P+ P+V P       P    E
Sbjct: 597 GQPTNPVTRPQPVVPKVEPKPTPATNPAPRVE 628


>gi|115634798|ref|XP_788510.2| PREDICTED: similar to ENSANGP00000007239 [Strongylocentrotus
           purpuratus]
 gi|115924511|ref|XP_001197642.1| PREDICTED: similar to ENSANGP00000007239 [Strongylocentrotus
           purpuratus]
          Length = 2731

 Score = 39.9 bits (91), Expect = 0.21,   Method: Composition-based stats.
 Identities = 23/129 (17%), Positives = 45/129 (34%), Gaps = 10/129 (7%)

Query: 68  VVAENHLQH-AEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPL 126
           +  +++ Q  AE   R+      Q + K Q+ +Q     K ++E+  ++           
Sbjct: 34  IQEKSYEQAVAEQRARLEKEQVQQREGKRQKRKQFFEKKKREREKHDSSPGILRQEVAQA 93

Query: 127 IEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVE 186
           I+    P  E   Q        K   +   K     K  ++ P+   +F       +P  
Sbjct: 94  ID----PYVEEVEQAPPSPPPVKEEKVKPAKKPKQPKPPKQAPVEEIIF-----EAKPAP 144

Query: 187 ATETIVPQE 195
             ET+ P +
Sbjct: 145 VQETVAPPK 153


>gi|153009725|ref|YP_001370940.1| extensin family protein [Ochrobactrum anthropi ATCC 49188]
 gi|151561613|gb|ABS15111.1| Extensin family protein [Ochrobactrum anthropi ATCC 49188]
          Length = 362

 Score = 39.9 bits (91), Expect = 0.21,   Method: Composition-based stats.
 Identities = 22/130 (16%), Positives = 47/130 (36%), Gaps = 21/130 (16%)

Query: 82  RIV-SMAQAQIQEKLQ----RDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFE 136
           RI+   AQ   Q + +    R ++     ++   ++++A ++ E  P P+I     P+  
Sbjct: 43  RILKQDAQKAKQHRKRPAVKRSQKKPASKQQTATQSESAPAKAETKPAPMI-----PVPT 97

Query: 137 NSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQEL 196
            + +P+        P+                  +P   P  +   +P   T T      
Sbjct: 98  PAPRPENTATKGAEPETPPIPTE-----------KPEAEPQNQPLAKPAPTTPTQAAPPK 146

Query: 197 NSDNASSVDQ 206
            +DN   +D+
Sbjct: 147 PADNPKPMDE 156


>gi|83288394|sp|Q9JM99|PRG4_MOUSE RecName: Full=Proteoglycan 4; AltName: Full=Lubricin; AltName:
           Full=Megakaryocyte-stimulating factor; AltName:
           Full=Superficial zone proteoglycan; Contains: RecName:
           Full=Proteoglycan 4 C-terminal part; Flags: Precursor
          Length = 1054

 Score = 39.9 bits (91), Expect = 0.22,   Method: Composition-based stats.
 Identities = 16/123 (13%), Positives = 38/123 (30%), Gaps = 5/123 (4%)

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQP----KVE 144
            + +    ++ +   L + +    +         P P   +  EP      +P    + E
Sbjct: 459 KEPEPTTPKEPEPTTLKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPE 518

Query: 145 DVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSV 204
               K P+ +  K+      +   P  P+  P   +  +PV  T          +   + 
Sbjct: 519 PTTPKEPEPTTPKEPEPTTPKEPEPTTPK-KPEPTTPKEPVPTTPKEPEPTTPKEPEPTT 577

Query: 205 DQD 207
            ++
Sbjct: 578 PKE 580



 Score = 37.2 bits (84), Expect = 1.3,   Method: Composition-based stats.
 Identities = 15/127 (11%), Positives = 38/127 (29%), Gaps = 5/127 (3%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQP--- 141
           S  + + +    ++ +     + +    +         P P   +  EP      +P   
Sbjct: 447 STTRKEPEPTTPKEPEPTTPKEPEPTTLKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTP 506

Query: 142 -KVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDN 200
            + E    K P+ +  K+      +   P  P+  P   +  +P   T          + 
Sbjct: 507 KEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPK-EPEPTTPKKPEPTTPKEPVPTTPKEP 565

Query: 201 ASSVDQD 207
             +  ++
Sbjct: 566 EPTTPKE 572



 Score = 35.7 bits (80), Expect = 3.8,   Method: Composition-based stats.
 Identities = 14/123 (11%), Positives = 36/123 (29%), Gaps = 5/123 (4%)

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQP----KVE 144
            + +    ++ +     + +    +         P P   +  EP      +P    + E
Sbjct: 483 KEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPE 542

Query: 145 DVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSV 204
               K P+ +  K+      +   P  P+  P   +  +P   T          +   + 
Sbjct: 543 PTTPKKPEPTTPKEPVPTTPKEPEPTTPK-EPEPTTPKEPEPTTRKEPEPTTPKEPEPTT 601

Query: 205 DQD 207
            ++
Sbjct: 602 PKE 604


>gi|168492822|ref|ZP_02716965.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae CDC3059-06]
 gi|221231480|ref|YP_002510632.1| zinc metalloproteinase ZmpB [Streptococcus pneumoniae ATCC 700669]
 gi|183576919|gb|EDT97447.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae CDC3059-06]
 gi|220673940|emb|CAR68449.1| putative zinc metalloproteinase ZmpB [Streptococcus pneumoniae ATCC
           700669]
          Length = 1889

 Score = 39.9 bits (91), Expect = 0.22,   Method: Composition-based stats.
 Identities = 23/117 (19%), Positives = 40/117 (34%), Gaps = 11/117 (9%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPC----PLIEEGKEPIFENSIQ 140
           +  QA+ + ++   E+       + E +     + E  P     P +EEGKE   E +  
Sbjct: 126 NQEQARTENQVVETEEAPKEEAPKTEESPKEEPKSEIKPTDDTLPKVEEGKEDSAEPAPV 185

Query: 141 PKVEDVAFKTPDISR-EKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQEL 196
            +V       P+     K  S    +      P   P  +   +PVE +E       
Sbjct: 186 EEVGGEVESKPEEKVAVKPESQPSDK------PTEEPKVEQVGEPVEPSEDEQAPTA 236


>gi|291571439|dbj|BAI93711.1| WD-40 repeat protein [Arthrospira platensis NIES-39]
          Length = 486

 Score = 39.9 bits (91), Expect = 0.23,   Method: Composition-based stats.
 Identities = 25/114 (21%), Positives = 41/114 (35%), Gaps = 7/114 (6%)

Query: 90  QIQEKLQRDEQDDLLVKEQKERAQNALSEF-EASPCPLIEEGKEPIFENSIQP----KVE 144
           + Q K Q    D+ L    +   ++      E+ P P+IE   EPI E   +P    + E
Sbjct: 117 EYQTKPQPPTSDNSLPPIAEPIIESEPEPIIESEPEPIIELEPEPIIELEPEPIIELEPE 176

Query: 145 DVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQ--PVEATETIVPQEL 196
            +    P+   E +          P+        KS ++   +EA E   P   
Sbjct: 177 PIIELEPEPIIESEPEPIIESEPEPVAESEGEEQKSQSKIFGIEAGEISAPGRS 230


>gi|239986483|ref|ZP_04707147.1| putative nicotinate-nucleotide- dimethylbenzimidazole
           phosphoribosyltransferase [Streptomyces roseosporus NRRL
           11379]
          Length = 749

 Score = 39.9 bits (91), Expect = 0.23,   Method: Composition-based stats.
 Identities = 24/115 (20%), Positives = 39/115 (33%), Gaps = 4/115 (3%)

Query: 84  VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV 143
           V  AQA    + Q           Q E+    L+     P P+ EE  EP    + +   
Sbjct: 10  VEPAQAVAVAEGQEAVVAREPAVAQPEQVAAELTPEPVQPEPVAEEPVEPAEPVAEETAG 69

Query: 144 EDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
           E    + P  + E  V+  +        P + P+A+ G  P       +  E  +
Sbjct: 70  EAAPEQEPAPTPEPAVAETEPE----AAPAIAPDAEDGTGPEVIETPELLPEPQA 120


>gi|270014627|gb|EFA11075.1| hypothetical protein TcasGA2_TC004671 [Tribolium castaneum]
          Length = 959

 Score = 39.9 bits (91), Expect = 0.23,   Method: Composition-based stats.
 Identities = 14/93 (15%), Positives = 27/93 (29%), Gaps = 4/93 (4%)

Query: 109 KERAQNALSEFEASPC----PLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKV 164
           K + +       A P     P I    +PI   + QP+++     T         + K+ 
Sbjct: 545 KPKEETPQCPLAAKPKESEVPQIPAAPQPIETPTSQPQIQPQPISTESPQCPITPTPKEE 604

Query: 165 RRRRPLRPRVFPNAKSGNQPVEATETIVPQELN 197
             + PL P+   +                 +  
Sbjct: 605 TPQCPLAPKPKESEVPQTPAAPQPIATPTPQPQ 637


>gi|293364235|ref|ZP_06610961.1| alpha-L-fucosidase [Streptococcus oralis ATCC 35037]
 gi|291317081|gb|EFE57508.1| alpha-L-fucosidase [Streptococcus oralis ATCC 35037]
          Length = 2031

 Score = 39.9 bits (91), Expect = 0.23,   Method: Composition-based stats.
 Identities = 17/113 (15%), Positives = 39/113 (34%), Gaps = 4/113 (3%)

Query: 87   AQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKE--PIFENSIQPK-- 142
            AQ +   + ++  Q +  V+ +K       ++ E    P      E     E   QP+  
Sbjct: 1697 AQPEKPAQPEKPAQPETPVQPEKPAQPEKPTQPEKPAQPETPAQPEKPAQPEKPAQPEKP 1756

Query: 143  VEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQE 195
             +      P+   + +   +  +  +P +P          +P E  +   P++
Sbjct: 1757 AQPETPAQPETPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPAETEKPAQPEK 1809



 Score = 37.2 bits (84), Expect = 1.4,   Method: Composition-based stats.
 Identities = 15/114 (13%), Positives = 37/114 (32%), Gaps = 6/114 (5%)

Query: 84   VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPK- 142
            +  AQ +   + +   Q +  V+ +K       ++ E    P          E   QP+ 
Sbjct: 1670 LEAAQPEKPAQPENPAQPEKPVQPEKPAQPEKPAQPEKPAQPETPVQP----EKPAQPEK 1725

Query: 143  -VEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQE 195
              +      P+   + +   +  +  +P +P           P +  +   P++
Sbjct: 1726 PTQPEKPAQPETPAQPEKPAQPEKPAQPEKPAQPETPAQPETPAQPEKPAQPEK 1779



 Score = 36.8 bits (83), Expect = 1.7,   Method: Composition-based stats.
 Identities = 15/106 (14%), Positives = 37/106 (34%), Gaps = 2/106 (1%)

Query: 87   AQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDV 146
            AQ +   + ++  Q +   + +K       +E E    P  E+  +P      +   +  
Sbjct: 1769 AQPEKPAQPEKPAQPEKPAQPEKPAQPEKPAETEKPAQP--EKPAQPETPAQPEKPAQPE 1826

Query: 147  AFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIV 192
                P+   + +   +  +   P +P       + + P E  + +V
Sbjct: 1827 KPTQPEKPAQPETPAQPEKPAEPEKPAQPEKPITSSSPEEGVKDLV 1872



 Score = 36.8 bits (83), Expect = 2.1,   Method: Composition-based stats.
 Identities = 23/115 (20%), Positives = 35/115 (30%), Gaps = 5/115 (4%)

Query: 86   MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVED 145
               AQ +   Q ++        Q E+         A P    E  K    E   QP+   
Sbjct: 1760 ETPAQPETPAQPEKPAQPEKPAQPEKPAQPEKP--AQPEKPAETEKPAQPEKPAQPETPA 1817

Query: 146  VAFKTPDISREKDVSYKKV-RRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSD 199
               K      EK    +K  +   P +P      +   QP +   +  P+E   D
Sbjct: 1818 QPEKPAQP--EKPTQPEKPAQPETPAQPEKPAEPEKPAQPEKPITSSSPEEGVKD 1870



 Score = 34.5 bits (77), Expect = 8.9,   Method: Composition-based stats.
 Identities = 17/110 (15%), Positives = 35/110 (31%), Gaps = 1/110 (0%)

Query: 87   AQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDV 146
            AQ +   + ++  Q +   + +K       ++ E    P      E   +     + E  
Sbjct: 1733 AQPETPAQPEKPAQPEKPAQPEKPAQPETPAQPETPAQPEKPAQPEKPAQPEKPAQPEKP 1792

Query: 147  AFKTPDISREKDVSYKKV-RRRRPLRPRVFPNAKSGNQPVEATETIVPQE 195
            A        EK    +K  +   P +P      +   QP +  +   P +
Sbjct: 1793 AQPEKPAETEKPAQPEKPAQPETPAQPEKPAQPEKPTQPEKPAQPETPAQ 1842


>gi|239940000|ref|ZP_04691937.1| putative nicotinate-nucleotide- dimethylbenzimidazole
           phosphoribosyltransferase [Streptomyces roseosporus NRRL
           15998]
          Length = 755

 Score = 39.9 bits (91), Expect = 0.23,   Method: Composition-based stats.
 Identities = 24/115 (20%), Positives = 39/115 (33%), Gaps = 4/115 (3%)

Query: 84  VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV 143
           V  AQA    + Q           Q E+    L+     P P+ EE  EP    + +   
Sbjct: 16  VEPAQAVAVAEGQEAVVAREPAVAQPEQVAAELTPEPVQPEPVAEEPVEPAEPVAEETAG 75

Query: 144 EDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
           E    + P  + E  V+  +        P + P+A+ G  P       +  E  +
Sbjct: 76  EAAPEQEPAPTPEPAVAETEPE----AAPAIAPDAEDGTGPEVIETPELLPEPQA 126


>gi|86742162|ref|YP_482562.1| regulator of polyketide synthase expression-like protein [Frankia
           sp. CcI3]
 gi|86569024|gb|ABD12833.1| Regulator of polyketide synthase expression-like [Frankia sp. CcI3]
          Length = 539

 Score = 39.9 bits (91), Expect = 0.23,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 27/90 (30%), Gaps = 6/90 (6%)

Query: 115 ALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREK-----DVSYKKVRRRRP 169
           A  E  A P P      EP  E    P+ E      P    E       V  + V    P
Sbjct: 21  ARLEPGAPPVPTPAGEIEPSPETEPSPETEPSPETEPSPETEPSPETGPVPEQSVDYPEP 80

Query: 170 LRPRV-FPNAKSGNQPVEATETIVPQELNS 198
             P +  P +  G  P  A +   P    S
Sbjct: 81  RIPDLGNPWSAGGASPRPAGDQARPTSTGS 110


>gi|7209719|dbj|BAA92310.1| unnamed protein product [Mus musculus]
          Length = 1054

 Score = 39.9 bits (91), Expect = 0.23,   Method: Composition-based stats.
 Identities = 16/123 (13%), Positives = 38/123 (30%), Gaps = 5/123 (4%)

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQP----KVE 144
            + +    ++ +   L + +    +         P P   +  EP      +P    + E
Sbjct: 459 KEPEPTTPKEPEPTTLKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPE 518

Query: 145 DVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSV 204
               K P+ +  K+      +   P  P+  P   +  +PV  T          +   + 
Sbjct: 519 PTTPKEPEPTTPKEPEPTTPKEPEPTTPK-KPEPTTPKEPVPTTPKEPEPTTPKEPEPTT 577

Query: 205 DQD 207
            ++
Sbjct: 578 PKE 580



 Score = 37.2 bits (84), Expect = 1.4,   Method: Composition-based stats.
 Identities = 15/127 (11%), Positives = 38/127 (29%), Gaps = 5/127 (3%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQP--- 141
           S  + + +    ++ +     + +    +         P P   +  EP      +P   
Sbjct: 447 STTRKEPEPTTPKEPEPTTPKEPEPTTLKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTP 506

Query: 142 -KVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDN 200
            + E    K P+ +  K+      +   P  P+  P   +  +P   T          + 
Sbjct: 507 KEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPK-EPEPTTPKKPEPTTPKEPVPTTPKEP 565

Query: 201 ASSVDQD 207
             +  ++
Sbjct: 566 EPTTPKE 572



 Score = 35.7 bits (80), Expect = 4.0,   Method: Composition-based stats.
 Identities = 14/123 (11%), Positives = 36/123 (29%), Gaps = 5/123 (4%)

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQP----KVE 144
            + +    ++ +     + +    +         P P   +  EP      +P    + E
Sbjct: 483 KEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPE 542

Query: 145 DVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSV 204
               K P+ +  K+      +   P  P+  P   +  +P   T          +   + 
Sbjct: 543 PTTPKKPEPTTPKEPVPTTPKEPEPTTPK-EPEPTTPKEPEPTTRKEPEPTTPKEPEPTT 601

Query: 205 DQD 207
            ++
Sbjct: 602 PKE 604


>gi|302417692|ref|XP_003006677.1| conserved hypothetical protein [Verticillium albo-atrum VaMs.102]
 gi|261354279|gb|EEY16707.1| conserved hypothetical protein [Verticillium albo-atrum VaMs.102]
          Length = 644

 Score = 39.9 bits (91), Expect = 0.24,   Method: Composition-based stats.
 Identities = 16/82 (19%), Positives = 27/82 (32%), Gaps = 6/82 (7%)

Query: 120 EASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISRE------KDVSYKKVRRRRPLRPR 173
           +  P    EE  +   E   + K E+   + P    E       D   +K + +   +P+
Sbjct: 563 QDKPESKPEEKPQVTPEQKPETKQEEKPVEKPQGKPEDDSAGKPDDKQEKPKEKPEEQPK 622

Query: 174 VFPNAKSGNQPVEATETIVPQE 195
             P  K   +P E       Q 
Sbjct: 623 EMPEGKPEERPAEKPREAREQA 644



 Score = 39.1 bits (89), Expect = 0.39,   Method: Composition-based stats.
 Identities = 19/106 (17%), Positives = 44/106 (41%), Gaps = 4/106 (3%)

Query: 86  MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVED 145
            A+ + +  ++ + + +L  +++ E       +      P  ++ ++P+ +   Q K ED
Sbjct: 543 AAKLEAKPDIKPELKPELKPQDKPESKPEEKPQVTPEQKPETKQEEKPVEKP--QGKPED 600

Query: 146 VAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETI 191
            +   PD  +EK     + + +    P   P  +   +P EA E  
Sbjct: 601 DSAGKPDDKQEKPKEKPEEQPKEM--PEGKPEERPAEKPREAREQA 644


>gi|283781300|ref|YP_003372055.1| hypothetical protein Psta_3534 [Pirellula staleyi DSM 6068]
 gi|283439753|gb|ADB18195.1| hypothetical protein Psta_3534 [Pirellula staleyi DSM 6068]
          Length = 816

 Score = 39.9 bits (91), Expect = 0.24,   Method: Composition-based stats.
 Identities = 23/110 (20%), Positives = 36/110 (32%), Gaps = 7/110 (6%)

Query: 86  MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVED 145
            A+   +EK      +    +E K          EA P    +E   P  E   + K  D
Sbjct: 369 EAEKPAEEKPAEPAPEAAKPEEAKPETPAEKPAEEAKPEGGCQEEPAP--EKPAEEKPAD 426

Query: 146 VAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQE 195
              + P  + E   + +K    +P  P   P A++   P   T    P  
Sbjct: 427 APAEKP--AEEAKPAEEKPAEEKPAEPAEKPAAET---PATETPAAEPPA 471



 Score = 38.4 bits (87), Expect = 0.69,   Method: Composition-based stats.
 Identities = 16/116 (13%), Positives = 33/116 (28%)

Query: 80  YNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSI 139
           Y ++      +I +K   +EQ       +  + ++ +     +P P     + P  E   
Sbjct: 274 YLKVDFDKYLEIAKKQVTEEQIQKQYDLEVSQGKHRVEVPAETPKPESPATETPAPETPA 333

Query: 140 QPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQE 195
               +  A        E      K    +P   +      +  +P E        E
Sbjct: 334 TETPKPEAPAGETPKPETPAEEPKPEAAKPEAAKPEAEKPAEEKPAEPAPEAAKPE 389



 Score = 38.0 bits (86), Expect = 0.80,   Method: Composition-based stats.
 Identities = 22/130 (16%), Positives = 37/130 (28%), Gaps = 10/130 (7%)

Query: 78  EHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIE----EGKEP 133
           + Y  I      + Q + Q D +        +  A+    E  A+  P  E    E  +P
Sbjct: 280 DKYLEIAKKQVTEEQIQKQYDLEVSQGKHRVEVPAETPKPESPATETPAPETPATETPKP 339

Query: 134 IFENSIQPKVEDVAFK------TPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEA 187
                  PK E  A +       P+ ++ +     + +   P      P       P E 
Sbjct: 340 EAPAGETPKPETPAEEPKPEAAKPEAAKPEAEKPAEEKPAEPAPEAAKPEEAKPETPAEK 399

Query: 188 TETIVPQELN 197
                  E  
Sbjct: 400 PAEEAKPEGG 409


>gi|110005908|gb|ABG48499.1| titin b [Danio rerio]
          Length = 28835

 Score = 39.9 bits (91), Expect = 0.24,   Method: Composition-based stats.
 Identities = 31/169 (18%), Positives = 54/169 (31%), Gaps = 15/169 (8%)

Query: 54   YSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQ 113
            YSV+AR          AE +L   E    I      ++ E+ +   + +L          
Sbjct: 5597 YSVIARLEPVGETKSTAELYLSGKEMKKPIEETVTKRVVERTEEAPKQELNAVSVLLYGV 5656

Query: 114  NALSEFEASPC-------PLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRR 166
               +  E  P         + E   EP  E    P+ +      P+         K   +
Sbjct: 5657 LKPTPSEPKPQMTAEPKASVTESKPEPKSEPKALPQPQSE--HKPEPKATPKPEPKPEPK 5714

Query: 167  RRPLRPRVFPNAKSGNQPVEATETIVP-----QELNSDNASSVDQDCKV 210
              P +P   P  K   +P  A    VP      E+   ++ ++ +D  +
Sbjct: 5715 ATP-KPEPKPELKPEPKPAFAPSVKVPEVPKKPEVALQSSLAIKKDVAL 5762


>gi|15828958|ref|NP_326318.1| lipoprotein [Mycoplasma pulmonis UAB CTIP]
 gi|14089901|emb|CAC13660.1| LIPOPROTEIN [Mycoplasma pulmonis]
          Length = 485

 Score = 39.9 bits (91), Expect = 0.24,   Method: Composition-based stats.
 Identities = 22/122 (18%), Positives = 41/122 (33%), Gaps = 4/122 (3%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
           + +Q Q     Q          E +++  +      A P    E  K+      IQP   
Sbjct: 50  NESQKQNGSTQQTQPAQPSTPNESQKQNGSTQQIQPAQPSTPNESQKQNGSTQQIQP--- 106

Query: 145 DVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSV 204
                TP+ S++++ S ++ +  +P  P          Q     +   P E    N S+ 
Sbjct: 107 -AQPSTPNESQKQNGSTQQTQPAQPSNPSESQKQNGSTQQANPAQPSNPNESQKQNNSTK 165

Query: 205 DQ 206
            +
Sbjct: 166 QK 167


>gi|69246511|ref|ZP_00603974.1| Surface protein from Gram-positive cocci, anchor region
           [Enterococcus faecium DO]
 gi|68195241|gb|EAN09695.1| Surface protein from Gram-positive cocci, anchor region
           [Enterococcus faecium DO]
          Length = 429

 Score = 39.9 bits (91), Expect = 0.24,   Method: Composition-based stats.
 Identities = 20/121 (16%), Positives = 37/121 (30%), Gaps = 9/121 (7%)

Query: 88  QAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKE------PIFENSIQP 141
           + + + K +    ++   +++ E       + E  P P  E   E      P  +   +P
Sbjct: 173 KPENENKPEVPPTENPDGEQKPEIEPGEEPDTETQPEPDNESKPEITPGEKPDVDPEEKP 232

Query: 142 KVEDVAFKTPDISREKDVSYKKVRR-RRPLRPRVFPNAKSGNQPVEATET--IVPQELNS 198
            V              + +         P +P V P  K    P   T++      E N 
Sbjct: 233 DVTPEPDTDSGNQTVPETNPDTDNETENPEKPEVAPEEKPDVTPEPDTDSGNQTVPETNP 292

Query: 199 D 199
           D
Sbjct: 293 D 293


>gi|270003533|gb|EEZ99980.1| hypothetical protein TcasGA2_TC002779 [Tribolium castaneum]
          Length = 4141

 Score = 39.9 bits (91), Expect = 0.25,   Method: Composition-based stats.
 Identities = 21/115 (18%), Positives = 37/115 (32%), Gaps = 2/115 (1%)

Query: 97  RDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQ--PKVEDVAFKTPDIS 154
            +E    L +E KE  Q           P  +E  E   E   Q     +    + P+ +
Sbjct: 285 EEETSSKLKEESKETKQVESLPQVEESKPRQKEEPEKRKETGPQVVEDTKSRPKEEPEKN 344

Query: 155 REKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQDCK 209
           +      K   + +P +P+V    +    P     T    +   D    V ++ K
Sbjct: 345 KHVVEESKPTPKEKPQKPKVVEEKQKETCPQVVENTRSKPKEEPDKTKQVVEESK 399



 Score = 36.8 bits (83), Expect = 1.8,   Method: Composition-based stats.
 Identities = 19/128 (14%), Positives = 41/128 (32%), Gaps = 12/128 (9%)

Query: 89  AQIQEKLQRDEQDDLLVKEQKERA------------QNALSEFEASPCPLIEEGKEPIFE 136
            Q +E  +R E    +V++ K R             ++  +  E    P + E K+    
Sbjct: 314 RQKEEPEKRKETGPQVVEDTKSRPKEEPEKNKHVVEESKPTPKEKPQKPKVVEEKQKETC 373

Query: 137 NSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQEL 196
             +         + PD +++     K   +  P +P+     +    P    +T    + 
Sbjct: 374 PQVVENTRSKPKEEPDKTKQVVEESKPRAKEEPQKPKGVEEKQKETCPHVVEDTRSKPKE 433

Query: 197 NSDNASSV 204
             +    V
Sbjct: 434 EPERTKQV 441


>gi|322710065|gb|EFZ01640.1| PX domain-containing protein [Metarhizium anisopliae ARSEF 23]
          Length = 1077

 Score = 39.9 bits (91), Expect = 0.25,   Method: Composition-based stats.
 Identities = 25/135 (18%), Positives = 45/135 (33%), Gaps = 16/135 (11%)

Query: 84  VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSE--FEASPCPLIE------EGKEPIF 135
           +S A  +++  +   ++ + ++    ER Q   +      +P   +E      E  +   
Sbjct: 416 LSRADEELEGAMGEMKRMNAMIARDDERQQRDDTNLDRTDTPNKSVELVSESQETGQKSP 475

Query: 136 ENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRV---FPNAKSGNQPVEAT---- 188
           E   +P V     +          S K      P+ PR     P+ KS  Q         
Sbjct: 476 ETPEEPAVLKGLGEKSSPRGASTDSTKSEAENTPVTPRSGLESPSQKSSPQRSSEQHFTS 535

Query: 189 -ETIVPQELNSDNAS 202
            + IVP   + DN  
Sbjct: 536 FDQIVPPGQSEDNDE 550


>gi|190892819|ref|YP_001979361.1| hypothetical protein RHECIAT_CH0003235 [Rhizobium etli CIAT 652]
 gi|190698098|gb|ACE92183.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 327

 Score = 39.5 bits (90), Expect = 0.26,   Method: Composition-based stats.
 Identities = 16/75 (21%), Positives = 26/75 (34%), Gaps = 3/75 (4%)

Query: 120 EASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAK 179
           +A P P       P+ + +  P  EDV    P    ++  +  +    RP  P+  P   
Sbjct: 36  QAKPEPAETTSPAPLPDKAEPPAPEDVPAPQPKPDAKEPEAPAQD---RPPAPQSEPGKS 92

Query: 180 SGNQPVEATETIVPQ 194
             + P  A     P 
Sbjct: 93  EASTPAPAEPMQGPP 107


>gi|51245282|ref|YP_065166.1| DNA polymerase III, subunit gamma/tau [Desulfotalea psychrophila
           LSv54]
 gi|50876319|emb|CAG36159.1| related to DNA polymerase III, subunit gamma/tau [Desulfotalea
           psychrophila LSv54]
          Length = 334

 Score = 39.5 bits (90), Expect = 0.26,   Method: Composition-based stats.
 Identities = 16/85 (18%), Positives = 26/85 (30%), Gaps = 1/85 (1%)

Query: 112 AQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREK-DVSYKKVRRRRPL 170
           A+   +  +A P     +   P    +  P  +      P            + ++RRP 
Sbjct: 123 AERGEASTKAIPAKPTGQEIAPGKRETSPPPPQKKKEHNPAEEIIPLPEEPPEFQQRRPT 182

Query: 171 RPRVFPNAKSGNQPVEATETIVPQE 195
            PR F        P  A +   P E
Sbjct: 183 APREFQQRTPAAPPTPAKKAPKPAE 207


>gi|196037931|ref|ZP_03105241.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus
           NVH0597-99]
 gi|196031201|gb|EDX69798.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus
           NVH0597-99]
          Length = 601

 Score = 39.5 bits (90), Expect = 0.26,   Method: Composition-based stats.
 Identities = 15/101 (14%), Positives = 38/101 (37%), Gaps = 2/101 (1%)

Query: 100 QDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDV 159
           ++      ++E+ +   ++      P   +  +P  E   +PK +D   + P+    K  
Sbjct: 154 EEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTDDPKQEKPE--EPKTD 211

Query: 160 SYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDN 200
             K+ +  +P +  +   A   N  +  T   + Q+    +
Sbjct: 212 DPKQEKPEQPKQENIQVPAAQVNDAISKTSEKMLQDGIESD 252


>gi|226502360|ref|NP_001141603.1| hypothetical protein LOC100273721 [Zea mays]
 gi|194705244|gb|ACF86706.1| unknown [Zea mays]
          Length = 555

 Score = 39.5 bits (90), Expect = 0.26,   Method: Composition-based stats.
 Identities = 18/108 (16%), Positives = 38/108 (35%), Gaps = 10/108 (9%)

Query: 79  HYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPI---F 135
           HY  ++  A+ +++E   R       +   ++R           P P I+   +P     
Sbjct: 81  HYQSLLDTAEMKLEEAHSR-------LARFRDRKPPPTRSEPKPPTPPIQREHKPSPPPI 133

Query: 136 ENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQ 183
           +  ++P  + +  K P  + +     + V      RP   P    G +
Sbjct: 134 QRDLKPSPQPLIQKAPSPAPQPSARPQLVIPGTSNRPTPRPEPMPGLK 181


>gi|206969369|ref|ZP_03230324.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus
           AH1134]
 gi|206736410|gb|EDZ53568.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus
           AH1134]
          Length = 612

 Score = 39.5 bits (90), Expect = 0.26,   Method: Composition-based stats.
 Identities = 12/90 (13%), Positives = 32/90 (35%)

Query: 92  QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTP 151
           +E      ++      ++E+ +   ++      P   +  +P  E   +PK +    + P
Sbjct: 153 EEPNGGKPEEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTNDPKQEKPEEPKTDGSKQEKP 212

Query: 152 DISREKDVSYKKVRRRRPLRPRVFPNAKSG 181
           D ++  D   ++ ++     P    N    
Sbjct: 213 DGTKTNDEKPEQPKQENIQNPSAQLNEAIS 242


>gi|115702556|ref|XP_797190.2| PREDICTED: similar to signal recognition particle receptor alpha
           subunit (sr-alpha), partial [Strongylocentrotus
           purpuratus]
          Length = 563

 Score = 39.5 bits (90), Expect = 0.26,   Method: Composition-based stats.
 Identities = 22/169 (13%), Positives = 58/169 (34%), Gaps = 22/169 (13%)

Query: 52  ERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQ--IQEKLQRDEQDDLLVKE-- 107
           ++Y    +D + +G  +  +     ++ + R++  A+    + +K ++ +  +   K   
Sbjct: 53  DKY----KDVLRSG-RIFGQ--FDFSDDFQRVLREAEKSSVVAKKGKQMKSFEESHKSKK 105

Query: 108 -------QKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVS 160
                     + +  ++   A      E   +P  + + QP+  D      +        
Sbjct: 106 TVASMIIDPSKEEKNITNKAAKKGNKTESSPQPSKKPAKQPETIDSGSLDEETINRNRE- 164

Query: 161 YKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQDCK 209
            K   R +P +    P  K  ++P + T+      +  +     D D  
Sbjct: 165 -KMFNRNKPKKVEKSP--KVTSKPTKKTKQATTWGMGGNAKDMPDLDWS 210


>gi|206973199|ref|ZP_03234121.1| surface layer domain protein [Bacillus cereus AH1134]
 gi|206732083|gb|EDZ49283.1| surface layer domain protein [Bacillus cereus AH1134]
          Length = 447

 Score = 39.5 bits (90), Expect = 0.27,   Method: Composition-based stats.
 Identities = 25/142 (17%), Positives = 49/142 (34%), Gaps = 27/142 (19%)

Query: 68  VVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLI 127
           V  E + Q        ++  + + + +++ D + +   +E+ E   +   E +    P +
Sbjct: 194 VTREAYSQF---LYNSINAVEKETKPEVKPDPKPETKPEEKPEVKPDPKPETKPEEKPEV 250

Query: 128 EEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEA 187
           +   +P  +   +P+V       PD   E     K         P V P+      P   
Sbjct: 251 KPDPKPETKPEEKPEV------KPDPKPETKPEEK---------PEVKPD------PKPE 289

Query: 188 TETIVPQELNSDNASSVDQDCK 209
           T+  VP      +   V  D K
Sbjct: 290 TKPEVP---EGLDVDLVQPDFK 308


>gi|123452637|ref|XP_001314281.1| RhoGEF domain containing protein [Trichomonas vaginalis G3]
 gi|121896576|gb|EAY01723.1| RhoGEF domain containing protein [Trichomonas vaginalis G3]
          Length = 802

 Score = 39.5 bits (90), Expect = 0.27,   Method: Composition-based stats.
 Identities = 22/118 (18%), Positives = 41/118 (34%), Gaps = 8/118 (6%)

Query: 92  QEKLQRDEQDDLLVKEQKERAQNALSEF---EASPCPLIEEGKEPIFENSIQPKVEDVAF 148
           ++   + E+      E+K   +         E  P P +EE   P  E    PK E+   
Sbjct: 254 EKPAPKAEEKPKSKPEEKTAPKAEEKPTPKVEEKPAPKVEEKPAPKAEEKPAPKAEEKPK 313

Query: 149 KTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQ 206
             P+   EK     + + +  +  +  P A+   +P    E     +     A  V++
Sbjct: 314 SKPE---EKPAPKVEEKPKSKVEEKTAPKAE--EKPAPKAEEKPKSKAEEKPAPKVEE 366



 Score = 36.8 bits (83), Expect = 1.8,   Method: Composition-based stats.
 Identities = 18/88 (20%), Positives = 27/88 (30%), Gaps = 3/88 (3%)

Query: 122 SPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDV---SYKKVRRRRPLRPRVFPNA 178
            P P  EE   P  E    PK E+     P+             KV  +   +    P  
Sbjct: 239 KPAPKPEEKPTPKPEEKPAPKAEEKPKSKPEEKTAPKAEEKPTPKVEEKPAPKVEEKPAP 298

Query: 179 KSGNQPVEATETIVPQELNSDNASSVDQ 206
           K+  +P    E     +     A  V++
Sbjct: 299 KAEEKPAPKAEEKPKSKPEEKPAPKVEE 326


>gi|195439012|ref|XP_002067425.1| GK16191 [Drosophila willistoni]
 gi|194163510|gb|EDW78411.1| GK16191 [Drosophila willistoni]
          Length = 1402

 Score = 39.5 bits (90), Expect = 0.27,   Method: Composition-based stats.
 Identities = 20/111 (18%), Positives = 46/111 (41%), Gaps = 7/111 (6%)

Query: 98   DEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREK 157
            +E  +   ++++E+     +E +  P P  +   EP  E+  QP+++      P    E 
Sbjct: 1145 EEVSNNNNEKEQEQQPAEEAEPQIEPKPEPKPQAEPQRES--QPELQSEPQSEPQ--LEP 1200

Query: 158  DVSYKKVRRRRP-LRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQD 207
                +   +  P L P++ P +++  + +E     VP     +   + + D
Sbjct: 1201 QSEPQSEPQSEPQLEPQLEPQSETQTETLE--NIAVPPAAFGNYHQADETD 1249



 Score = 38.0 bits (86), Expect = 0.94,   Method: Composition-based stats.
 Identities = 20/121 (16%), Positives = 41/121 (33%), Gaps = 3/121 (2%)

Query: 84   VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV 143
            VS    + +++ Q  E+ +  ++ + E    A  + E+ P    E   EP  E   +P+ 
Sbjct: 1147 VSNNNNEKEQEQQPAEEAEPQIEPKPEPKPQAEPQRESQPELQSEPQSEPQLEPQSEPQS 1206

Query: 144  EDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASS 203
            E  +    +   E     +         P   P A       + T+     +   +   S
Sbjct: 1207 EPQSEPQLEPQLEPQSETQTETLENIAVP---PAAFGNYHQADETDDKGDLKQEENTYDS 1263

Query: 204  V 204
            +
Sbjct: 1264 L 1264


>gi|327193494|gb|EGE60389.1| hypothetical protein RHECNPAF_1560022 [Rhizobium etli CNPAF512]
          Length = 326

 Score = 39.5 bits (90), Expect = 0.27,   Method: Composition-based stats.
 Identities = 15/75 (20%), Positives = 25/75 (33%), Gaps = 3/75 (4%)

Query: 120 EASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAK 179
            A P P       P+ + +  P  EDV    P    ++  +  +    RP  P+  P   
Sbjct: 36  RAKPEPAETTSPAPLLDKAEPPAPEDVPAPQPKPDAKEPEAPAQD---RPPAPQSEPEKS 92

Query: 180 SGNQPVEATETIVPQ 194
             ++P        P 
Sbjct: 93  EPSKPAPTEPMQGPP 107


>gi|195328230|ref|XP_002030819.1| GM24368 [Drosophila sechellia]
 gi|194119762|gb|EDW41805.1| GM24368 [Drosophila sechellia]
          Length = 601

 Score = 39.5 bits (90), Expect = 0.27,   Method: Composition-based stats.
 Identities = 21/108 (19%), Positives = 39/108 (36%), Gaps = 4/108 (3%)

Query: 102 DLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSY 161
           D    + +    ++ ++ EA   P+  EG +P  E  +Q   E      P+      +  
Sbjct: 2   DPEAYDDETSTNDSSTDDEAILNPV--EGHQPAVEIDVQRD-EPGENAEPEQPTVPPLIL 58

Query: 162 KKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQDCK 209
                  P  PR     +   Q V + ET  P +     +++ D+  K
Sbjct: 59  VDP-PHMPSPPRNSRRNQGEEQEVISLETPSPPKKRKRISAAADKSLK 105


>gi|316939674|gb|ADU73708.1| cellulosome anchoring protein cohesin region [Clostridium
            thermocellum DSM 1313]
          Length = 1615

 Score = 39.5 bits (90), Expect = 0.27,   Method: Composition-based stats.
 Identities = 22/115 (19%), Positives = 31/115 (26%), Gaps = 2/115 (1%)

Query: 92   QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTP 151
             E    DE          +    + +  E  P     +   P  E +  P  E      P
Sbjct: 1072 DEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPT--PSDEPTPSDEP 1129

Query: 152  DISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQ 206
              S E   S           P   P       P E  E  +P +  SD  +  D+
Sbjct: 1130 TPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDE 1184



 Score = 36.1 bits (81), Expect = 2.9,   Method: Composition-based stats.
 Identities = 17/108 (15%), Positives = 25/108 (23%), Gaps = 4/108 (3%)

Query: 92  QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQ----PKVEDVA 147
            E    DE          E  +  +     S  P   +   P  E +      P  E   
Sbjct: 839 DEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTP 898

Query: 148 FKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQE 195
            +TP+     D    +        P   P       P +        E
Sbjct: 899 SETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPE 946



 Score = 34.9 bits (78), Expect = 7.3,   Method: Composition-based stats.
 Identities = 16/107 (14%), Positives = 24/107 (22%), Gaps = 4/107 (3%)

Query: 92  QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQ----PKVEDVA 147
            E    DE          E  +  +     S  P   +   P  E +      P  E   
Sbjct: 882 DEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTP 941

Query: 148 FKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQ 194
            +TP+     D    +        P   P       P +        
Sbjct: 942 SETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEP 988



 Score = 34.9 bits (78), Expect = 7.3,   Method: Composition-based stats.
 Identities = 16/107 (14%), Positives = 24/107 (22%), Gaps = 4/107 (3%)

Query: 92   QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQ----PKVEDVA 147
             E    DE          E  +  +     S  P   +   P  E +      P  E   
Sbjct: 980  DEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTP 1039

Query: 148  FKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQ 194
             +TP+     D    +        P   P       P +        
Sbjct: 1040 SETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEP 1086


>gi|307130787|ref|YP_003882803.1| DNA-binding membrane protein required for chromosome resolution and
           partitioning [Dickeya dadantii 3937]
 gi|306528316|gb|ADM98246.1| DNA-binding membrane protein required for chromosome resolution and
           partitioning [Dickeya dadantii 3937]
          Length = 1176

 Score = 39.5 bits (90), Expect = 0.28,   Method: Composition-based stats.
 Identities = 24/135 (17%), Positives = 49/135 (36%), Gaps = 9/135 (6%)

Query: 71  ENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASP---CPLI 127
           E++  H E    ++   QAQ+       ++     + + +  Q+  + F A P    P  
Sbjct: 531 ESYPDHEEDEETLL---QAQLARDFADMQRSRYAEERELDTKQDEPAIFAAEPPAVTPAA 587

Query: 128 EEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEA 187
            E ++P  +   +P ++     +P      D     V     L P+     +       A
Sbjct: 588 AETRQPDLKPKTEPPLDSAFAISPFADLVDDGP---VEPLFTLPPQESFPGEPRYVQSPA 644

Query: 188 TETIVPQELNSDNAS 202
            +T+ P E  ++  S
Sbjct: 645 LQTVAPIESEAEAES 659


>gi|67614162|ref|XP_667351.1| formin-related protein [Cryptosporidium hominis TU502]
 gi|54658482|gb|EAL37124.1| formin-related protein [Cryptosporidium hominis]
          Length = 1635

 Score = 39.5 bits (90), Expect = 0.28,   Method: Composition-based stats.
 Identities = 10/33 (30%), Positives = 18/33 (54%)

Query: 51  AERYSVLARDAMSAGDYVVAENHLQHAEHYNRI 83
            E+Y  L  +   +GD V+++ +   A +Y RI
Sbjct: 482 LEKYLSLVNEVYGSGDLVMSDAYSTAASYYFRI 514


>gi|119776443|ref|YP_929183.1| hypothetical protein Sama_3311 [Shewanella amazonensis SB2B]
 gi|119768943|gb|ABM01514.1| conserved hypothetical protein [Shewanella amazonensis SB2B]
          Length = 483

 Score = 39.5 bits (90), Expect = 0.28,   Method: Composition-based stats.
 Identities = 32/177 (18%), Positives = 67/177 (37%), Gaps = 15/177 (8%)

Query: 3   SVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAM 62
           S Q   + R R  +       +  +N   R +++NG   + R       ER         
Sbjct: 312 SQQHNPQVRSRELSQSREQEFKARMNSSERRFENNGNSSRERDVGNSSRERDM-----GH 366

Query: 63  SAGDYVVAE--NHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
            + D  + +  N  + A+   R+ +  + + +E+ Q  ++     + Q+ER Q    + +
Sbjct: 367 QSHDRELRQQLNSRERADSRERMDNRERMESRERSQPQQRGFEQREPQRERQQFQERQRD 426

Query: 121 ASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPN 177
           A P    E+         +Q + +  A       R++   +++ +R RP   R   N
Sbjct: 427 AQPAQPREQQ--------VQRERQREAQHDARQQRQQPREHQQPQRERPQPQRERHN 475


>gi|322696754|gb|EFY88542.1| transcriptional corepressor of histone genes (Hir3) [Metarhizium
           acridum CQMa 102]
          Length = 2167

 Score = 39.5 bits (90), Expect = 0.28,   Method: Composition-based stats.
 Identities = 20/93 (21%), Positives = 32/93 (34%), Gaps = 3/93 (3%)

Query: 112 AQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLR 171
            ++     EA   P+I    EP  E   +PK +      P       V  +  R+     
Sbjct: 336 QEDVKMVTEAEVEPVIAPEPEPEAEKKPEPKPKTEEKVKP-TVEGPPVVRRSTRQGSRAN 394

Query: 172 PRVFPNAKSGNQPVEATE--TIVPQELNSDNAS 202
            +  P+ K  N P    E    +P+E + D   
Sbjct: 395 TKAKPDTKEDNPPNPPKEVPKELPKEPDQDPKE 427


>gi|194466666|ref|ZP_03072653.1| LPXTG-motif cell wall anchor domain protein [Lactobacillus reuteri
            100-23]
 gi|194453702|gb|EDX42599.1| LPXTG-motif cell wall anchor domain protein [Lactobacillus reuteri
            100-23]
          Length = 1877

 Score = 39.5 bits (90), Expect = 0.28,   Method: Composition-based stats.
 Identities = 21/116 (18%), Positives = 38/116 (32%), Gaps = 5/116 (4%)

Query: 87   AQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDV 146
            +Q  +Q   Q   Q      EQ      A    + +  P  +  ++P  + + QP  +  
Sbjct: 1680 SQPTVQPTEQPTSQPTAQPTEQPTSQPTAQPTEQPTSQPTAQPTEQPTSQPTAQPTEQPT 1739

Query: 147  AFKTPDISREKDVSYKKVRRRRPL-----RPRVFPNAKSGNQPVEATETIVPQELN 197
            +  T   + +           +P      +P   P ++S  QP E        E N
Sbjct: 1740 SQPTAQPTEQPTSQPTAQPTEQPTSQPTAQPTEQPTSQSTAQPSEQPTEQPAIESN 1795



 Score = 37.2 bits (84), Expect = 1.6,   Method: Composition-based stats.
 Identities = 19/98 (19%), Positives = 34/98 (34%), Gaps = 4/98 (4%)

Query: 113  QNALSEFEASP--CPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPL 170
            +   S+  A P   P  +   +P  + + QP V+     T   + +           +P 
Sbjct: 1652 EQPTSQPTAQPTEQPTSQPTAQPTEQPTSQPTVQPTEQPTSQPTAQPTEQPTSQPTAQPT 1711

Query: 171  -RPRVFPNAKSGNQP-VEATETIVPQELNSDNASSVDQ 206
             +P   P A+   QP  + T     Q  +   A   +Q
Sbjct: 1712 EQPTSQPTAQPTEQPTSQPTAQPTEQPTSQPTAQPTEQ 1749


>gi|294660559|ref|NP_853383.2| DNA polymerase III subunits gamma and tau [Mycoplasma gallisepticum
           str. R(low)]
 gi|284812222|gb|AAP56951.2| DNA polymerase III subunits gamma and tau [Mycoplasma gallisepticum
           str. R(low)]
 gi|284930879|gb|ADC30818.1| DNA polymerase III subunits gamma and tau [Mycoplasma gallisepticum
           str. R(high)]
          Length = 601

 Score = 39.5 bits (90), Expect = 0.29,   Method: Composition-based stats.
 Identities = 15/91 (16%), Positives = 30/91 (32%), Gaps = 1/91 (1%)

Query: 116 LSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVF 175
               E +P P++    E + +   +   +    +      E     +  +  +  +P   
Sbjct: 349 FDYLEQNPQPVVGNNVEVVIKPKTKTTEQIQEKEEAKPQVEIKQKNENEKVVKVEQPNEQ 408

Query: 176 PNA-KSGNQPVEATETIVPQELNSDNASSVD 205
             A K  + P E TE+      N     S+D
Sbjct: 409 LKAKKVRSLPSEETESSTKSTTNDQLDLSLD 439


>gi|15829122|ref|NP_326482.1| hypothetical protein MYPU_6510 [Mycoplasma pulmonis UAB CTIP]
 gi|14090066|emb|CAC13824.1| predicted coding region [Mycoplasma pulmonis]
          Length = 1272

 Score = 39.5 bits (90), Expect = 0.29,   Method: Composition-based stats.
 Identities = 12/86 (13%), Positives = 28/86 (32%), Gaps = 5/86 (5%)

Query: 103 LLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK 162
               + + +  N+ +  +  P        EP  E   + + +           + D   +
Sbjct: 367 KNDSKDEPKKDNSNTNSKDEPKT-----DEPKVEEPREDEPKTNPMSDSKDKPKIDEPNE 421

Query: 163 KVRRRRPLRPRVFPNAKSGNQPVEAT 188
           K + +    P+  P  K   +P + T
Sbjct: 422 KPKDQPKTEPKNEPKDKPKVEPKDET 447


>gi|293552764|ref|ZP_06673425.1| surface protein [Enterococcus faecium E1039]
 gi|291603073|gb|EFF33264.1| surface protein [Enterococcus faecium E1039]
          Length = 429

 Score = 39.5 bits (90), Expect = 0.29,   Method: Composition-based stats.
 Identities = 19/126 (15%), Positives = 39/126 (30%), Gaps = 10/126 (7%)

Query: 88  QAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKE------PIFENSIQP 141
           + + + K +    ++   +++ E       + E  P P  E   E      P  +   +P
Sbjct: 173 KPENENKPEVPPTENPDGEQKPEIEPGEEPDTETQPEPDNESKPEITPGEKPDVDPEEKP 232

Query: 142 KVEDVAFKTPDISREKDVSYKKVRR-RRPLRPRVFPNAKSGNQPVEATET---IVPQELN 197
            V              + +         P +P V P  K    P   T++    VP+   
Sbjct: 233 DVTPEPDTDSGNQTVPETNPDTDNETENPEKPEVAPEEKPDVIPEPDTDSGNQTVPETNP 292

Query: 198 SDNASS 203
             +  +
Sbjct: 293 DTDNET 298


>gi|228925190|ref|ZP_04088300.1| Surface layer protein [Bacillus thuringiensis serovar huazhongensis
           BGSC 4BD1]
 gi|228834529|gb|EEM80058.1| Surface layer protein [Bacillus thuringiensis serovar huazhongensis
           BGSC 4BD1]
          Length = 441

 Score = 39.5 bits (90), Expect = 0.30,   Method: Composition-based stats.
 Identities = 17/86 (19%), Positives = 34/86 (39%), Gaps = 7/86 (8%)

Query: 114 NALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPR 173
           N+++  E    P ++   +P  +   +P+V       PD   E     K   +  P +P 
Sbjct: 216 NSINAVEKETKPEVKPDPKPETKPEEKPEV------KPDPKPETKPEEKPEVKPDP-KPE 268

Query: 174 VFPNAKSGNQPVEATETIVPQELNSD 199
             P  K   +P    +  +P  ++S+
Sbjct: 269 TKPEEKPEVKPDPKPDVQLPAGMDSN 294


>gi|229199483|ref|ZP_04326144.1| Lpxtg-motif cell wall anchor domain protein [Bacillus cereus m1293]
 gi|228583888|gb|EEK42045.1| Lpxtg-motif cell wall anchor domain protein [Bacillus cereus m1293]
          Length = 2849

 Score = 39.5 bits (90), Expect = 0.30,   Method: Composition-based stats.
 Identities = 15/108 (13%), Positives = 37/108 (34%), Gaps = 2/108 (1%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
           +  Q     +   +EQ +   ++  E  +N+ ++         ++ ++P  E        
Sbjct: 202 AEEQKNGDAQQPTEEQKNSDAQQPTEEQKNSDAQQPTEEQK-NDDAQQPTEEQKNGDNTT 260

Query: 145 DVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIV 192
           +     PD S  K ++   +           P   + N+P   + T +
Sbjct: 261 EQPVDNPDPSP-KQITENILTGVTLTDKDGKPFNDTDNRPSPDSITKI 307


>gi|109511597|ref|XP_001064508.1| PREDICTED: diacylglycerol kinase kappa-like [Rattus norvegicus]
          Length = 1390

 Score = 39.5 bits (90), Expect = 0.30,   Method: Composition-based stats.
 Identities = 20/93 (21%), Positives = 26/93 (27%), Gaps = 6/93 (6%)

Query: 120 EASPCPLIE----EGKEPIFENSIQPKVE-DVAFKTPDISREKDVSYKKVRRRRPLRPRV 174
           EA+P P  E       EP  E   +P  E D     P+   E               P  
Sbjct: 175 EATPEPATERDAKSTPEPALEPDSKPDPEPDSERPDPEPDSE-RAPEPDPEPDSEPAPEP 233

Query: 175 FPNAKSGNQPVEATETIVPQELNSDNASSVDQD 207
            P   S   P  A +  +          + D D
Sbjct: 234 DPEPDSERVPEPAPDPTLELASEPTREPTPDLD 266



 Score = 39.1 bits (89), Expect = 0.38,   Method: Composition-based stats.
 Identities = 13/58 (22%), Positives = 23/58 (39%), Gaps = 2/58 (3%)

Query: 133 PIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATET 190
           P  E + +P  E  A  TP+ + E D            RP   P+++   +P    ++
Sbjct: 172 PCPEATPEPATERDAKSTPEPALEPDSKPDPE--PDSERPDPEPDSERAPEPDPEPDS 227


>gi|321473306|gb|EFX84274.1| hypothetical protein DAPPUDRAFT_223050 [Daphnia pulex]
          Length = 1122

 Score = 39.5 bits (90), Expect = 0.31,   Method: Composition-based stats.
 Identities = 24/135 (17%), Positives = 56/135 (41%), Gaps = 5/135 (3%)

Query: 76  HAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKE--RAQNALSEFEASPCPLIEEGKEP 133
           HAE  + + +  Q ++Q++LQ+DE  D L ++ +E    +  +        P   +   P
Sbjct: 158 HAEFQSELQNDLQDELQDELQQDELQDELQQDLQETPNPEEEIQPEIPPELPPKSQEPFP 217

Query: 134 IFENSIQPKVE---DVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATET 190
           + +  ++P V+     A   PD S     +     + +   P+      +    ++A   
Sbjct: 218 VTDAELEPHVDTPVPEAISGPDESVLPMETQIPEVKTKEQVPKEDEEMHTTTVSLDAVSQ 277

Query: 191 IVPQELNSDNASSVD 205
            + ++    ++S+ D
Sbjct: 278 QLAEDAGDGDSSAND 292


>gi|195590918|ref|XP_002085191.1| GD12443 [Drosophila simulans]
 gi|194197200|gb|EDX10776.1| GD12443 [Drosophila simulans]
          Length = 601

 Score = 39.5 bits (90), Expect = 0.31,   Method: Composition-based stats.
 Identities = 21/108 (19%), Positives = 38/108 (35%), Gaps = 4/108 (3%)

Query: 102 DLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSY 161
           D    + +    ++ ++ EA   P+  EG +P  E  +Q   E      P+         
Sbjct: 2   DPEAYDDETSTNDSFTDDEAIVNPV--EGHQPAVEIEVQRD-EPGENAEPEQPTVPP-PI 57

Query: 162 KKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQDCK 209
                  P  PR     +   Q V + ET  P +     +++ D+  K
Sbjct: 58  LVDPPHLPSPPRNSRRNQGEEQEVISLETPSPPKKRKRISAAADKSLK 105


>gi|195495014|ref|XP_002095087.1| GE22190 [Drosophila yakuba]
 gi|194181188|gb|EDW94799.1| GE22190 [Drosophila yakuba]
          Length = 662

 Score = 39.5 bits (90), Expect = 0.31,   Method: Composition-based stats.
 Identities = 26/150 (17%), Positives = 42/150 (28%), Gaps = 20/150 (13%)

Query: 80  YNRIVSMAQAQIQEKLQRDEQDDLLVK---EQKERAQNALSEFEASPCPLIEEGKEPIFE 136
           Y  I S    +  +   R    D       +  E   +AL           EE   P   
Sbjct: 17  YPEIYSSDSRESDQPAPRRRNSDSDPDVMLQGMENEYDALEPGANEDDSSTEEEAIPNPI 76

Query: 137 NSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFP-----------------NAK 179
              QP +E       +   + D + +         PRV P                   +
Sbjct: 77  EDQQPALEIQVQPDEEAYDQPDENQELEPPEGLQMPRVPPPILVDPPNLPSPPRNSHRNQ 136

Query: 180 SGNQPVEATETIVPQELNSDNASSVDQDCK 209
              Q V + ET  P +     +++ D+  K
Sbjct: 137 GDEQEVISLETPSPPKKRKRLSAAADKSLK 166


>gi|253572643|ref|ZP_04850044.1| transcription termination factor rho [Bacteroides sp. 1_1_6]
 gi|251837775|gb|EES65865.1| transcription termination factor rho [Bacteroides sp. 1_1_6]
          Length = 740

 Score = 39.5 bits (90), Expect = 0.32,   Method: Composition-based stats.
 Identities = 26/124 (20%), Positives = 42/124 (33%), Gaps = 5/124 (4%)

Query: 83  IVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKE--PIFENSIQ 140
           I    +    EKL+ + + D   + +    +       A+    + + KE  P  +   Q
Sbjct: 62  IAGATKKVAAEKLKEERKGDKNKRSRTAAPKKEEKVAPAAKNAEVTKNKENAPAAKPQQQ 121

Query: 141 PKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPN--AKSGNQPVEATETIVPQELNS 198
           PK E           E        +R+   RPR   N   K+ N+ VE  + IV      
Sbjct: 122 PKEEAANKAKEAPVAEPKAEKAAPKRK-VGRPRKDANIAEKAENKEVENAKPIVKPTEEK 180

Query: 199 DNAS 202
             A 
Sbjct: 181 AVAE 184


>gi|224536676|ref|ZP_03677215.1| hypothetical protein BACCELL_01552 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224521767|gb|EEF90872.1| hypothetical protein BACCELL_01552 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 377

 Score = 39.5 bits (90), Expect = 0.32,   Method: Composition-based stats.
 Identities = 9/54 (16%), Positives = 15/54 (27%)

Query: 112 AQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVR 165
            +    E   +P P  EE   P     +QP        +P+    +        
Sbjct: 203 GKREPQESPVTPEPAPEEPASPEPAPEVQPTPVAEPVTSPEPVVVQPEKSPLPE 256


>gi|149639471|ref|XP_001508174.1| PREDICTED: similar to hCG32740 [Ornithorhynchus anatinus]
          Length = 968

 Score = 39.5 bits (90), Expect = 0.33,   Method: Composition-based stats.
 Identities = 25/120 (20%), Positives = 47/120 (39%), Gaps = 11/120 (9%)

Query: 88  QAQIQEKLQRD---EQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
           +A+ ++ L RD    Q     K + ER +N   + ++     IEEG+EP+      P+ +
Sbjct: 786 KAEEEQNLPRDGTASQVKPDAKSESERVENHFQKHKSKMKHHIEEGEEPLKSEGRAPRPK 845

Query: 145 DV---AFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPV-----EATETIVPQEL 196
                     + +R   +  +K  R+R        +AK  +  V     + +    P E 
Sbjct: 846 KSKHPKDAKFEGTRVPHLVKQKRYRKRVREDEKEEDAKKNDDYVLEKLFKKSGNSRPPES 905


>gi|156098207|ref|XP_001615136.1| hypothetical protein [Plasmodium vivax SaI-1]
 gi|148804010|gb|EDL45409.1| hypothetical protein, conserved [Plasmodium vivax]
          Length = 1368

 Score = 39.1 bits (89), Expect = 0.33,   Method: Composition-based stats.
 Identities = 15/111 (13%), Positives = 33/111 (29%), Gaps = 8/111 (7%)

Query: 77  AEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFE 136
           AE   R +  A   ++     D  D+   ++ ++      S     P    E   +    
Sbjct: 589 AEINARCLKAAPGGVEANRSGDRADNTNREDHRDDPAKGDSPSGDLPNHSEEREDKKPLP 648

Query: 137 NSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEA 187
           N   P  +    +     +      K ++R++         +K    P + 
Sbjct: 649 NGRDPTRKRKRDEEDSPDQLPHSDKKDMKRQK--------RSKLTESPNDE 691


>gi|126310615|ref|XP_001376656.1| PREDICTED: similar to midasin [Monodelphis domestica]
          Length = 5694

 Score = 39.1 bits (89), Expect = 0.33,   Method: Composition-based stats.
 Identities = 36/211 (17%), Positives = 74/211 (35%), Gaps = 29/211 (13%)

Query: 2    RSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDA 61
            R+ Q +KR  G   N  +   + ++++  +R  +S         +A+  A +    A +A
Sbjct: 5097 RNTQSFKRKPGHADNERSMGDHSEHVHKRLRTVESTS-------SAEQEASKSQANAEEA 5149

Query: 62   MSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEA 121
                     E+  Q +E Y      AQ       ++ +       EQ+E  ++A  E + 
Sbjct: 5150 D------AFEHIKQGSESY-----DAQTYDVASQEQQQSAQPPSSEQEENTEDASMEIDE 5198

Query: 122  SPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRR-----RRPLRPRVFP 176
                   E    +    ++P+           + E D+  +  +      RRP R     
Sbjct: 5199 Q------EDLRTVDTQELKPEEVKSGASATQGNDETDMETQPTKSEEDQDRRPDRSPSKM 5252

Query: 177  NAKSGNQPVEATETIVPQELNSDNASSVDQD 207
              +   +  E++    PQ L       +++D
Sbjct: 5253 ENEKQERSRESSIHTAPQYLTDSTFQYIEKD 5283


>gi|126649649|ref|XP_001388346.1| formin-related protein [Cryptosporidium parvum Iowa II]
 gi|32398991|emb|CAD98456.1| formin-related protein, possible [Cryptosporidium parvum]
 gi|126117440|gb|EAZ51540.1| formin-related protein, putative [Cryptosporidium parvum Iowa II]
          Length = 1638

 Score = 39.1 bits (89), Expect = 0.33,   Method: Composition-based stats.
 Identities = 10/33 (30%), Positives = 18/33 (54%)

Query: 51  AERYSVLARDAMSAGDYVVAENHLQHAEHYNRI 83
            E+Y  L  +   +GD V+++ +   A +Y RI
Sbjct: 478 LEKYLSLVNEVYGSGDLVMSDAYSTAASYYFRI 510


>gi|71666455|ref|XP_820186.1| trans-sialidase [Trypanosoma cruzi strain CL Brener]
 gi|70885521|gb|EAN98335.1| trans-sialidase, putative [Trypanosoma cruzi]
          Length = 1133

 Score = 39.1 bits (89), Expect = 0.34,   Method: Composition-based stats.
 Identities = 16/104 (15%), Positives = 28/104 (26%), Gaps = 7/104 (6%)

Query: 107  EQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK---- 162
            +  E      +  E  P        +P    S +PK  +     P  +  K    K    
Sbjct: 928  KSAEPKPAEPNSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEP 987

Query: 163  ---KVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASS 203
               + +   P      P      +P  A       +    NA++
Sbjct: 988  KSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPNAAT 1031



 Score = 36.8 bits (83), Expect = 1.7,   Method: Composition-based stats.
 Identities = 18/123 (14%), Positives = 31/123 (25%), Gaps = 9/123 (7%)

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIE--EGKEPIFENSIQPKVEDV 146
              + K    +  +    E K           A P P        +P    S +PK  + 
Sbjct: 818 KSAEPKPAEPKSAEPKPAESKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEP 877

Query: 147 AFKTPDISREKDVSYK-------KVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSD 199
               P  +  K    K       + +   P      P      +P  A       +    
Sbjct: 878 KSAEPKPAESKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEP 937

Query: 200 NAS 202
           N++
Sbjct: 938 NSA 940



 Score = 36.4 bits (82), Expect = 2.4,   Method: Composition-based stats.
 Identities = 14/103 (13%), Positives = 25/103 (24%), Gaps = 7/103 (6%)

Query: 107 EQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK---- 162
           +  E         E  P        +P    S +PK  +     P  +  K    K    
Sbjct: 788 KSAEPKPAEPKSAEPKPAEPKSAEPKPAESKSAEPKPAEPKSAEPKPAESKSAEPKPAEP 847

Query: 163 ---KVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
              + +   P      P      +P  A       +     ++
Sbjct: 848 KSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAESKSA 890



 Score = 36.4 bits (82), Expect = 2.4,   Method: Composition-based stats.
 Identities = 14/103 (13%), Positives = 25/103 (24%), Gaps = 7/103 (6%)

Query: 107 EQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK---- 162
           +  E         E  P        +P    S +PK  +     P  +  K    K    
Sbjct: 798 KSAEPKPAEPKSAEPKPAESKSAEPKPAEPKSAEPKPAESKSAEPKPAEPKSAEPKPAEP 857

Query: 163 ---KVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
              + +   P      P      +P  A       +     ++
Sbjct: 858 KSAEPKPAEPKSAEPKPAEPKSAEPKPAESKSAGPKPAEPKSA 900



 Score = 36.4 bits (82), Expect = 2.6,   Method: Composition-based stats.
 Identities = 14/103 (13%), Positives = 25/103 (24%), Gaps = 7/103 (6%)

Query: 107  EQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK---- 162
            +  E         E  P        +P    S +PK  +     P  +  K    K    
Sbjct: 918  KSAEPKPAEPKSAEPKPAEPNSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEP 977

Query: 163  ---KVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
               + +   P      P      +P  A       +     ++
Sbjct: 978  KSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSA 1020



 Score = 36.4 bits (82), Expect = 2.7,   Method: Composition-based stats.
 Identities = 14/103 (13%), Positives = 25/103 (24%), Gaps = 7/103 (6%)

Query: 107 EQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK---- 162
           +  E         E  P        +P    S +PK  +     P  +  K    K    
Sbjct: 778 KSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAESKSAEPKPAEPKSAEPKPAES 837

Query: 163 ---KVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
              + +   P      P      +P  A       +     ++
Sbjct: 838 KSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSA 880



 Score = 36.1 bits (81), Expect = 2.8,   Method: Composition-based stats.
 Identities = 15/103 (14%), Positives = 26/103 (25%), Gaps = 7/103 (6%)

Query: 107  EQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK---- 162
            +  E         E  P        +P   NS +PK  +     P  +  K    K    
Sbjct: 908  KSAEPKPAEPKSAEPKPAEPKSAEPKPAEPNSAEPKPAEPKSAEPKPAEPKSAEPKPAEP 967

Query: 163  ---KVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
               + +   P      P      +P  A       +     ++
Sbjct: 968  KSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSA 1010



 Score = 36.1 bits (81), Expect = 3.7,   Method: Composition-based stats.
 Identities = 17/116 (14%), Positives = 28/116 (24%), Gaps = 5/116 (4%)

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
              + K    +  +    E K           A P P   +  EP      +PK  +   
Sbjct: 798 KSAEPKPAEPKSAEPKPAESKSAEPKPAEPKSAEPKPAESKSAEP---KPAEPKSAEPKP 854

Query: 149 KTPDISREKDVSYKK--VRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
             P  +  K    K    +   P      P       P  A       +     ++
Sbjct: 855 AEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAESKSAGPKPAEPKSAEPKPAEPKSA 910



 Score = 35.3 bits (79), Expect = 5.2,   Method: Composition-based stats.
 Identities = 15/103 (14%), Positives = 26/103 (25%), Gaps = 7/103 (6%)

Query: 107 EQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK---- 162
           +  E         E  P      G +P    S +PK  +     P  +  K    K    
Sbjct: 868 KSAEPKPAEPKSAEPKPAESKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEP 927

Query: 163 ---KVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
              + +   P      P      +P  A       +     ++
Sbjct: 928 KSAEPKPAEPNSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSA 970



 Score = 34.9 bits (78), Expect = 6.8,   Method: Composition-based stats.
 Identities = 16/123 (13%), Positives = 29/123 (23%), Gaps = 9/123 (7%)

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIE--EGKEPIFENSIQPKVEDV 146
              + K    +  +    E K           A P P        +P    S +PK  + 
Sbjct: 868 KSAEPKPAEPKSAEPKPAESKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEP 927

Query: 147 AFKTPDISREKDVSYK-------KVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSD 199
               P  +       K       + +   P      P      +P  A       +    
Sbjct: 928 KSAEPKPAEPNSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEP 987

Query: 200 NAS 202
            ++
Sbjct: 988 KSA 990



 Score = 34.9 bits (78), Expect = 7.1,   Method: Composition-based stats.
 Identities = 14/103 (13%), Positives = 25/103 (24%), Gaps = 7/103 (6%)

Query: 107  EQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK---- 162
            +  E         E  P        +P    S +PK  +     P  +  K    K    
Sbjct: 898  KSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPNSAEPKPAEPKSAEPKPAEP 957

Query: 163  ---KVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
               + +   P      P      +P  A       +     ++
Sbjct: 958  KSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSA 1000



 Score = 34.5 bits (77), Expect = 9.0,   Method: Composition-based stats.
 Identities = 18/102 (17%), Positives = 28/102 (27%), Gaps = 5/102 (4%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
               + K    +  +    E K           A P P   +  EP      +PK  +   
Sbjct: 948  KSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEP---KPAEPKSAEPKP 1004

Query: 149  KTPDISREKDVSYKK--VRRRRPLRPRVFPNAKSGNQPVEAT 188
              P  +  K    K    +   P          + +QP  AT
Sbjct: 1005 AEPKSAEPKPAEPKSAEPKPAEPNAATSSAREGTADQPASAT 1046


>gi|228974650|ref|ZP_04135216.1| Cell surface protein [Bacillus thuringiensis serovar thuringiensis
           str. T01001]
 gi|228981244|ref|ZP_04141544.1| Cell surface protein [Bacillus thuringiensis Bt407]
 gi|228778444|gb|EEM26711.1| Cell surface protein [Bacillus thuringiensis Bt407]
 gi|228785053|gb|EEM33066.1| Cell surface protein [Bacillus thuringiensis serovar thuringiensis
           str. T01001]
          Length = 896

 Score = 39.1 bits (89), Expect = 0.34,   Method: Composition-based stats.
 Identities = 14/76 (18%), Positives = 28/76 (36%), Gaps = 2/76 (2%)

Query: 99  EQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSI--QPKVEDVAFKTPDISRE 156
           EQD L   + +E+           P     E ++P  E     +P+VE    + P+  + 
Sbjct: 300 EQDKLEQIKNEEKQPEVEKPEAEKPEVEKPEAEKPEVEKPEVEKPEVEKPEVEKPEAEKP 359

Query: 157 KDVSYKKVRRRRPLRP 172
           +    +  +     +P
Sbjct: 360 EVEKPEAEKPDENKKP 375


>gi|149277309|ref|ZP_01883451.1| translation initiation factor IF-2 [Pedobacter sp. BAL39]
 gi|149232186|gb|EDM37563.1| translation initiation factor IF-2 [Pedobacter sp. BAL39]
          Length = 1013

 Score = 39.1 bits (89), Expect = 0.34,   Method: Composition-based stats.
 Identities = 44/190 (23%), Positives = 63/190 (33%), Gaps = 41/190 (21%)

Query: 52  ERYSVLARDAMSAGDYVVAENHLQHAEHYNRI----VSMAQAQIQEKLQRDEQDDLLVKE 107
           + Y+ L ++    GD +V E   Q      R     V+   A+  +K    E + +LVK 
Sbjct: 45  DMYNALLKEFQ--GDKIVKEEANQIVIGKIRRDEPEVTDKVAEAPKKNVDFENEGILVKN 102

Query: 108 QKERAQNALSEFE---ASPCPLIEEGKE----PIF---------------------ENSI 139
                  A    E   A P P +EE  E    P                       E   
Sbjct: 103 LHSYTPPAEKPKEEQVAKPAPAVEEKAEEGALPGVKIIGKINLDELNSKTRPVKKEEAPE 162

Query: 140 QPKVEDVAFKTPDIS-------REKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIV 192
            PKVE    +TP  +        EK V       +  ++P   P A+   QPVE   T  
Sbjct: 163 APKVETPQAETPAAAPVQAERQEEKPVEKPVEAPKEVIKPVEQPKAEETPQPVEQPITKA 222

Query: 193 PQELNSDNAS 202
           P+   +  A 
Sbjct: 223 PEVKETPKAE 232


>gi|194889047|ref|XP_001977012.1| GG18469 [Drosophila erecta]
 gi|190648661|gb|EDV45939.1| GG18469 [Drosophila erecta]
          Length = 1169

 Score = 39.1 bits (89), Expect = 0.34,   Method: Composition-based stats.
 Identities = 17/111 (15%), Positives = 42/111 (37%), Gaps = 2/111 (1%)

Query: 86  MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVED 145
             QA+I+ + + + Q +   + + E      +     P P +E   E   E+  +P+ + 
Sbjct: 281 EPQAEIEAQPEVESQPEAESQPEAESQPEVEAHPAVEPQPEVESQPEA--ESQSEPETQP 338

Query: 146 VAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQEL 196
                P++    +   +     +P +       K  +  V+ T+  + + L
Sbjct: 339 EVEAQPEVDALPEPESQPEAESQPEKEPEVEAEKISDNEVDTTDASLMETL 389



 Score = 39.1 bits (89), Expect = 0.39,   Method: Composition-based stats.
 Identities = 19/107 (17%), Positives = 40/107 (37%), Gaps = 3/107 (2%)

Query: 86  MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVED 145
            AQ +I+ + + + Q ++  + + E      S+ EA   P  E   E     +++P+ E 
Sbjct: 263 EAQPEIEAQPELEPQLEVEPQAEIEAQPEVESQPEAESQPEAESQPEVEAHPAVEPQPEV 322

Query: 146 VAFKTPDISREKDVSYKKVRRRRPLR---PRVFPNAKSGNQPVEATE 189
            +    +   E +   +   +        P   P A+S  +     E
Sbjct: 323 ESQPEAESQSEPETQPEVEAQPEVDALPEPESQPEAESQPEKEPEVE 369



 Score = 36.8 bits (83), Expect = 1.7,   Method: Composition-based stats.
 Identities = 21/118 (17%), Positives = 41/118 (34%), Gaps = 8/118 (6%)

Query: 92  QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGK----EPIFENSIQPKVEDVA 147
           +E   + EQ      + +   + A  + E    P IE       +P  E  ++ + +   
Sbjct: 227 EESETQPEQVQPEEPQSESEGEQAEKKPEIEAQPEIEAQPEIEAQPELEPQLEVEPQAEI 286

Query: 148 FKTPDISREKDVSYKKVRRRRP---LRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
              P++  + +   +     +P     P V P  +  +QP EA     P+      A 
Sbjct: 287 EAQPEVESQPEAESQPEAESQPEVEAHPAVEPQPEVESQP-EAESQSEPETQPEVEAQ 343



 Score = 36.1 bits (81), Expect = 3.1,   Method: Composition-based stats.
 Identities = 22/126 (17%), Positives = 44/126 (34%), Gaps = 10/126 (7%)

Query: 86  MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVED 145
            AQ +I+ + + + Q +L  + + E      ++ E    P  E       E   QP+VE 
Sbjct: 257 EAQPEIEAQPEIEAQPELEPQLEVEPQAEIEAQPEVESQPEAESQP----EAESQPEVEA 312

Query: 146 VAFKTPDISREKDVSYKKVRRRRP-LRPRVFPNAKSGNQPVEATE---TIVPQELNSDNA 201
                P    E +   +   +  P  +P V    +    P   ++      P++     A
Sbjct: 313 HPAVEPQP--EVESQPEAESQSEPETQPEVEAQPEVDALPEPESQPEAESQPEKEPEVEA 370

Query: 202 SSVDQD 207
             +  +
Sbjct: 371 EKISDN 376


>gi|115252921|emb|CAJ66789.1| putative cell-wall anchored surface adhesin [Streptococcus
           agalactiae]
 gi|115252929|emb|CAJ66793.1| putative cell-wall anchored surface adhesin [Streptococcus
           agalactiae]
 gi|115252933|emb|CAJ66795.1| putative cell-wall anchored surface adhesin [Streptococcus
           agalactiae]
 gi|115252939|emb|CAJ66798.1| putative cell-wall anchored surface adhesin [Streptococcus
           agalactiae]
 gi|115252943|emb|CAJ66800.1| putative cell-wall anchored surface adhesin [Streptococcus
           agalactiae]
 gi|115252957|emb|CAJ66807.1| putative cell-wall anchored surface adhesin [Streptococcus
           agalactiae]
 gi|255961183|gb|ACU44467.1| BibA [Streptococcus agalactiae]
 gi|255961189|gb|ACU44470.1| BibA [Streptococcus agalactiae]
          Length = 752

 Score = 39.1 bits (89), Expect = 0.34,   Method: Composition-based stats.
 Identities = 21/154 (13%), Positives = 56/154 (36%), Gaps = 10/154 (6%)

Query: 49  HIAERYSVL---------ARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDE 99
            + ++Y  +         A D +  G ++  +   Q A      +   + + ++  + + 
Sbjct: 546 QVKDKYVDILAVQKAVDQAYDHVEEGKFITTDQANQLANKLRDALQSLELKDKKVAKPEA 605

Query: 100 QDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDV 159
           + ++  + + +   +   + +    P  +   +P  +  I+P V+  A        + DV
Sbjct: 606 KPEVKPEAKPDVKPDVKPDVKPEVKPEAKPEAKPEAKPEIKPDVKPEARPEAKPEVKPDV 665

Query: 160 SYKKVRRRRP-LRPRVFPNAKSGNQPVEATETIV 192
             +     +P ++P V P AK   +P        
Sbjct: 666 KPEAKPEAKPEVKPDVKPEAKPEAKPATKKSVNT 699



 Score = 37.2 bits (84), Expect = 1.6,   Method: Composition-based stats.
 Identities = 22/124 (17%), Positives = 41/124 (33%), Gaps = 14/124 (11%)

Query: 93  EKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGK--EPIFENSIQPKVEDVAFKT 150
           ++  +         +  E     +++ EA P    E     +P  +  ++P+V+  A   
Sbjct: 577 DQANQLANKLRDALQSLELKDKKVAKPEAKPEVKPEAKPDVKPDVKPDVKPEVKPEAKPE 636

Query: 151 PDISREKDVSYKKVRRRRP---------LRPRVFPNAKSGNQP---VEATETIVPQELNS 198
                + ++        RP         ++P   P AK   +P    EA     P    S
Sbjct: 637 AKPEAKPEIKPDVKPEARPEAKPEVKPDVKPEAKPEAKPEVKPDVKPEAKPEAKPATKKS 696

Query: 199 DNAS 202
            N S
Sbjct: 697 VNTS 700


>gi|29347005|ref|NP_810508.1| transcription termination factor Rho [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|29338903|gb|AAO76702.1| transcription termination factor rho [Bacteroides thetaiotaomicron
           VPI-5482]
          Length = 722

 Score = 39.1 bits (89), Expect = 0.34,   Method: Composition-based stats.
 Identities = 26/124 (20%), Positives = 42/124 (33%), Gaps = 5/124 (4%)

Query: 83  IVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKE--PIFENSIQ 140
           I    +    EKL+ + + D   + +    +       A+    + + KE  P  +   Q
Sbjct: 45  IAGATKKVAAEKLKEERKGDKNKRSRTAAPKKEEKVAPAAKNAEVTKNKENAPAAKPQQQ 104

Query: 141 PKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPN--AKSGNQPVEATETIVPQELNS 198
           PK E           E        +R+   RPR   N   K+ N+ VE  + IV      
Sbjct: 105 PKEEAANKAKEAPVAEPKAEKAAPKRK-VGRPRKDANIAEKAENKEVENAKPIVKPTEEK 163

Query: 199 DNAS 202
             A 
Sbjct: 164 AVAE 167


>gi|228940367|ref|ZP_04102938.1| LPXTG-motif cell wall anchor domain protein [Bacillus thuringiensis
           serovar berliner ATCC 10792]
 gi|228973284|ref|ZP_04133873.1| LPXTG-motif cell wall anchor domain protein [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228786480|gb|EEM34470.1| LPXTG-motif cell wall anchor domain protein [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228819493|gb|EEM65547.1| LPXTG-motif cell wall anchor domain protein [Bacillus thuringiensis
           serovar berliner ATCC 10792]
          Length = 612

 Score = 39.1 bits (89), Expect = 0.35,   Method: Composition-based stats.
 Identities = 12/90 (13%), Positives = 32/90 (35%)

Query: 92  QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTP 151
           +E      ++      ++E+ +   ++      P   +  +P  E   +PK +    + P
Sbjct: 153 EEPNGGKPEEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTNDPKQEKPEEPKTDGSKQEKP 212

Query: 152 DISREKDVSYKKVRRRRPLRPRVFPNAKSG 181
           D ++  D   ++ ++     P    N    
Sbjct: 213 DGTKTNDEKPEQPKQENIQDPSAQLNEAIS 242


>gi|229092275|ref|ZP_04223450.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus
           Rock3-42]
 gi|228691092|gb|EEL44858.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus
           Rock3-42]
          Length = 589

 Score = 39.1 bits (89), Expect = 0.35,   Method: Composition-based stats.
 Identities = 15/101 (14%), Positives = 38/101 (37%), Gaps = 2/101 (1%)

Query: 100 QDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDV 159
           ++      ++E+ +   ++      P   +  +P  E   +PK +D   + P+    K  
Sbjct: 142 EEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTDDPKQEKPE--EPKTD 199

Query: 160 SYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDN 200
             K+ +  +P +  +   A   N  +  T   + Q+    +
Sbjct: 200 DPKQEKPEQPKQENIQVPAAQVNDAISKTSEKMLQDGIESD 240


>gi|194750624|ref|XP_001957630.1| GF10504 [Drosophila ananassae]
 gi|190624912|gb|EDV40436.1| GF10504 [Drosophila ananassae]
          Length = 763

 Score = 39.1 bits (89), Expect = 0.35,   Method: Composition-based stats.
 Identities = 20/110 (18%), Positives = 37/110 (33%), Gaps = 8/110 (7%)

Query: 80  YNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSI 139
           YNR    A+  + ++ Q     +    + +E   +     E  P P +E   EP  E++ 
Sbjct: 164 YNR-EDEAEPSVNQEGQEGGPVEEDSNDNQEVPVDEQVPQE-EPQPPMEAQAEPSIEDAA 221

Query: 140 QPKVEDVAFKTPDISREK-----DVSYKKVRRRRPLRPRVFPNAKSGNQP 184
            P+           ++E      D      +R+R             N+P
Sbjct: 222 -PRPSPPRISRRSQAQEPVVISLDSPSPPKKRKRVSSANTSLKKSPENKP 270



 Score = 36.4 bits (82), Expect = 2.4,   Method: Composition-based stats.
 Identities = 21/119 (17%), Positives = 42/119 (35%), Gaps = 24/119 (20%)

Query: 82  RIVSMAQAQIQEKLQR-DEQDDLLVKEQKERAQNALSEFEASPCPLIE----EGKEPIFE 136
           R+       ++ +  R DE +  + +E +E         +    P+ E    E  +P  E
Sbjct: 151 RVARALNEMVEPRYNREDEAEPSVNQEGQEGGPVEEDSNDNQEVPVDEQVPQEEPQPPME 210

Query: 137 NSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQE 195
              +P +ED A                    RP  PR+   +++    V + ++  P +
Sbjct: 211 AQAEPSIEDAA-------------------PRPSPPRISRRSQAQEPVVISLDSPSPPK 250


>gi|157120255|ref|XP_001653573.1| hypothetical protein AaeL_AAEL001570 [Aedes aegypti]
 gi|108883086|gb|EAT47311.1| conserved hypothetical protein [Aedes aegypti]
          Length = 1215

 Score = 39.1 bits (89), Expect = 0.35,   Method: Composition-based stats.
 Identities = 12/75 (16%), Positives = 23/75 (30%), Gaps = 8/75 (10%)

Query: 126 LIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK--KVRRRRPLRPRVFPNAKSGNQ 183
                 EP      +P+ +      P+   E     K    ++  P  PR   N      
Sbjct: 434 PPASEPEPESSPKAEPEPKSEPASEPEPKAETTAKPKPAAQKKANPWTPRHDFN------ 487

Query: 184 PVEATETIVPQELNS 198
           P++ T+ ++      
Sbjct: 488 PMDCTDIVIGTARGE 502


>gi|229070768|ref|ZP_04203997.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus
           F65185]
 gi|229080534|ref|ZP_04213055.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus
           Rock4-2]
 gi|228702836|gb|EEL55301.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus
           Rock4-2]
 gi|228712347|gb|EEL64293.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus
           F65185]
          Length = 612

 Score = 39.1 bits (89), Expect = 0.35,   Method: Composition-based stats.
 Identities = 12/90 (13%), Positives = 32/90 (35%)

Query: 92  QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTP 151
           +E      ++      ++E+ +   ++      P   +  +P  E   +PK +    + P
Sbjct: 153 EEPNGGKPEEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTNDPKQEKPEEPKTDGSKQEKP 212

Query: 152 DISREKDVSYKKVRRRRPLRPRVFPNAKSG 181
           D ++  D   ++ ++     P    N    
Sbjct: 213 DGTKTNDEKPEQPKQENIQDPSAQLNEAIS 242


>gi|195426379|ref|XP_002061312.1| GK20794 [Drosophila willistoni]
 gi|194157397|gb|EDW72298.1| GK20794 [Drosophila willistoni]
          Length = 1416

 Score = 39.1 bits (89), Expect = 0.35,   Method: Composition-based stats.
 Identities = 15/80 (18%), Positives = 23/80 (28%), Gaps = 9/80 (11%)

Query: 118 EFEASPCPL--IEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVF 175
           E  ++P P    E   EP  E   +P+ +      P    E               P+  
Sbjct: 336 EAGSAPEPSSEPESKSEPSSEPKSEPETKSEPSSEPKSEPETKSEPSSE-------PKSE 388

Query: 176 PNAKSGNQPVEATETIVPQE 195
           P  KS       +E     +
Sbjct: 389 PETKSEPSSEPKSEPSAEPK 408



 Score = 36.4 bits (82), Expect = 2.3,   Method: Composition-based stats.
 Identities = 13/74 (17%), Positives = 27/74 (36%), Gaps = 1/74 (1%)

Query: 125 PLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKS-GNQ 183
               E K      + +P+ E  A  +P+   E + S  +      ++    P ++   + 
Sbjct: 584 KTSPEPKSEPESAAPEPEPEASATTSPEPKSEPESSAPEPEPEASVKNSPEPKSEPKSSA 643

Query: 184 PVEATETIVPQELN 197
           P    E+ V +  N
Sbjct: 644 PEPEPESSVKKSAN 657



 Score = 36.4 bits (82), Expect = 2.7,   Method: Composition-based stats.
 Identities = 11/58 (18%), Positives = 17/58 (29%)

Query: 114 NALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLR 171
            + SE  + P    E   EP  E   +P+ +      P    E         +  P  
Sbjct: 348 ESKSEPSSEPKSEPETKSEPSSEPKSEPETKSEPSSEPKSEPETKSEPSSEPKSEPSA 405



 Score = 34.5 bits (77), Expect = 9.4,   Method: Composition-based stats.
 Identities = 15/101 (14%), Positives = 31/101 (30%), Gaps = 14/101 (13%)

Query: 112 AQNALSEFEASPCPLIE-------EGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKV 164
            +       A+P P  E       E K     ++ +P+ E     +P+   E   S  + 
Sbjct: 587 PEPKSEPESAAPEPEPEASATTSPEPKSEPESSAPEPEPEASVKNSPEPKSEPKSSAPEP 646

Query: 165 RRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVD 205
                ++       KS N      +  +       + + +D
Sbjct: 647 EPESSVK-------KSANLEAPERKLKLNPYTPRHDFNPMD 680


>gi|154417279|ref|XP_001581660.1| Kelch motif family protein [Trichomonas vaginalis G3]
 gi|121915889|gb|EAY20674.1| Kelch motif family protein [Trichomonas vaginalis G3]
          Length = 1453

 Score = 39.1 bits (89), Expect = 0.35,   Method: Composition-based stats.
 Identities = 21/112 (18%), Positives = 44/112 (39%), Gaps = 9/112 (8%)

Query: 86   MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSE--FEASPCPLIEEGKEPIFENSIQPKV 143
              Q   + + ++DEQ ++ V  +  + +    E    A   P  E  K  I +   +PK 
Sbjct: 1067 EPQKPEEPQQKQDEQIEVPVPVKPPQPEEEKEEIVVPAKEEPKQEPPKVEIPQKPEEPKP 1126

Query: 144  EDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQE 195
            + V    P   +E+     K  ++  ++P++        +P    E   P++
Sbjct: 1127 QPVKTPEPAPVKEQPKEEPKPAKQEEIKPKL-------PEPAPKQEPEPPKQ 1171


>gi|228950012|ref|ZP_04112200.1| Surface layer protein [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228809659|gb|EEM56092.1| Surface layer protein [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
          Length = 427

 Score = 39.1 bits (89), Expect = 0.36,   Method: Composition-based stats.
 Identities = 18/92 (19%), Positives = 33/92 (35%), Gaps = 11/92 (11%)

Query: 109 KERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDV--AFKTPDISREKDVSYKKVRR 166
               +   S+F  +    +E+  +P  +   +P+ +        PD   E     K    
Sbjct: 196 AHVTREQYSQFLYNSINAVEKETKPEVKPDPKPETKPEEKPEVKPDPKPETKPEEK---- 251

Query: 167 RRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
                P V P+ K   +P E  +  +P EL+ 
Sbjct: 252 -----PEVKPDPKPETKPEEKPDQKLPVELDG 278


>gi|290993723|ref|XP_002679482.1| rasGEF domain-containing protein [Naegleria gruberi]
 gi|284093099|gb|EFC46738.1| rasGEF domain-containing protein [Naegleria gruberi]
          Length = 2140

 Score = 39.1 bits (89), Expect = 0.36,   Method: Composition-based stats.
 Identities = 22/112 (19%), Positives = 44/112 (39%), Gaps = 11/112 (9%)

Query: 109  KERAQNALSEFEASPCPLIEEG-KEPIFEN-------SIQPKVEDVAFKTPD---ISREK 157
            ++  +   +       P   +   +P  E          Q + ++    TP+    S+E 
Sbjct: 1093 RKSKEVEPTPTALHTAPTNAKKIAQPGEEGFNLIEYLKAQQEQQEQTQHTPEVAIPSKED 1152

Query: 158  DVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQDCK 209
                +K++RR  L  R+F   KS +Q  E + T    E N+ ++ +V +   
Sbjct: 1153 KSKNEKIKRRMSLTDRLFNRNKSLDQSSEESNTSPVAEANNSSSGAVRKSIT 1204


>gi|255937039|ref|XP_002559546.1| Pc13g11280 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211584166|emb|CAP92197.1| Pc13g11280 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 1310

 Score = 39.1 bits (89), Expect = 0.36,   Method: Composition-based stats.
 Identities = 18/99 (18%), Positives = 36/99 (36%), Gaps = 7/99 (7%)

Query: 106 KEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVED-VAFKTPDISREKDVSYKKV 164
            + +   Q A++  + +  P   E  +P F  + QP          P  +    +S    
Sbjct: 572 AKSRSALQEAIAARKRAQMPSRPESAQPTFAEAKQPAPSSKSTRSVPTGAPLSSLSSA-- 629

Query: 165 RRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASS 203
               P+RP + P     ++P  A       E  + ++S+
Sbjct: 630 ----PVRPGMKPRRAEISRPATADPYARRPESRAQSSST 664


>gi|60682521|ref|YP_212665.1| transcription termination factor Rho [Bacteroides fragilis NCTC
           9343]
 gi|60493955|emb|CAH08747.1| putative transcription termination factor [Bacteroides fragilis
           NCTC 9343]
          Length = 688

 Score = 39.1 bits (89), Expect = 0.36,   Method: Composition-based stats.
 Identities = 14/79 (17%), Positives = 28/79 (35%), Gaps = 2/79 (2%)

Query: 113 QNALSEFEASPCPLIEEGKEP-IFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLR 171
           +N       +  P  +   +P   E + +   E  A      +    V+     +++P R
Sbjct: 86  KNGEVTKTDAKTPAAKTQPQPKTTEPTPETAKEANAETNATPAESVKVTPYATPKKKPGR 145

Query: 172 PRVFPNAKSGNQPVEATET 190
           PR     ++  +P E T  
Sbjct: 146 PR-KNQVETEAKPAEETTE 163


>gi|167533469|ref|XP_001748414.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163773226|gb|EDQ86869.1| predicted protein [Monosiga brevicollis MX1]
          Length = 414

 Score = 39.1 bits (89), Expect = 0.36,   Method: Composition-based stats.
 Identities = 21/115 (18%), Positives = 33/115 (28%), Gaps = 1/115 (0%)

Query: 94  KLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDI 153
           +L R       +    E  Q+        P P      EP+ +    P       ++P  
Sbjct: 39  RLHRHRNVSEPIAAPVEPRQSTDKPRRQPPTPNPAPSAEPLVKEPAGPSPTPQGAQSPRQ 98

Query: 154 SREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVP-QELNSDNASSVDQD 207
           +     S   +R      PR     KS N  +       P  E       ++D D
Sbjct: 99  ASPTPASPHVLRDTARPLPRQLRQLKSSNNLLSTPVEAPPELESKGLPMPTLDPD 153


>gi|115497086|ref|NP_001068755.1| cortactin [Bos taurus]
 gi|92096756|gb|AAI14762.1| Cortactin [Bos taurus]
 gi|296471420|gb|DAA13535.1| cortactin [Bos taurus]
          Length = 538

 Score = 39.1 bits (89), Expect = 0.37,   Method: Composition-based stats.
 Identities = 19/97 (19%), Positives = 42/97 (43%), Gaps = 2/97 (2%)

Query: 58  ARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVK-EQKERAQNAL 116
           A ++ ++      EN  +  E  +R  + A+   +   +R EQ+    + +++ RAQ   
Sbjct: 342 AVNSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAQERQEQEAARRQLDEQARAQKPT 401

Query: 117 SEFEASPCPLIEEGK-EPIFENSIQPKVEDVAFKTPD 152
                +P P  E     P++E++   + E    + P+
Sbjct: 402 PPASPTPQPAQERPPSSPVYEDAAPFRAEPSPSREPE 438


>gi|71404706|ref|XP_805038.1| trans-sialidase [Trypanosoma cruzi strain CL Brener]
 gi|70868284|gb|EAN83187.1| trans-sialidase, putative [Trypanosoma cruzi]
          Length = 927

 Score = 39.1 bits (89), Expect = 0.37,   Method: Composition-based stats.
 Identities = 14/79 (17%), Positives = 27/79 (34%), Gaps = 3/79 (3%)

Query: 125 PLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQP 184
           P       P    S +PK  +   + P  +       ++ +   P          + +QP
Sbjct: 746 PSGGAPPTPAEPKSEEPKPAESRPEEPKPAE---SESEEPKPAEPNAATSSAREGTADQP 802

Query: 185 VEATETIVPQELNSDNASS 203
             AT +   + + S  +SS
Sbjct: 803 ASATSSDGHEAVTSVTSSS 821


>gi|13470499|ref|NP_102068.1| ATP-dependent RNA helicase [Mesorhizobium loti MAFF303099]
 gi|14021241|dbj|BAB47854.1| probable ATP-dependent RNA helicase [Mesorhizobium loti MAFF303099]
          Length = 527

 Score = 39.1 bits (89), Expect = 0.37,   Method: Composition-based stats.
 Identities = 15/123 (12%), Positives = 32/123 (26%), Gaps = 3/123 (2%)

Query: 84  VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV 143
           V  ++ +     +         ++  +R      +            ++       QP V
Sbjct: 390 VVASEGEDDAPRRGKGAPRRAGRKDDDRKDRGERKKG-GERRARHSEEDAAVAQQEQPDV 448

Query: 144 EDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQ--ELNSDNA 201
            + A       R +  + +     R    R  P A          +   P       DN 
Sbjct: 449 AETAVADISERRARKEAIRSENTERKSSDRNEPRAPERGDTRPQRDNSRPARHRHQEDND 508

Query: 202 SSV 204
           ++V
Sbjct: 509 TTV 511


>gi|255320863|ref|ZP_05362037.1| poly(A) polymerase [Acinetobacter radioresistens SK82]
 gi|262380244|ref|ZP_06073399.1| poly(A) polymerase I [Acinetobacter radioresistens SH164]
 gi|255302032|gb|EET81275.1| poly(A) polymerase [Acinetobacter radioresistens SK82]
 gi|262298438|gb|EEY86352.1| poly(A) polymerase I [Acinetobacter radioresistens SH164]
          Length = 483

 Score = 39.1 bits (89), Expect = 0.37,   Method: Composition-based stats.
 Identities = 19/108 (17%), Positives = 42/108 (38%), Gaps = 3/108 (2%)

Query: 64  AGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASP 123
           AGD    +   Q  + Y  + +  + +   +  R        ++Q E   + +   E  P
Sbjct: 368 AGDPT-TQGMGQWWDAYQNMGADEKEKTISQYNRQRA--KNRRKQNEDVLDEVKHLEIEP 424

Query: 124 CPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLR 171
              I E +      + +P+V+  A K  +   + +  +  ++R+R  R
Sbjct: 425 LVDIPEPRSRRARKARKPEVDHEAVKAAESVGDFNSDHPIMKRKRVKR 472


>gi|285017808|ref|YP_003375519.1| translation initiation factor if-2 protein [Xanthomonas albilineans
           GPE PC73]
 gi|283473026|emb|CBA15531.1| probable translation initiation factor if-2 protein [Xanthomonas
           albilineans]
          Length = 900

 Score = 39.1 bits (89), Expect = 0.38,   Method: Composition-based stats.
 Identities = 23/119 (19%), Positives = 46/119 (38%), Gaps = 16/119 (13%)

Query: 62  MSAGDYV---VAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSE 118
            ++G  V    AE   +  E   R ++  Q   ++   R ++ D   K +++  + A +E
Sbjct: 119 AASGGRVDDERAEILRKLEESKQRNLAEQQRLAEQDRARADELDRKRKAEQDVLERAEAE 178

Query: 119 FEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPN 177
            +A+                 +  +E+VA  TP I+     + +  R     RP   P+
Sbjct: 179 RKAAQA-------------EQEADIEEVAASTPAIAPSTVAAPRAPRPATTPRPAPAPH 224


>gi|74227060|dbj|BAE38328.1| unnamed protein product [Mus musculus]
 gi|148699325|gb|EDL31272.1| RIKEN cDNA A430110N23 [Mus musculus]
 gi|187954375|gb|AAI41045.1| RIKEN cDNA A430110N23 gene [Mus musculus]
          Length = 1371

 Score = 39.1 bits (89), Expect = 0.38,   Method: Composition-based stats.
 Identities = 18/78 (23%), Positives = 30/78 (38%), Gaps = 4/78 (5%)

Query: 122  SPCPL--IEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAK 179
            +P P    ++ + P    S QP        TP    E   S +K     P +PR+  N++
Sbjct: 1139 APQPTTNPQQPRSPHPATSPQPPTNTHPSSTPATPTESLPSSRKTELSSPTKPRL--NSE 1196

Query: 180  SGNQPVEATETIVPQELN 197
               +   +T+    Q L 
Sbjct: 1197 LTFEEAPSTDASQTQNLE 1214


>gi|27370514|ref|NP_766596.1| soluble scavenger receptor cysteine-rich domain-containing protein
            SSC5D precursor [Mus musculus]
 gi|81875363|sp|Q8BV57|SRCRL_MOUSE RecName: Full=Scavenger receptor cysteine-rich domain-containing
            protein LOC284297 homolog; Flags: Precursor
 gi|26348281|dbj|BAC37780.1| unnamed protein product [Mus musculus]
 gi|194354453|gb|ACF54723.1| group B scavenger receptor cysteine-rich domain-containing protein
            [Mus musculus]
          Length = 1371

 Score = 39.1 bits (89), Expect = 0.38,   Method: Composition-based stats.
 Identities = 18/78 (23%), Positives = 30/78 (38%), Gaps = 4/78 (5%)

Query: 122  SPCPL--IEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAK 179
            +P P    ++ + P    S QP        TP    E   S +K     P +PR+  N++
Sbjct: 1139 APQPTTNPQQPRSPHPATSPQPPTNTHPSSTPATPTESLPSSRKTELSSPTKPRL--NSE 1196

Query: 180  SGNQPVEATETIVPQELN 197
               +   +T+    Q L 
Sbjct: 1197 LTFEEAPSTDASQTQNLE 1214


>gi|298253846|ref|ZP_06977433.1| P30/P32 adhesin-like protein [Gardnerella vaginalis 5-1]
 gi|297531989|gb|EFH70964.1| P30/P32 adhesin-like protein [Gardnerella vaginalis 5-1]
          Length = 1888

 Score = 39.1 bits (89), Expect = 0.39,   Method: Composition-based stats.
 Identities = 14/106 (13%), Positives = 32/106 (30%), Gaps = 5/106 (4%)

Query: 92   QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV-EDVAFKT 150
             E  ++ E      ++  E+ +      +        +  +P  + +  PK  E      
Sbjct: 1611 DEPGKQPENPSEPGEKPGEKPKPGEDPSKKP---EKPKPDQPGTKPAPAPKPGEHQQVPA 1667

Query: 151  PDISREKDVSYKKVRRRRPLRPRVFP-NAKSGNQPVEATETIVPQE 195
            P        S ++ +  +P  P   P  ++   +P  A        
Sbjct: 1668 PAPKPTPSESSEQSKPSKPSVPSEKPVPSEKTEKPAPADSAKPAPA 1713


>gi|195152401|ref|XP_002017125.1| GL22134 [Drosophila persimilis]
 gi|194112182|gb|EDW34225.1| GL22134 [Drosophila persimilis]
          Length = 472

 Score = 39.1 bits (89), Expect = 0.39,   Method: Composition-based stats.
 Identities = 14/72 (19%), Positives = 22/72 (30%), Gaps = 1/72 (1%)

Query: 117 SEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFP 176
           +  + SPCP       P     +QP         P+ +    +         P++P   P
Sbjct: 102 TPVQPSPCPTTPVESSPCPNTPVQPNPCPNNLVQPNPNPNTPL-QPNPCPNTPIQPSPSP 160

Query: 177 NAKSGNQPVEAT 188
           N      P   T
Sbjct: 161 NTPVLPNPCPNT 172


>gi|148992227|ref|ZP_01821950.1| zinc metalloprotease ZmpB, putative [Streptococcus pneumoniae
           SP9-BS68]
 gi|168488345|ref|ZP_02712544.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae SP195]
 gi|147928853|gb|EDK79865.1| zinc metalloprotease ZmpB, putative [Streptococcus pneumoniae
           SP9-BS68]
 gi|183572970|gb|EDT93498.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae SP195]
 gi|332074469|gb|EGI84945.1| M26 IgA1-specific Metallo-endopeptidase family protein
           [Streptococcus pneumoniae GA17570]
          Length = 1829

 Score = 39.1 bits (89), Expect = 0.39,   Method: Composition-based stats.
 Identities = 23/117 (19%), Positives = 40/117 (34%), Gaps = 11/117 (9%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPC----PLIEEGKEPIFENSIQ 140
           +  QA+ + ++   E+       + E +     + E  P     P +EEGKE   E +  
Sbjct: 126 NQEQARTENQVVETEEAPKEEAPKTEESPKEEPKSEIKPTDDTLPKVEEGKEDSAEPAPV 185

Query: 141 PKVEDVAFKTPDISR-EKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQEL 196
            +V       P+     K  S    +      P   P  +   +PVE +E       
Sbjct: 186 EEVGGEVESKPEEKVAVKPESQPSDK------PTEEPKVEQVGEPVEPSEDEQAPTA 236


>gi|307709586|ref|ZP_07646039.1| LPXTG-motif cell wall anchor domain protein [Streptococcus mitis
           SK564]
 gi|307619622|gb|EFN98745.1| LPXTG-motif cell wall anchor domain protein [Streptococcus mitis
           SK564]
          Length = 835

 Score = 39.1 bits (89), Expect = 0.40,   Method: Composition-based stats.
 Identities = 19/81 (23%), Positives = 30/81 (37%), Gaps = 5/81 (6%)

Query: 123 PCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGN 182
           P P   E  +P  + + QP+  + A      + +   + +K  RR PLR     +     
Sbjct: 373 PTPKPAENPQPEVKPAEQPQPTNPAKPEVKPAEQPQENNRKPVRRWPLR-----DGSVHE 427

Query: 183 QPVEATETIVPQELNSDNASS 203
            PV     IV     SD   +
Sbjct: 428 HPVVTYADIVAPLPISDMKET 448


>gi|307708361|ref|ZP_07644828.1| C protein beta antigen [Streptococcus mitis NCTC 12261]
 gi|307615807|gb|EFN95013.1| C protein beta antigen [Streptococcus mitis NCTC 12261]
          Length = 722

 Score = 39.1 bits (89), Expect = 0.40,   Method: Composition-based stats.
 Identities = 23/118 (19%), Positives = 37/118 (31%), Gaps = 11/118 (9%)

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPC----PLIEEGKEPIFENSIQPKVE 144
              + +  R +Q         E  ++        P     P  E+ K+P      QPK  
Sbjct: 564 KATEPEPPRGDQPKTPEAPTPEEPKHPEVPTVDQPKNPEKPTPEDPKQPGVPTVEQPKTP 623

Query: 145 DVAF----KTPD-ISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPV-EATETIVPQEL 196
                   K P+  +  +    +K   + P +P V P A+    P   A E     E 
Sbjct: 624 ASPVPAEPKRPEVPAVAQPKVPEKPSPKEPKQPEV-PTAEQPKTPASPAPEEPKHPET 680


>gi|167536139|ref|XP_001749742.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163771890|gb|EDQ85551.1| predicted protein [Monosiga brevicollis MX1]
          Length = 1275

 Score = 39.1 bits (89), Expect = 0.40,   Method: Composition-based stats.
 Identities = 23/139 (16%), Positives = 46/139 (33%), Gaps = 16/139 (11%)

Query: 61  AMSAGDYVVAENHLQHAEHY---NRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALS 117
           A   GD +  E  +Q  +      R+ +  QA  +EK ++D     +V +  ++   A+ 
Sbjct: 124 AKLRGDRIAVEAEIQRLDEQIERQRVQNKLQASKEEKRRQDRDRGEIVLQGGDQPDTAID 183

Query: 118 EFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPN 177
                   + +E      E   + +    A        E   S   + R  P        
Sbjct: 184 RDR-RSQSIRDEKLMAGIEGKSEKQRVAEA-HARFAFNEYRSSQLSLHRDVP-------- 233

Query: 178 AKSGNQPVEATETIVPQEL 196
                +P++  +   P +L
Sbjct: 234 ---DARPMQCKDVAYPPDL 249


>gi|293559693|ref|ZP_06676221.1| surface protein, putative [Enterococcus faecium E1162]
 gi|314996888|ref|ZP_07861892.1| LPXTG-motif protein cell wall anchor domain protein [Enterococcus
           faecium TX0133a01]
 gi|291606368|gb|EFF35774.1| surface protein, putative [Enterococcus faecium E1162]
 gi|313588995|gb|EFR67840.1| LPXTG-motif protein cell wall anchor domain protein [Enterococcus
           faecium TX0133a01]
          Length = 389

 Score = 39.1 bits (89), Expect = 0.41,   Method: Composition-based stats.
 Identities = 19/129 (14%), Positives = 38/129 (29%), Gaps = 7/129 (5%)

Query: 88  QAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKE------PIFENSIQP 141
           + + + K +    ++   +++ E       + E  P P  E   E      P  +   +P
Sbjct: 173 KPENENKPEVPPTENPDGEQKPEIEPGEEPDTETQPEPDNESKPEITPGEKPDVDPEEKP 232

Query: 142 KVEDVAFKTPDISREKDVSYKKVRR-RRPLRPRVFPNAKSGNQPVEATETIVPQELNSDN 200
            V              + +         P +  V P  K    P   T+          N
Sbjct: 233 DVTPEPDTDSGNQTVPETNPDTDNETENPEKLEVDPEEKPDVTPEPDTDARDQGIPEKIN 292

Query: 201 ASSVDQDCK 209
             ++ +D K
Sbjct: 293 KKTIQEDGK 301



 Score = 34.5 bits (77), Expect = 8.2,   Method: Composition-based stats.
 Identities = 25/122 (20%), Positives = 40/122 (32%), Gaps = 2/122 (1%)

Query: 87  AQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDV 146
           +Q Q  E+    +    LV+E  ++ +N     E  P    +  ++P  E   +P  E  
Sbjct: 149 SQRQTIEQDSAIDSGGDLVEEPTDKPENENKP-EVPPTENPDGEQKPEIEPGEEPDTETQ 207

Query: 147 AFKTPDISRE-KDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVD 205
                +   E        V           P+  SGNQ V  T      E  +     VD
Sbjct: 208 PEPDNESKPEITPGEKPDVDPEEKPDVTPEPDTDSGNQTVPETNPDTDNETENPEKLEVD 267

Query: 206 QD 207
            +
Sbjct: 268 PE 269


>gi|253565001|ref|ZP_04842457.1| transcription termination factor rho [Bacteroides sp. 3_2_5]
 gi|251946466|gb|EES86843.1| transcription termination factor rho [Bacteroides sp. 3_2_5]
          Length = 688

 Score = 39.1 bits (89), Expect = 0.41,   Method: Composition-based stats.
 Identities = 17/94 (18%), Positives = 32/94 (34%), Gaps = 5/94 (5%)

Query: 113 QNALSEFEASPCPLIEEGKEP-IFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLR 171
           +N       +  P  +   +P   E + +   E  A      +    V+     +++P R
Sbjct: 86  KNGELTKTDAKTPAAKTQPQPKTTEPTPETAKEANAETNATPAESVKVTPYATPKKKPGR 145

Query: 172 PRVFPNAKSGNQPVEATE---TIVPQELNSDNAS 202
           PR     ++  +P E T      VP       A+
Sbjct: 146 PR-KNQVETEAKPAEETTEKPETVPSAQEEKPAA 178


>gi|330815939|ref|YP_004359644.1| Putative prolin-rich exported protein [Burkholderia gladioli BSR3]
 gi|327368332|gb|AEA59688.1| Putative prolin-rich exported protein [Burkholderia gladioli BSR3]
          Length = 850

 Score = 39.1 bits (89), Expect = 0.42,   Method: Composition-based stats.
 Identities = 21/119 (17%), Positives = 33/119 (27%), Gaps = 8/119 (6%)

Query: 87  AQAQIQEKLQRDEQDDLLVKE--QKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
           AQ +++       Q  +  +   Q    Q + +           E  +P FE    P+VE
Sbjct: 726 AQPRVEGPRAESAQPRIEARAEPQAPTPQPSFARQPERQPAAQLERPQPHFEAPQAPRVE 785

Query: 145 DVAFKTPDISREKDVSYKKVRRRRPL------RPRVFPNAKSGNQPVEATETIVPQELN 197
               + P    E        R   P       RP   P  +    P +A          
Sbjct: 786 APRIERPQPHFEPQPPPHFERPAAPQAAPHFERPAAPPQQQHVEAPRQAPVQHASPAQG 844


>gi|265766040|ref|ZP_06094081.1| transcription termination factor Rho [Bacteroides sp. 2_1_16]
 gi|263253708|gb|EEZ25173.1| transcription termination factor Rho [Bacteroides sp. 2_1_16]
          Length = 684

 Score = 39.1 bits (89), Expect = 0.42,   Method: Composition-based stats.
 Identities = 14/79 (17%), Positives = 28/79 (35%), Gaps = 2/79 (2%)

Query: 113 QNALSEFEASPCPLIEEGKEP-IFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLR 171
           +N       +  P  +   +P   E + +   E  A      +    V+     +++P R
Sbjct: 86  KNGELTKTDAKTPAAKTQPQPKTTEPTPETAKEANAETNATPAESVKVTPYATPKKKPGR 145

Query: 172 PRVFPNAKSGNQPVEATET 190
           PR     ++  +P E T  
Sbjct: 146 PR-KNQVETEAKPAEETTE 163


>gi|25012056|ref|NP_736451.1| peptidoglycan linked protein [Streptococcus agalactiae NEM316]
 gi|24413599|emb|CAD47677.1| gbs2018 [Streptococcus agalactiae NEM316]
 gi|115252911|emb|CAJ66784.1| putative cell-wall anchored surface adhesin [Streptococcus
           agalactiae]
 gi|255961127|gb|ACU44439.1| BibA [Streptococcus agalactiae]
 gi|255961131|gb|ACU44441.1| BibA [Streptococcus agalactiae]
          Length = 643

 Score = 39.1 bits (89), Expect = 0.42,   Method: Composition-based stats.
 Identities = 25/113 (22%), Positives = 38/113 (33%), Gaps = 8/113 (7%)

Query: 93  EKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPD 152
           ++  +         +  E     +++ EA P    E   E   E   + K E      PD
Sbjct: 484 DQANQLANKLRDALQSLELKDKKVAKPEAKPEAKPEAKPEAKPEAKPEAKPEAKPEAKPD 543

Query: 153 ISREKDVSYKKVRRRRPLRPRVFPNAKSGNQP---VEATETIVPQELNSDNAS 202
               K  +   V+     +P   P AKS  +P   +EA     P    S N S
Sbjct: 544 ---VKPEAKPDVKPE--AKPEAKPEAKSEAKPEAKLEAKPEAKPATKKSVNTS 591



 Score = 36.4 bits (82), Expect = 2.6,   Method: Composition-based stats.
 Identities = 20/120 (16%), Positives = 38/120 (31%), Gaps = 3/120 (2%)

Query: 75  QHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPI 134
           Q  +H      +   Q  +   +       ++ + ++     ++ EA P    E   E  
Sbjct: 470 QAYDHVEEGKFITTDQANQLANKLRDALQSLELKDKKVAKPEAKPEAKPEAKPEAKPEAK 529

Query: 135 FENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQP--VEATETIV 192
            E   + K E      P+   +      K   +   +    P AK   +P    AT+  V
Sbjct: 530 PEAKPEAKPEAKPDVKPEAKPDVK-PEAKPEAKPEAKSEAKPEAKLEAKPEAKPATKKSV 588


>gi|223937455|ref|ZP_03629359.1| DEAD/DEAH box helicase domain protein [bacterium Ellin514]
 gi|223893806|gb|EEF60263.1| DEAD/DEAH box helicase domain protein [bacterium Ellin514]
          Length = 645

 Score = 39.1 bits (89), Expect = 0.43,   Method: Composition-based stats.
 Identities = 19/117 (16%), Positives = 34/117 (29%), Gaps = 11/117 (9%)

Query: 88  QAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFE-----NSIQPK 142
           + +      R ++     + ++ER +      EA P P+      P  E        + +
Sbjct: 452 ERRDDRHDGRADRPSRFSERREERPRRPDFSREARPEPVRHSAPLPKVERKPIIAKPEHR 511

Query: 143 VEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQ------PVEATETIVP 193
            E      P  +  K          RP   + FP A+   +      P        P
Sbjct: 512 KEQAPASAPAATEAKPAPVPPSEPSRPKPAQQFPFAERREKVFQKAAPAPKHSRRTP 568


>gi|194743128|ref|XP_001954052.1| GF18082 [Drosophila ananassae]
 gi|190627089|gb|EDV42613.1| GF18082 [Drosophila ananassae]
          Length = 1314

 Score = 39.1 bits (89), Expect = 0.43,   Method: Composition-based stats.
 Identities = 20/114 (17%), Positives = 35/114 (30%), Gaps = 16/114 (14%)

Query: 106 KEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK--- 162
           ++  +R        E  P P      +P  + S +P+        P  + +K    K   
Sbjct: 168 EKSSDRKPAPKKRSEPKPAPKKSSEPKPASKKSSEPQPAPKKSSEPKPATKKSSEPKPAT 227

Query: 163 -----KVRRRRPLRPRV--------FPNAKSGNQPVEATETIVPQELNSDNASS 203
                 V+R      RV         P   S ++P  AT +   +      + S
Sbjct: 228 KKTTLSVKRCLVRLKRVSLPNSGQKKPKMSSDSEPEAATTSKKSRPSRRSKSES 281


>gi|241888664|ref|ZP_04775971.1| hypothetical protein GEMHA0001_1254 [Gemella haemolysans ATCC
           10379]
 gi|241864687|gb|EER69062.1| hypothetical protein GEMHA0001_1254 [Gemella haemolysans ATCC
           10379]
          Length = 445

 Score = 39.1 bits (89), Expect = 0.43,   Method: Composition-based stats.
 Identities = 20/131 (15%), Positives = 42/131 (32%), Gaps = 14/131 (10%)

Query: 79  HYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEA------SPCPLIEEGKE 132
           H  +I    +    E   + + ++ L K+Q  + + +     A      +  P   E  +
Sbjct: 127 HTFKIAVSYEVATDEVKAQQKANNDLKKDQNAKGEQSKPSAPAVETKKPAEQPKPVEQPK 186

Query: 133 PIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIV 192
           P    + +P+ +    +T   +     S    +   P+      NA   N P E+    V
Sbjct: 187 P--AATAKPEEQPKTGETTKTAETPKTSEAVAKPNTPV------NAVPSNTPGESGLRSV 238

Query: 193 PQELNSDNASS 203
                     +
Sbjct: 239 MLNNPKTEVKT 249


>gi|30023387|ref|NP_835018.1| collagen adhesion protein [Bacillus cereus ATCC 14579]
 gi|29898948|gb|AAP12219.1| Collagen adhesion protein [Bacillus cereus ATCC 14579]
          Length = 342

 Score = 39.1 bits (89), Expect = 0.43,   Method: Composition-based stats.
 Identities = 16/95 (16%), Positives = 37/95 (38%), Gaps = 2/95 (2%)

Query: 92  QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTP 151
             K   +EQ +   ++  E+ ++  ++ + +  P     ++P  ++      +  A +  
Sbjct: 189 DAKQTTEEQMNGDAQQPTEQPKDGETQQKPAEQPKDGNPQQPAKQSKDGETQQKPAEQPK 248

Query: 152 DISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVE 186
           D + ++     K   R P +P   P      QP E
Sbjct: 249 DGNTQQPAEQPKD--RNPQQPTEQPKDGGTQQPTE 281


>gi|170587212|ref|XP_001898372.1| Dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex, mitochondrial
           precursor [Brugia malayi]
 gi|158594198|gb|EDP32784.1| Dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex, mitochondrial
           precursor, putative [Brugia malayi]
          Length = 350

 Score = 38.8 bits (88), Expect = 0.44,   Method: Composition-based stats.
 Identities = 19/83 (22%), Positives = 31/83 (37%), Gaps = 1/83 (1%)

Query: 120 EASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVR-RRRPLRPRVFPNA 178
             +P    +E K+P+ E +  P   D    +P  S EK V+   ++    PL     P  
Sbjct: 126 GEAPAKSTKEAKQPVEEKTPPPPKADSVQTSPSSSPEKPVTPSPMKIAAAPLPSYSQPKP 185

Query: 179 KSGNQPVEATETIVPQELNSDNA 201
            S  + V +     P   + D  
Sbjct: 186 DSPIEKVPSLTDHSPFTGSRDET 208


>gi|301163997|emb|CBW23553.1| putative transcription termination factor [Bacteroides fragilis
           638R]
          Length = 684

 Score = 38.8 bits (88), Expect = 0.44,   Method: Composition-based stats.
 Identities = 14/79 (17%), Positives = 28/79 (35%), Gaps = 2/79 (2%)

Query: 113 QNALSEFEASPCPLIEEGKEP-IFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLR 171
           +N       +  P  +   +P   E + +   E  A      +    V+     +++P R
Sbjct: 86  KNGELTKTDAKTPAAKTQPQPKTTEPTPETAKEANAETNATPAESVKVTPYATPKKKPGR 145

Query: 172 PRVFPNAKSGNQPVEATET 190
           PR     ++  +P E T  
Sbjct: 146 PR-KNQVETEAKPAEETTE 163


>gi|53714500|ref|YP_100492.1| transcription termination factor Rho [Bacteroides fragilis YCH46]
 gi|52217365|dbj|BAD49958.1| transcription termination factor rho [Bacteroides fragilis YCH46]
          Length = 687

 Score = 38.8 bits (88), Expect = 0.44,   Method: Composition-based stats.
 Identities = 14/79 (17%), Positives = 28/79 (35%), Gaps = 2/79 (2%)

Query: 113 QNALSEFEASPCPLIEEGKEP-IFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLR 171
           +N       +  P  +   +P   E + +   E  A      +    V+     +++P R
Sbjct: 86  KNGELTKTDAKTPAAKTQPQPKTTEPTPETAKEANAETNATPAESVKVTPYATPKKKPGR 145

Query: 172 PRVFPNAKSGNQPVEATET 190
           PR     ++  +P E T  
Sbjct: 146 PR-KNQVETEAKPAEETTE 163


>gi|68236020|gb|AAY88346.1| REV3 [Neurospora crassa]
          Length = 1926

 Score = 38.8 bits (88), Expect = 0.45,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 35/94 (37%), Gaps = 5/94 (5%)

Query: 82  RIVSMAQAQIQEK-LQRDEQDDLLVKEQK--ERAQNALSEFEASPCPLIEEGKEPI-FEN 137
           R+   AQ ++  K  QR  + D    +QK  E+ Q+          P       P+    
Sbjct: 563 RVHEEAQPEVDRKAQQRSREHDQKQGQQKIQEQTQDHDQGGGQKEAPENSTFTTPVRTVQ 622

Query: 138 SIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLR 171
            ++P  +D A +         V   K R  +P++
Sbjct: 623 PMKPNNQDSAGEE-QSMNSLQVEPPKPRTSQPMK 655


>gi|148683989|gb|EDL15936.1| leucine rich repeat containing 59, isoform CRA_b [Mus musculus]
          Length = 376

 Score = 38.8 bits (88), Expect = 0.45,   Method: Composition-based stats.
 Identities = 27/121 (22%), Positives = 45/121 (37%), Gaps = 7/121 (5%)

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALS--E 118
           A  AGD +  +   Q A    + +   QA  + + QR  + +   ++++E  Q A    E
Sbjct: 194 AKVAGDCLDEKQCKQCANKVLQHMKAVQADQERERQRRLEVEREAEKKREAKQQAKEAKE 253

Query: 119 FEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNA 178
            E       EE +    E   Q   +    K P     K  + +  + +   RPR  P  
Sbjct: 254 RELRKREKAEEKERRRKEYDAQKASKREQEKKP-----KKEANQAPKSKSGSRPRKPPPR 308

Query: 179 K 179
           K
Sbjct: 309 K 309


>gi|95981812|gb|ABF57897.1| ballchen [Drosophila simulans]
          Length = 603

 Score = 38.8 bits (88), Expect = 0.45,   Method: Composition-based stats.
 Identities = 16/68 (23%), Positives = 23/68 (33%), Gaps = 2/68 (2%)

Query: 120 EASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK-KVRRRRPLRPRVF-PN 177
             +P P  E           +PK       TP  S +   + K   + + P   R+  PN
Sbjct: 422 RVAPAPAAESSPPGRKRVKTEPKSTPKERATPKTSPKPKGTPKASPKPQTPTAARLKTPN 481

Query: 178 AKSGNQPV 185
           AK    P 
Sbjct: 482 AKINFSPS 489


>gi|322712896|gb|EFZ04469.1| hypothetical protein MAA_01543 [Metarhizium anisopliae ARSEF 23]
          Length = 472

 Score = 38.8 bits (88), Expect = 0.46,   Method: Composition-based stats.
 Identities = 15/117 (12%), Positives = 30/117 (25%), Gaps = 3/117 (2%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEG---KEPIFENSIQP 141
              QA       + +         +E +Q A++    +  P I       +P   +  Q 
Sbjct: 279 QGQQAGQPSVTSQPQASQSDDTCDEEVSQPAVTSQAQASQPAITSQVQTSQPTVTSQAQA 338

Query: 142 KVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
               V  +            +  +     + +      +   PV  T    P   N 
Sbjct: 339 SQSSVTCEEEASQPAVTSQAQASQPAVTTQAQASQPDVTNQVPVPTTAGGAPPATNG 395


>gi|239831712|ref|ZP_04680041.1| Anther-specific proline-rich protein APG [Ochrobactrum intermedium
           LMG 3301]
 gi|239823979|gb|EEQ95547.1| Anther-specific proline-rich protein APG [Ochrobactrum intermedium
           LMG 3301]
          Length = 353

 Score = 38.8 bits (88), Expect = 0.46,   Method: Composition-based stats.
 Identities = 19/103 (18%), Positives = 35/103 (33%), Gaps = 2/103 (1%)

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQ-PKVEDVA 147
            Q  +K ++  +       Q++      +  +AS  P  E    P F   +  P+ E+ A
Sbjct: 46  KQDAQKARQHRKRPAARHTQRKPTAKQQTARQASSAPKAEAKPAPGFTIPVPIPRPEETA 105

Query: 148 FKTPDISREK-DVSYKKVRRRRPLRPRVFPNAKSGNQPVEATE 189
            K P                +   RP   P+ +   +P E  +
Sbjct: 106 NKKPVPEATPLPEENAGTEPQEQPRPAPAPSPEKPARPAEPAD 148


>gi|45387587|ref|NP_991142.1| myosin-IIIa [Danio rerio]
 gi|15982970|gb|AAL11513.1|AF384863_1 myosin IIIA [Danio rerio]
          Length = 1775

 Score = 38.8 bits (88), Expect = 0.46,   Method: Composition-based stats.
 Identities = 21/141 (14%), Positives = 48/141 (34%), Gaps = 6/141 (4%)

Query: 68   VVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLI 127
            +  +N+ +  +  N+  +  QA  + + +R          QKE  +      E     + 
Sbjct: 1176 LARQNYKELLDEKNKAAAKIQAHYRGQKERKSFQRKKEAMQKENTEKTERVTE-----VP 1230

Query: 128  EEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEA 187
             E  +P+ E  +Q   E       + +     S  +  R R          K+ +     
Sbjct: 1231 LEADDPVSEEPLQEGGEVEMDDADEKAAVVLQSNYRGYRERKKFKERQERNKTLSGDELD 1290

Query: 188  TETIVPQE-LNSDNASSVDQD 207
              +  P+E  + ++  +  +D
Sbjct: 1291 ASSSTPEEMTSGEDLEATRED 1311


>gi|95981800|gb|ABF57891.1| ballchen [Drosophila simulans]
          Length = 603

 Score = 38.8 bits (88), Expect = 0.47,   Method: Composition-based stats.
 Identities = 22/109 (20%), Positives = 34/109 (31%), Gaps = 8/109 (7%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEF------EASPCPLIEEGKEPIFENS 138
           S    +I      +E+D    K+  ++A               +P P  E          
Sbjct: 381 SSLDEEISASEDDEEEDKSYRKKAAKKATPLKRNAKVSPLKRVAPAPAAESSPPGRKRVK 440

Query: 139 IQPKVEDVAFKTPDISREKDVSYK-KVRRRRPLRPR-VFPNAKSGNQPV 185
            +PK       TP  S +   + K   + + P   R   PNAK    P 
Sbjct: 441 TEPKSTPKERATPKTSPKPKGTPKASPKPQTPTAARLRTPNAKINFSPS 489


>gi|268566537|ref|XP_002647577.1| C. briggsae CBR-LIN-40 protein [Caenorhabditis briggsae]
          Length = 985

 Score = 38.8 bits (88), Expect = 0.47,   Method: Composition-based stats.
 Identities = 24/120 (20%), Positives = 48/120 (40%), Gaps = 5/120 (4%)

Query: 33  NYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHA-EHYNRIVSMAQAQI 91
            YD N   +     A  + E+Y  +  D M   +    E   + A EH  R+    + + 
Sbjct: 254 VYDPNAQTLLADKGAIRVGEKYQAVVDDWMEPEEREAKEQAEKEAKEHAKRV----KKEE 309

Query: 92  QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTP 151
           + +  R E++D  ++   +  +    E   +    I + + P  E+  +PK  ++   TP
Sbjct: 310 EAERLRQEKEDDNIENGLKIDEGDDEEMPEAKADAIVKEETPEDEDDTEPKSREILVWTP 369


>gi|309363329|emb|CAP26941.2| CBR-LIN-40 protein [Caenorhabditis briggsae AF16]
          Length = 1002

 Score = 38.8 bits (88), Expect = 0.47,   Method: Composition-based stats.
 Identities = 24/120 (20%), Positives = 48/120 (40%), Gaps = 5/120 (4%)

Query: 33  NYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHA-EHYNRIVSMAQAQI 91
            YD N   +     A  + E+Y  +  D M   +    E   + A EH  R+    + + 
Sbjct: 238 VYDPNAQTLLADKGAIRVGEKYQAVVDDWMEPEEREAKEQAEKEAKEHAKRV----KKEE 293

Query: 92  QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTP 151
           + +  R E++D  ++   +  +    E   +    I + + P  E+  +PK  ++   TP
Sbjct: 294 EAERLRQEKEDDNIENGLKIDEGDDEEMPEAKADAIVKEETPEDEDDTEPKSREILVWTP 353


>gi|228979847|ref|ZP_04140168.1| LPXTG-motif cell wall anchor domain protein [Bacillus thuringiensis
           Bt407]
 gi|228779862|gb|EEM28108.1| LPXTG-motif cell wall anchor domain protein [Bacillus thuringiensis
           Bt407]
          Length = 600

 Score = 38.8 bits (88), Expect = 0.47,   Method: Composition-based stats.
 Identities = 12/90 (13%), Positives = 32/90 (35%)

Query: 92  QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTP 151
           +E      ++      ++E+ +   ++      P   +  +P  E   +PK +    + P
Sbjct: 141 EEPNGGKPEEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTNDPKQEKPEEPKTDGSKQEKP 200

Query: 152 DISREKDVSYKKVRRRRPLRPRVFPNAKSG 181
           D ++  D   ++ ++     P    N    
Sbjct: 201 DGTKTNDEKPEQPKQENIQDPSAQLNEAIS 230


>gi|296194716|ref|XP_002745071.1| PREDICTED: caspase recruitment domain-containing protein 6
            [Callithrix jacchus]
          Length = 1033

 Score = 38.8 bits (88), Expect = 0.47,   Method: Composition-based stats.
 Identities = 14/94 (14%), Positives = 27/94 (28%), Gaps = 2/94 (2%)

Query: 85   SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
            +  Q   ++   R     L +              +++P  +     +P      QPK  
Sbjct: 911  ASQQGAQKKTQGRPSNPALQIGSHPMSKSPQFKSDQSNPSQVKHSQPKPFHPVPSQPKPS 970

Query: 145  DVAFKTPDISREKDVSYKK--VRRRRPLRPRVFP 176
                     S+ K    K    +  +P  P+  P
Sbjct: 971  QTKSSQSQPSQTKCSPCKSIQPKPSQPRPPQSKP 1004


>gi|301771970|ref|XP_002921437.1| PREDICTED: LOW QUALITY PROTEIN: dedicator of cytokinesis protein
           6-like [Ailuropoda melanoleuca]
          Length = 2048

 Score = 38.8 bits (88), Expect = 0.48,   Method: Composition-based stats.
 Identities = 24/131 (18%), Positives = 44/131 (33%), Gaps = 9/131 (6%)

Query: 66  DYVVAENHLQH-AEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPC 124
           D+++A    QH +  Y+ I +  Q + Q+ L R   +     +++   +++     +S  
Sbjct: 114 DWIIAHRRYQHLSAAYSPITTETQRERQKGLTRQVFEQDASGDERSGPEDSDDPRHSSGS 173

Query: 125 P---LIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSG 181
           P       G   IF+          A        E+       RR    R +  P A   
Sbjct: 174 PDDTPRSSGASSIFDLR-----NLAADSLLPSLLERTAPEDVDRRNEASRRQNRPRALLA 228

Query: 182 NQPVEATETIV 192
             P    +  V
Sbjct: 229 LYPAPDEDEAV 239


>gi|294660627|ref|NP_853492.2| hypothetical protein MGA_0588 [Mycoplasma gallisepticum str.
           R(low)]
 gi|284812290|gb|AAP57060.2| conserved hypothetical protein [Mycoplasma gallisepticum str.
           R(low)]
 gi|284930992|gb|ADC30931.1| conserved hypothetical protein [Mycoplasma gallisepticum str.
           R(high)]
          Length = 701

 Score = 38.8 bits (88), Expect = 0.48,   Method: Composition-based stats.
 Identities = 18/110 (16%), Positives = 38/110 (34%), Gaps = 6/110 (5%)

Query: 96  QRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISR 155
           QR  +  L    + + A N+  +      P     K P+ +   +P+      K P+ + 
Sbjct: 45  QRQNKVTLDGNGKAQDAYNSNRDNNLPDTPTPPVTKAPVVQEQPKPE------KKPEPTP 98

Query: 156 EKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVD 205
           +     + V            N  + ++P    +   PQ+ N    + +D
Sbjct: 99  QPKPQPRPVDPNDKFAQTTNINYVTYDKPDYRLDATTPQQPNDPTKAVLD 148


>gi|281337410|gb|EFB12994.1| hypothetical protein PANDA_010327 [Ailuropoda melanoleuca]
          Length = 1576

 Score = 38.8 bits (88), Expect = 0.49,   Method: Composition-based stats.
 Identities = 23/141 (16%), Positives = 47/141 (33%), Gaps = 26/141 (18%)

Query: 79  HYNRIVSMAQAQIQEKLQRDEQDDL-LVKEQKERAQNALSEFEASPCPLIEEGKEPIFEN 137
           H+ R    A+ + +E+ ++ + DD    ++ +E  +  ++  E    PL  E  E +   
Sbjct: 133 HFAR--GPAKRKPEEEQEKAKSDDSPEEEKDQEEKRRRVTSREQVARPLPAEEPERVKPG 190

Query: 138 S--------------------IQPKVEDVAFKTPD--ISREKDVSYKKVRRRRPLRPRVF 175
           +                     +P  +  + + PD            +   R   RPR  
Sbjct: 191 THMEEEEERDEKEEKRLRSQTKEPTPKPKSKEEPDREGKTGVQAEMAEGDERDERRPRSQ 250

Query: 176 PNA-KSGNQPVEATETIVPQE 195
           P    +  +P E     V  +
Sbjct: 251 PKDLAAKRRPEEKEPERVKPQ 271


>gi|228959506|ref|ZP_04121193.1| LPXTG-motif cell wall anchor domain protein [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|228800186|gb|EEM47116.1| LPXTG-motif cell wall anchor domain protein [Bacillus thuringiensis
           serovar pakistani str. T13001]
          Length = 600

 Score = 38.8 bits (88), Expect = 0.49,   Method: Composition-based stats.
 Identities = 12/90 (13%), Positives = 32/90 (35%)

Query: 92  QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTP 151
           +E      ++      ++E+ +   ++      P   +  +P  E   +PK +    + P
Sbjct: 141 EEPNGGKPEEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTNDPKQEKPEEPKTDGSKQEKP 200

Query: 152 DISREKDVSYKKVRRRRPLRPRVFPNAKSG 181
           D ++  D   ++ ++     P    N    
Sbjct: 201 DGTKTNDEKPEQPKQENIQDPSAQLNEAIS 230


>gi|310639900|ref|YP_003944658.1| lpxtg-motif cell wall anchor domain protein [Paenibacillus polymyxa
            SC2]
 gi|309244850|gb|ADO54417.1| LPXTG-motif cell wall anchor domain protein [Paenibacillus polymyxa
            SC2]
          Length = 1203

 Score = 38.8 bits (88), Expect = 0.49,   Method: Composition-based stats.
 Identities = 13/78 (16%), Positives = 22/78 (28%), Gaps = 14/78 (17%)

Query: 123  PCPLIEEGKEPIFENSIQPK-VEDVAFKTPDISREKDVSY--------KKVRRRRPLRPR 173
              P +E   +P  E  +QP+  E    + P    + +              +   P  P 
Sbjct: 1103 EQPPVEPEAQPSAEPGVQPETPEADPHQEPSPPVKIEEDPVPKGVIRLPAEKPENPSDPG 1162

Query: 174  VFPNAKS-----GNQPVE 186
              P   +      N P  
Sbjct: 1163 HTPKVDTLPKTGENSPAP 1180


>gi|88601772|ref|YP_501950.1| hypothetical protein Mhun_0469 [Methanospirillum hungatei JF-1]
 gi|88187234|gb|ABD40231.1| hypothetical protein Mhun_0469 [Methanospirillum hungatei JF-1]
          Length = 295

 Score = 38.8 bits (88), Expect = 0.50,   Method: Composition-based stats.
 Identities = 21/80 (26%), Positives = 33/80 (41%), Gaps = 3/80 (3%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
           S A     ++   DE+ +  +   ++    +  E      P+ E G  P FE  ++P V 
Sbjct: 169 SGAADLFGDEYPEDEEGEASLPGIEDDDFGSFDEPGVDEQPVTESGDLPDFEGDLEPDVS 228

Query: 145 DVAFKTPDISREKDVSYKKV 164
           D  F   D S E D+S K  
Sbjct: 229 DSGF---DDSIEDDLSGKDE 245


>gi|6970476|dbj|BAA90752.1| Misshapen/NIKs-related kinase MINK-1 [Mus musculus]
          Length = 1300

 Score = 38.8 bits (88), Expect = 0.50,   Method: Composition-based stats.
 Identities = 21/140 (15%), Positives = 48/140 (34%), Gaps = 15/140 (10%)

Query: 79  HYNRIVSMAQ-----AQIQEKLQRDEQDDLLVKEQKERAQNALSE-FEASPCPLIEEGKE 132
           HY R ++ A       +++E+ + ++Q +  + ++ +          +ASP P     + 
Sbjct: 508 HYGRGINPADKPAWAREVEERARMNKQQNSPLAKRSQAGAGPEPPISQASPSPPGPLSQT 567

Query: 133 PIFENSIQPKVED-------VAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPV 185
           P  +  ++P+               P  +        + +  R L    FP +   +   
Sbjct: 568 PPMQRPVEPQEGPHKSLVAHRVPLKPYAAPVPRSQSLQDQPTRNLA--AFPASHDPDPAA 625

Query: 186 EATETIVPQELNSDNASSVD 205
             T T  P    +    + D
Sbjct: 626 VPTPTATPSARGAVIRQNSD 645


>gi|7637419|dbj|BAA94837.1| GCK family kinase MINK2 [Mus musculus]
          Length = 1308

 Score = 38.8 bits (88), Expect = 0.50,   Method: Composition-based stats.
 Identities = 21/140 (15%), Positives = 48/140 (34%), Gaps = 15/140 (10%)

Query: 79  HYNRIVSMAQ-----AQIQEKLQRDEQDDLLVKEQKERAQNALSE-FEASPCPLIEEGKE 132
           HY R ++ A       +++E+ + ++Q +  + ++ +          +ASP P     + 
Sbjct: 508 HYGRGINPADKPAWAREVEERARMNKQQNSPLAKRSQAGAGPEPPISQASPSPPGPLSQT 567

Query: 133 PIFENSIQPKVED-------VAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPV 185
           P  +  ++P+               P  +        + +  R L    FP +   +   
Sbjct: 568 PPMQRPVEPQEGPHKSLVAHRVPLKPYAAPVPRSQSLQDQPTRNLA--AFPASHDPDPAA 625

Query: 186 EATETIVPQELNSDNASSVD 205
             T T  P    +    + D
Sbjct: 626 VPTPTATPSARGAVIRQNSD 645


>gi|326382637|ref|ZP_08204328.1| prolipoprotein diacylglyceryl transferase [Gordonia neofelifaecis
           NRRL B-59395]
 gi|326198756|gb|EGD55939.1| prolipoprotein diacylglyceryl transferase [Gordonia neofelifaecis
           NRRL B-59395]
          Length = 582

 Score = 38.8 bits (88), Expect = 0.50,   Method: Composition-based stats.
 Identities = 16/89 (17%), Positives = 31/89 (34%)

Query: 99  EQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKD 158
            + D    E +E   +A +  E  P P +    EP  E   +  +E  A      +  + 
Sbjct: 403 RETDDDAAEPREADDSADAGAEPEPEPDVAVEPEPEPETDGEAGIETDADADDQSATAES 462

Query: 159 VSYKKVRRRRPLRPRVFPNAKSGNQPVEA 187
           VS      ++       P  ++ ++P   
Sbjct: 463 VSEWAQTDKQAPGTDSEPEPEADSEPEPE 491


>gi|21356599|ref|NP_648919.1| CG13025 [Drosophila melanogaster]
 gi|7294060|gb|AAF49415.1| CG13025 [Drosophila melanogaster]
 gi|17946482|gb|AAL49273.1| RE72625p [Drosophila melanogaster]
 gi|220948778|gb|ACL86932.1| CG13025-PA [synthetic construct]
          Length = 608

 Score = 38.8 bits (88), Expect = 0.50,   Method: Composition-based stats.
 Identities = 22/115 (19%), Positives = 38/115 (33%), Gaps = 4/115 (3%)

Query: 95  LQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDIS 154
               E  D  V   +    ++  + E    P+  EG +P  E   Q   +      P+  
Sbjct: 2   ENETEALDPEVYADETSTDDSSGDDEVILNPV--EGLQPAVEIDEQRD-QPGENAEPEQP 58

Query: 155 REKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQDCK 209
           R   +         P  PR     +   Q V + ET  P +     +++ D+  K
Sbjct: 59  RVPPLILVDP-PHLPSPPRNSRRNQGEEQEVISLETPSPPKKRKRLSAAADKSLK 112


>gi|282866428|ref|ZP_06275472.1| hypothetical protein SACTEDRAFT_6017 [Streptomyces sp. ACTE]
 gi|282558640|gb|EFB64198.1| hypothetical protein SACTEDRAFT_6017 [Streptomyces sp. ACTE]
          Length = 323

 Score = 38.8 bits (88), Expect = 0.51,   Method: Composition-based stats.
 Identities = 17/103 (16%), Positives = 30/103 (29%), Gaps = 5/103 (4%)

Query: 102 DLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSY 161
           +L     +           A+P P +E G EP    +  P   D  F+   +   +    
Sbjct: 99  ELQRPADEPDPGAPTPVGPAAPEPGLEPGHEPAAFATAPPTSSDTDFQGGTMESSQQQPQ 158

Query: 162 KKVRRRRPLRPRVFPNA-----KSGNQPVEATETIVPQELNSD 199
            +  R+   +      A     +    P   T  + P     D
Sbjct: 159 PEPERQNRDQDDALKRAIQAAYQGNGTPSPPTSAVAPPTGGED 201


>gi|29428007|sp|Q9JM52|MINK1_MOUSE RecName: Full=Misshapen-like kinase 1; AltName: Full=GCK family
           kinase MiNK; AltName: Full=MAPK/ERK kinase kinase kinase
           6; Short=MEK kinase kinase 6; Short=MEKKK 6; AltName:
           Full=Misshapen/NIK-related kinase; AltName:
           Full=Mitogen-activated protein kinase kinase kinase
           kinase 6
          Length = 1308

 Score = 38.8 bits (88), Expect = 0.52,   Method: Composition-based stats.
 Identities = 21/140 (15%), Positives = 48/140 (34%), Gaps = 15/140 (10%)

Query: 79  HYNRIVSMAQ-----AQIQEKLQRDEQDDLLVKEQKERAQNALSE-FEASPCPLIEEGKE 132
           HY R ++ A       +++E+ + ++Q +  + ++ +          +ASP P     + 
Sbjct: 508 HYGRGINPADKPAWAREVEERARMNKQQNSPLAKRSQAGAGPEPPISQASPSPPGPLSQT 567

Query: 133 PIFENSIQPKVED-------VAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPV 185
           P  +  ++P+               P  +        + +  R L    FP +   +   
Sbjct: 568 PPMQRPVEPQEGPHKSLVAHRVPLKPYAAPVPRSQSLQDQPTRNLA--AFPASHDPDPAA 625

Query: 186 EATETIVPQELNSDNASSVD 205
             T T  P    +    + D
Sbjct: 626 VPTPTATPSARGAVIRQNSD 645


>gi|300022048|ref|YP_003754659.1| TonB-dependent receptor [Hyphomicrobium denitrificans ATCC 51888]
 gi|299523869|gb|ADJ22338.1| TonB-dependent receptor [Hyphomicrobium denitrificans ATCC 51888]
          Length = 897

 Score = 38.8 bits (88), Expect = 0.52,   Method: Composition-based stats.
 Identities = 21/101 (20%), Positives = 34/101 (33%), Gaps = 11/101 (10%)

Query: 105 VKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVS--YK 162
           V       +  + + +A P P+ +  K+P  +   QP  + V    P    E   S    
Sbjct: 52  VDSGGNLPEVKVIQQQAKPKPVKQAQKKPKVQ--PQPAPQPVVEAAPQAPVETSTSEVPP 109

Query: 163 KVRRRRPLRPRVFPNAKSGNQPVEAT-------ETIVPQEL 196
              +  P      P  K      + T       ET++PQE 
Sbjct: 110 SNVKMSPFGASSIPVEKVPAAVSQVTATDFKRDETVIPQEA 150


>gi|255726684|ref|XP_002548268.1| hypothetical protein CTRG_02565 [Candida tropicalis MYA-3404]
 gi|240134192|gb|EER33747.1| hypothetical protein CTRG_02565 [Candida tropicalis MYA-3404]
          Length = 1080

 Score = 38.8 bits (88), Expect = 0.52,   Method: Composition-based stats.
 Identities = 15/82 (18%), Positives = 24/82 (29%), Gaps = 2/82 (2%)

Query: 122 SPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSG 181
           +P         P  E S  P         P    E   +  +     P  P   P  ++ 
Sbjct: 835 APGTETPSAPAPGTETSSAPAPGTETPSAPAPGTETPSAPCEGDECTPTTPA--PGTETS 892

Query: 182 NQPVEATETIVPQELNSDNASS 203
           + P   TET       ++  S+
Sbjct: 893 SAPAPGTETSSAPAPGTETPSA 914



 Score = 36.1 bits (81), Expect = 2.9,   Method: Composition-based stats.
 Identities = 14/73 (19%), Positives = 22/73 (30%), Gaps = 2/73 (2%)

Query: 131 KEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATET 190
             P  E S  P         P    E   +  +     P  P   P  ++ + P   TET
Sbjct: 885 PAPGTETSSAPAPGTETSSAPAPGTETPSAPCEGDECTPTTPA--PGTETSSAPAPGTET 942

Query: 191 IVPQELNSDNASS 203
                  ++  S+
Sbjct: 943 SSAPAPGTETPSA 955



 Score = 34.9 bits (78), Expect = 6.8,   Method: Composition-based stats.
 Identities = 13/88 (14%), Positives = 22/88 (25%), Gaps = 2/88 (2%)

Query: 116 LSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVF 175
            +    +P         P  E    P         P    E   +           P   
Sbjct: 778 ETPSAPAPGTETSSAPAPGTETPSAPAPGTETPSAPCEGDECTPTTPAPGTETSSAPA-- 835

Query: 176 PNAKSGNQPVEATETIVPQELNSDNASS 203
           P  ++ + P   TET       ++  S+
Sbjct: 836 PGTETPSAPAPGTETSSAPAPGTETPSA 863


>gi|195340532|ref|XP_002036867.1| GM12616 [Drosophila sechellia]
 gi|194130983|gb|EDW53026.1| GM12616 [Drosophila sechellia]
          Length = 926

 Score = 38.8 bits (88), Expect = 0.52,   Method: Composition-based stats.
 Identities = 19/115 (16%), Positives = 45/115 (39%), Gaps = 4/115 (3%)

Query: 86  MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIE----EGKEPIFENSIQP 141
            AQ + + +L+ + Q ++  + + E      ++ E  P P +E       +P  E   + 
Sbjct: 78  EAQPEAEPQLEVEPQPEVESQPEVESQPEVEAQPEVEPQPEVEPQPEVEPQPEVETEPEA 137

Query: 142 KVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQEL 196
           + +      P++    +V        +P +     + K  +  V+ TE  + + L
Sbjct: 138 ESQSEPETKPEVEALPEVETLPEAESQPEKEPEVEDEKISDNEVDTTEASLMETL 192



 Score = 36.8 bits (83), Expect = 2.1,   Method: Composition-based stats.
 Identities = 22/113 (19%), Positives = 40/113 (35%), Gaps = 3/113 (2%)

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
            + + + ++ + ++   +   E A+    E EA P    +   EP  E   QP+VE    
Sbjct: 42  EESETQPEQVQPEEYQSESDGELAEKKP-EIEAPPEVEAQPEAEPQLEVEPQPEVESQPE 100

Query: 149 KTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNA 201
                  E      + +     +P V P  +   +P EA     P+      A
Sbjct: 101 VESQPEVEAQ-PEVEPQPEVEPQPEVEPQPEVETEP-EAESQSEPETKPEVEA 151


>gi|221052927|ref|XP_002257838.1| Liver stage antigen 3 precursor [Plasmodium knowlesi strain H]
 gi|193807670|emb|CAQ38374.1| Liver stage antigen 3 precursor, putative [Plasmodium knowlesi
           strain H]
          Length = 1986

 Score = 38.8 bits (88), Expect = 0.52,   Method: Composition-based stats.
 Identities = 30/144 (20%), Positives = 58/144 (40%), Gaps = 8/144 (5%)

Query: 71  ENHLQHAEHYNRIVSMAQAQIQEKLQRDEQ--DDLLVKEQKERAQNALSEFEASPCPLIE 128
           EN  Q  E    I+      +QEK++ +E   +D+L + ++E      +  E    P++E
Sbjct: 634 ENFEQKIEANENILGSVLENLQEKVELNENVLEDVLAEMKEEAVSQQETAEETIEEPVVE 693

Query: 129 EGKEPIFENSIQPKV----EDVAFKTPDISREKDVSYKKVRRRRPLRPRV-FPNAKSGNQ 183
             +EP+ E   +P V    E V     +   E            P+   +  P  ++  +
Sbjct: 694 TIEEPVVETIAEPVVETIEEPVVETIEEPVVETIEEPVVENIEEPVVENIEEPVVETIEE 753

Query: 184 PVEAT-ETIVPQELNSDNASSVDQ 206
           PV  T E  V + +      ++++
Sbjct: 754 PVVETIEEPVVETIEEPVVETIEE 777


>gi|229153115|ref|ZP_04281295.1| Cell surface protein [Bacillus cereus m1550]
 gi|228630381|gb|EEK87030.1| Cell surface protein [Bacillus cereus m1550]
          Length = 1522

 Score = 38.8 bits (88), Expect = 0.54,   Method: Composition-based stats.
 Identities = 18/93 (19%), Positives = 35/93 (37%), Gaps = 5/93 (5%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
             + +E  +  E+ ++  ++ KE         E    P   +  E   E+  +P+V+    
Sbjct: 1309 PKTKEDFKIPEEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDP 1368

Query: 149  KTPDISREKDVSYKKVR-----RRRPLRPRVFP 176
            K P++  E     K+        + P  P V P
Sbjct: 1369 KEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKP 1401


>gi|311113147|ref|YP_003984369.1| hypothetical protein HMPREF0733_11478 [Rothia dentocariosa ATCC
           17931]
 gi|310944641|gb|ADP40935.1| conserved hypothetical protein [Rothia dentocariosa ATCC 17931]
          Length = 1221

 Score = 38.8 bits (88), Expect = 0.55,   Method: Composition-based stats.
 Identities = 21/111 (18%), Positives = 45/111 (40%), Gaps = 3/111 (2%)

Query: 88  QAQIQEKLQRDEQDDLLVKEQKE-RAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDV 146
           Q Q +++  + E       +Q + +  N   E      P  ++ K+   +N ++P+ E+ 
Sbjct: 824 QEQPKQEQPKQENPKQEQPKQDDPKQDNPKQEDPKQEQPKQDDPKQDDNKNIVKPQPENP 883

Query: 147 AFKTPDISREK-DVSYKKVRRRRPLRPR-VFPNAKSGNQPVEATETIVPQE 195
               P   + K D   K+   ++  +P+   P      QP +  + + P E
Sbjct: 884 IQDDPKQEQPKQDNPPKQEDPKQDEQPQPENPATDDQVQPADPNDDLKPNE 934



 Score = 36.1 bits (81), Expect = 2.9,   Method: Composition-based stats.
 Identities = 17/129 (13%), Positives = 46/129 (35%), Gaps = 8/129 (6%)

Query: 86  MAQAQIQEKLQRD--------EQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFEN 137
             Q + +   Q +        +Q+D   ++ K+         + +P     +  +P  +N
Sbjct: 792 AEQPKQENPKQENPQPQPENPKQEDPKQEDPKQEQPKQEQPKQENPKQEQPKQDDPKQDN 851

Query: 138 SIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELN 197
             Q   +    K  D  ++ + +  K +   P++          + P +  +    ++  
Sbjct: 852 PKQEDPKQEQPKQDDPKQDDNKNIVKPQPENPIQDDPKQEQPKQDNPPKQEDPKQDEQPQ 911

Query: 198 SDNASSVDQ 206
            +N ++ DQ
Sbjct: 912 PENPATDDQ 920


>gi|56605670|ref|NP_001008281.1| leucine-rich repeat-containing protein 59 [Rattus norvegicus]
 gi|81910029|sp|Q5RJR8|LRC59_RAT RecName: Full=Leucine-rich repeat-containing protein 59; AltName:
           Full=Protein p34
 gi|480379|pir||S36779 ribosome-binding protein p34 - rat
 gi|534876|dbj|BAA02786.1| p34 protein [Rattus sp.]
 gi|55778335|gb|AAH86530.1| Leucine rich repeat containing 59 [Rattus norvegicus]
 gi|149053897|gb|EDM05714.1| leucine rich repeat containing 59 [Rattus norvegicus]
          Length = 307

 Score = 38.8 bits (88), Expect = 0.55,   Method: Composition-based stats.
 Identities = 27/123 (21%), Positives = 45/123 (36%), Gaps = 7/123 (5%)

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALS--E 118
           A  AGD +  +   Q A    + +   QA  + + QR  + +   ++++E  Q A    E
Sbjct: 125 AKVAGDCLDEKQCKQCANKVLQHMKAVQADQERERQRRLEVEREAEKKREAKQQAKEAKE 184

Query: 119 FEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNA 178
            E       EE +    E   Q   +    K P     K  + +  + +   RPR  P  
Sbjct: 185 RELRKREKAEEKERRRKEYDAQKASKREQEKKP-----KKETNQAPKSKSGSRPRKPPPR 239

Query: 179 KSG 181
           K  
Sbjct: 240 KHN 242


>gi|83720269|ref|YP_442218.1| RE17165p [Burkholderia thailandensis E264]
 gi|83654094|gb|ABC38157.1| RE17165p [Burkholderia thailandensis E264]
          Length = 915

 Score = 38.8 bits (88), Expect = 0.56,   Method: Composition-based stats.
 Identities = 21/106 (19%), Positives = 33/106 (31%), Gaps = 3/106 (2%)

Query: 88  QAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVA 147
           Q +  E   R   +       +   QNAL    ++P P       P      QP+    A
Sbjct: 751 QQRANEGQPRASGEPNAPLNYRSPTQNALPPIRSTPTPTHSAQPAPQPAGRAQPQP---A 807

Query: 148 FKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVP 193
           ++TP        + + V R+    P    N      P    +   P
Sbjct: 808 WQTPRNEMRAPEAPRSVPRQEVAPPPAPRNEYRAPAPAPRPQVEAP 853



 Score = 36.4 bits (82), Expect = 2.3,   Method: Composition-based stats.
 Identities = 15/97 (15%), Positives = 27/97 (27%), Gaps = 4/97 (4%)

Query: 97  RDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISRE 156
           + ++ +             L+    +   L      P   +S QP  +      P  + +
Sbjct: 750 QQQRANEGQPRASGEPNAPLNYRSPTQNALPPIRSTPTPTHSAQPAPQPAGRAQPQPAWQ 809

Query: 157 KDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVP 193
                 +   R P  PR  P  +    P    E   P
Sbjct: 810 TP----RNEMRAPEAPRSVPRQEVAPPPAPRNEYRAP 842


>gi|259486212|tpe|CBF83872.1| TPA: Putative Zn(II)2Cys6 transcription factor (Eurofung)
           [Aspergillus nidulans FGSC A4]
          Length = 1018

 Score = 38.4 bits (87), Expect = 0.57,   Method: Composition-based stats.
 Identities = 19/95 (20%), Positives = 28/95 (29%)

Query: 102 DLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSY 161
           ++L   Q  +AQ  L     S  P  E     I   +  P         PD ++      
Sbjct: 707 EMLKNRQSSKAQVNLKRPAPSNQPAPEPQPGSIQRANTFPVQLLSRPSKPDGTQSPKSVD 766

Query: 162 KKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQEL 196
                R P +PR    +        A+    P E 
Sbjct: 767 DNHAARSPAKPRTNRRSWVQPSEAPASAVSTPPEA 801


>gi|260829373|ref|XP_002609636.1| hypothetical protein BRAFLDRAFT_123556 [Branchiostoma floridae]
 gi|229294998|gb|EEN65646.1| hypothetical protein BRAFLDRAFT_123556 [Branchiostoma floridae]
          Length = 977

 Score = 38.4 bits (87), Expect = 0.57,   Method: Composition-based stats.
 Identities = 31/137 (22%), Positives = 51/137 (37%), Gaps = 19/137 (13%)

Query: 59  RDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALS- 117
           R+AM   + + AE+ LQ  E   R++     Q  E  QR  ++D    + +E A N +  
Sbjct: 840 REAM---ERLKAEHALQMQELERRMIQ----QKLEAQQRQCEEDQKWLQSEEVALNPIIS 892

Query: 118 ----EFEASPCPLIE-EGKEPIFENSIQ---PKVEDVAFKTPDISREKDVSYKKVRRRR- 168
                 E  P    E EG +       +   P+            +E + +    +  R 
Sbjct: 893 PKLERPEQMPGQTNEVEGSQTDGNMPDRSSSPRPLPELPSYQQSPQEANSNEPPPKPARP 952

Query: 169 --PLRPRVFPNAKSGNQ 183
             PL PR    A+  +Q
Sbjct: 953 GLPLSPRTSNAAELSSQ 969


>gi|67524789|ref|XP_660456.1| hypothetical protein AN2852.2 [Aspergillus nidulans FGSC A4]
 gi|40744247|gb|EAA63423.1| hypothetical protein AN2852.2 [Aspergillus nidulans FGSC A4]
          Length = 1017

 Score = 38.4 bits (87), Expect = 0.57,   Method: Composition-based stats.
 Identities = 19/95 (20%), Positives = 28/95 (29%)

Query: 102 DLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSY 161
           ++L   Q  +AQ  L     S  P  E     I   +  P         PD ++      
Sbjct: 706 EMLKNRQSSKAQVNLKRPAPSNQPAPEPQPGSIQRANTFPVQLLSRPSKPDGTQSPKSVD 765

Query: 162 KKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQEL 196
                R P +PR    +        A+    P E 
Sbjct: 766 DNHAARSPAKPRTNRRSWVQPSEAPASAVSTPPEA 800


>gi|322695791|gb|EFY87593.1| AAA family ATPase, putative [Metarhizium acridum CQMa 102]
          Length = 2123

 Score = 38.4 bits (87), Expect = 0.59,   Method: Composition-based stats.
 Identities = 14/98 (14%), Positives = 39/98 (39%), Gaps = 14/98 (14%)

Query: 52   ERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDE-----QDDLLVK 106
            E+ +  A +    GD +         +HY R+++  + +  ++ Q +E     +     +
Sbjct: 1025 EKQAAYASELQKIGDEI---------DHYERVLAYKREEQAQQAQLEEKKAKLKGLKAAQ 1075

Query: 107  EQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
            E+++  +++         P  E  +    + + Q + E
Sbjct: 1076 ERRDAVESSKKAQARKEQPRTENSERSGSKPASQAQQE 1113


>gi|293377082|ref|ZP_06623292.1| LPXTG-motif cell wall anchor domain protein [Enterococcus faecium
           PC4.1]
 gi|292644298|gb|EFF62398.1| LPXTG-motif cell wall anchor domain protein [Enterococcus faecium
           PC4.1]
          Length = 365

 Score = 38.4 bits (87), Expect = 0.59,   Method: Composition-based stats.
 Identities = 18/116 (15%), Positives = 38/116 (32%), Gaps = 2/116 (1%)

Query: 88  QAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVA 147
           + + + K      ++   ++Q E       + E  P P  E   E   E       E   
Sbjct: 174 KPENENKPDIPPTENPDGEQQPEIESGEEPDTEMKPEPDNESKPETTPEEKPGTDNETEN 233

Query: 148 FKTPDISREKDVSYKKVRRR-RPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
            + PD++ E      + +    P  P   P      + + +T+    +E    + +
Sbjct: 234 PEKPDVTPEPPNRVPEEKPDVSPEMPEKTPETNITAKEI-STQKDEKKESQKIDTT 288


>gi|90020697|ref|YP_526524.1| hypothetical protein Sde_1050 [Saccharophagus degradans 2-40]
 gi|89950297|gb|ABD80312.1| hypothetical protein Sde_1050 [Saccharophagus degradans 2-40]
          Length = 1246

 Score = 38.4 bits (87), Expect = 0.59,   Method: Composition-based stats.
 Identities = 30/158 (18%), Positives = 51/158 (32%), Gaps = 18/158 (11%)

Query: 59  RDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSE 118
           ++    GD       LQ AE         Q +  E+LQR E  +L  KE  E  Q    +
Sbjct: 107 KELQRKGDR-----ELQRAED-----KELQRKENEELQRKEDKELQRKED-ENLQRKEDK 155

Query: 119 FEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKK-------VRRRRPLR 171
                   I+   +P  E + +P+ E           E+    +K       ++R+    
Sbjct: 156 ELQRKEEDIQRASQPDKELARKPEQEQEPKIARKPQVEEQQLQRKAHEQQEEIQRKAEGS 215

Query: 172 PRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQDCK 209
           P    N  +  +   A    +P  +        + D  
Sbjct: 216 PDAGSNVTAEIRSAMAGGDPLPLSVRRFMEPRFNADFS 253


>gi|302890623|ref|XP_003044195.1| hypothetical protein NECHADRAFT_88571 [Nectria haematococca mpVI
           77-13-4]
 gi|256725116|gb|EEU38482.1| hypothetical protein NECHADRAFT_88571 [Nectria haematococca mpVI
           77-13-4]
          Length = 1225

 Score = 38.4 bits (87), Expect = 0.59,   Method: Composition-based stats.
 Identities = 32/184 (17%), Positives = 49/184 (26%), Gaps = 23/184 (12%)

Query: 2   RSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRN-YDSNGYDVKVRGTAQHIAERYSVLARD 60
           ++ Q   R  G   +       RK+    VR   D      +  G  Q         A  
Sbjct: 35  KATQPRNRPGGAFVDETAIQALRKSPQEPVRVPLDEIRPHRRDGGRQQE--------ASK 86

Query: 61  AMSAGDYVVAE----NHLQHAEHYNRIVSMAQAQIQEKLQRDE--------QDDLLVKEQ 108
             + G+ V+       + QHAE           Q +  L  +E                 
Sbjct: 87  PQTQGEKVMGPLEEITYRQHAEETLHRTQGTVRQGKILLPPEEIARTLDELNRRYSGGTA 146

Query: 109 KERAQNALSEFEASPCPLIE--EGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRR 166
           + R  + L    A    L++     EP F     P          +       S     R
Sbjct: 147 RPRTCDDLDRQRARDTELVQGPSTPEPTFRPPQTPPSRKRHRTQQEGLLTPPPSGPSRSR 206

Query: 167 RRPL 170
           +RP 
Sbjct: 207 KRPR 210


>gi|229073886|ref|ZP_04206967.1| Surface layer protein [Bacillus cereus F65185]
 gi|228709234|gb|EEL61327.1| Surface layer protein [Bacillus cereus F65185]
          Length = 483

 Score = 38.4 bits (87), Expect = 0.59,   Method: Composition-based stats.
 Identities = 15/65 (23%), Positives = 25/65 (38%), Gaps = 5/65 (7%)

Query: 120 EASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAK 179
           E  P P  EE  E   +   +P+ +      P    + +V   K   +   +P V P+ K
Sbjct: 238 EVKPDPKPEEKPE--VKPDPKPEEKPEVKPDPKPEEKPEV---KPDPKPEEKPEVKPDPK 292

Query: 180 SGNQP 184
              +P
Sbjct: 293 PEEKP 297



 Score = 35.7 bits (80), Expect = 4.5,   Method: Composition-based stats.
 Identities = 24/142 (16%), Positives = 43/142 (30%), Gaps = 12/142 (8%)

Query: 67  YVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPL 126
           +V  E + Q    YN I ++ + Q  E     + ++    +   + +      E  P P 
Sbjct: 214 HVTREQYSQFL--YNSINAVEKVQKPEVKPDPKPEEKPEVKPDPKPEEKP---EVKPDPK 268

Query: 127 IEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVE 186
            EE      E    PK E+     PD    K     +V+       +     +    P  
Sbjct: 269 PEEKP----EVKPDPKPEEKPEVKPDP---KPEEKPEVKPDPKPEEKPEEKPEVKPDPKP 321

Query: 187 ATETIVPQELNSDNASSVDQDC 208
             +   P+     +      D 
Sbjct: 322 EEKPEQPKVPEGLDVEIAQPDF 343


>gi|301772046|ref|XP_002921451.1| PREDICTED: LOW QUALITY PROTEIN: DNA (cytosine-5)-methyltransferase
           1-like [Ailuropoda melanoleuca]
          Length = 1676

 Score = 38.4 bits (87), Expect = 0.60,   Method: Composition-based stats.
 Identities = 23/141 (16%), Positives = 47/141 (33%), Gaps = 26/141 (18%)

Query: 79  HYNRIVSMAQAQIQEKLQRDEQDDL-LVKEQKERAQNALSEFEASPCPLIEEGKEPIFEN 137
           H+ R    A+ + +E+ ++ + DD    ++ +E  +  ++  E    PL  E  E +   
Sbjct: 233 HFAR--GPAKRKPEEEQEKAKSDDSPEEEKDQEEKRRRVTSREQVARPLPAEEPERVKPG 290

Query: 138 S--------------------IQPKVEDVAFKTPD--ISREKDVSYKKVRRRRPLRPRVF 175
           +                     +P  +  + + PD            +   R   RPR  
Sbjct: 291 THMEEEEERDEKEEKRLRSQTKEPTPKPKSKEEPDREGKTGVQAEMAEGDERDERRPRSQ 350

Query: 176 PNA-KSGNQPVEATETIVPQE 195
           P    +  +P E     V  +
Sbjct: 351 PKDLAAKRRPEEKEPERVKPQ 371


>gi|149063637|gb|EDM13960.1| rCG21167 [Rattus norvegicus]
          Length = 393

 Score = 38.4 bits (87), Expect = 0.60,   Method: Composition-based stats.
 Identities = 19/126 (15%), Positives = 38/126 (30%), Gaps = 6/126 (4%)

Query: 84  VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE-ASPCPLIEE--GKEPIFENSIQ 140
           ++  +A+  +   R+ +       + E +Q A  + E + P P   E     P    + Q
Sbjct: 140 LAPTEAETSQPAPREAETSQPAPIKAETSQPAPIKAETSQPAPREAETSQPAPTEAETSQ 199

Query: 141 PKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDN 200
           P         P  + E + S          +P   P     +QP                
Sbjct: 200 PAPTKAETSQPAPT-EAETSQPAPTEVETSQPA--PTEAETSQPAPTEAETSQPASTETE 256

Query: 201 ASSVDQ 206
            + + +
Sbjct: 257 TTQLPR 262



 Score = 36.4 bits (82), Expect = 2.4,   Method: Composition-based stats.
 Identities = 24/114 (21%), Positives = 36/114 (31%), Gaps = 6/114 (5%)

Query: 92  QEKLQRDEQDDLLVKEQKERAQNALSEFE-ASPCPLIEE--GKEPIFENSIQPKVEDVAF 148
           Q +L   E    L   + E +Q A  E E + P P+  E     PI   + QP   +   
Sbjct: 128 QRRLSPVEMTTRLAPTEAETSQPAPREAETSQPAPIKAETSQPAPIKAETSQPAPREAET 187

Query: 149 KTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
             P  + E + S     +    +P   P     +QP                 S
Sbjct: 188 SQPAPT-EAETSQPAPTKAETSQPA--PTEAETSQPAPTEVETSQPAPTEAETS 238


>gi|95981810|gb|ABF57896.1| ballchen [Drosophila simulans]
          Length = 603

 Score = 38.4 bits (87), Expect = 0.60,   Method: Composition-based stats.
 Identities = 16/68 (23%), Positives = 23/68 (33%), Gaps = 2/68 (2%)

Query: 120 EASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK-KVRRRRPLRPRVF-PN 177
             +P P  E           +PK       TP  S +   + K   + + P   R+  PN
Sbjct: 422 RVAPAPAAESSPPGRKRVKTEPKSTPKERATPKTSPKPKGTPKASPKPQTPTAARLKTPN 481

Query: 178 AKSGNQPV 185
           AK    P 
Sbjct: 482 AKINFSPS 489


>gi|260797835|ref|XP_002593906.1| hypothetical protein BRAFLDRAFT_98202 [Branchiostoma floridae]
 gi|229279138|gb|EEN49917.1| hypothetical protein BRAFLDRAFT_98202 [Branchiostoma floridae]
          Length = 668

 Score = 38.4 bits (87), Expect = 0.61,   Method: Composition-based stats.
 Identities = 19/110 (17%), Positives = 42/110 (38%), Gaps = 8/110 (7%)

Query: 93  EKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPD 152
           +  Q+  Q D     Q +R     ++ +    P  +  ++P  + + QP  +  +     
Sbjct: 565 QTRQQARQPDSKPDSQTDRQ----TDRQPDSQPASQTDRQPDRQPARQPARQPASQTARQ 620

Query: 153 ISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
            +R+ D       R    +P   P +++ +Q    T++    + N   AS
Sbjct: 621 PARQIDRQTDSQGR----QPASQPASQTDSQTDSQTDSQTDSQANRQPAS 666


>gi|315611788|ref|ZP_07886710.1| alpha-L-fucosidase FucA [Streptococcus sanguinis ATCC 49296]
 gi|315316203|gb|EFU64233.1| alpha-L-fucosidase FucA [Streptococcus sanguinis ATCC 49296]
          Length = 2041

 Score = 38.4 bits (87), Expect = 0.62,   Method: Composition-based stats.
 Identities = 17/125 (13%), Positives = 37/125 (29%), Gaps = 6/125 (4%)

Query: 77   AEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEF-EASPCPLIEEGKEPIF 135
            A+     +  A+ Q       +   + + K +  + +        A P    +  K    
Sbjct: 1640 ADQAIAAIQEAKTQEAVNQALETALEQISKLEAAQPEKPARPETPAQPEKPAQPEKPAQP 1699

Query: 136  ENSIQPKV-----EDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATET 190
            E   QP+      +    + P             +  +P +P      +   QP +   +
Sbjct: 1700 ETPAQPETPAQPEQPAQPEKPAQPETPAQPETPAQPEQPAQPEQPAQPEKPAQPEKPITS 1759

Query: 191  IVPQE 195
              P+E
Sbjct: 1760 SSPEE 1764



 Score = 38.0 bits (86), Expect = 0.79,   Method: Composition-based stats.
 Identities = 23/133 (17%), Positives = 42/133 (31%), Gaps = 19/133 (14%)

Query: 71   ENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDL-LVKEQKERAQNALSEFEASPCPLIEE 129
            E   Q  E     +S  +A   EK  R E         Q E+     +  +       E+
Sbjct: 1654 EAVNQALETALEQISKLEAAQPEKPARPETPAQPEKPAQPEKPAQPETPAQPETPAQPEQ 1713

Query: 130  GKEPIFENSIQPKV--EDVAFKTPDISREKDVSYKKVRRRRPLRP--------------R 173
              +P  E   QP+   +      P+   + +   +  +  +P +P               
Sbjct: 1714 PAQP--EKPAQPETPAQPETPAQPEQPAQPEQPAQPEKPAQPEKPITSSSPEEGVKNLVF 1771

Query: 174  VFPNAKSGNQPVE 186
              P+ +  N+PV 
Sbjct: 1772 TLPSLEIVNKPVP 1784


>gi|289615723|emb|CBI57464.1| unnamed protein product [Sordaria macrospora]
          Length = 739

 Score = 38.4 bits (87), Expect = 0.62,   Method: Composition-based stats.
 Identities = 26/121 (21%), Positives = 41/121 (33%), Gaps = 20/121 (16%)

Query: 87  AQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDV 146
            ++Q   K   +E  D +  +  E A   +   +A      EE  +P  E   QP+ E  
Sbjct: 1   MESQETAKRPIEEPGDAVAVQDAEPATKRVKLDDAPAPQAQEEPSQPQTETQPQPQTEG- 59

Query: 147 AFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQ 206
                           K +R+     R       G  P++A   +VP    +  A  VD 
Sbjct: 60  -------------DKPKEQRQDDRDKRR------GIAPIKAEYLVVPPSQVAKTAEVVDD 100

Query: 207 D 207
           D
Sbjct: 101 D 101


>gi|24639970|ref|NP_572262.1| CG3108 [Drosophila melanogaster]
 gi|22831771|gb|AAF46083.2| CG3108 [Drosophila melanogaster]
 gi|54650714|gb|AAV36936.1| LP17541p [Drosophila melanogaster]
          Length = 1132

 Score = 38.4 bits (87), Expect = 0.62,   Method: Composition-based stats.
 Identities = 21/111 (18%), Positives = 42/111 (37%)

Query: 86  MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVED 145
            A+AQ + + Q + +    V+ Q E       E +    P  E   +P  E+  +P+ + 
Sbjct: 268 EAEAQPEAEPQLEVEPQPEVESQPEVESQPEVEAQPEVEPQSEVESQPEAESHSEPETQA 327

Query: 146 VAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQEL 196
                P++    +   +     +P R       K  +  V+ TE  + + L
Sbjct: 328 EVEAQPEVESLPEAESQPEAESQPEREPEVEAEKISDNEVDTTEASLMETL 378



 Score = 36.4 bits (82), Expect = 2.2,   Method: Composition-based stats.
 Identities = 22/117 (18%), Positives = 37/117 (31%), Gaps = 4/117 (3%)

Query: 91  IQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGK--EPIFENSIQPKVE--DV 146
             E++Q  E       EQ E      ++ E    P  E     EP  E   QP+VE    
Sbjct: 233 QPEQVQPGEYQSESDGEQAETKPEIEAQPEVEAQPEAEAQPEAEPQLEVEPQPEVESQPE 292

Query: 147 AFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASS 203
               P++  + +V  +     +P                +     +P+  +   A S
Sbjct: 293 VESQPEVEAQPEVEPQSEVESQPEAESHSEPETQAEVEAQPEVESLPEAESQPEAES 349



 Score = 36.1 bits (81), Expect = 3.0,   Method: Composition-based stats.
 Identities = 20/111 (18%), Positives = 40/111 (36%), Gaps = 6/111 (5%)

Query: 92  QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTP 151
           +E   + EQ      + +   + A ++ E    P +E   E   +   +P++E       
Sbjct: 228 EESEIQPEQVQPGEYQSESDGEQAETKPEIEAQPEVEAQPEAEAQPEAEPQLEVEPQPEV 287

Query: 152 DISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
           +   E +   +        +P V P ++  +QP EA     P+      A 
Sbjct: 288 ESQPEVESQPEVE-----AQPEVEPQSEVESQP-EAESHSEPETQAEVEAQ 332


>gi|74197989|dbj|BAE35177.1| unnamed protein product [Mus musculus]
          Length = 384

 Score = 38.4 bits (87), Expect = 0.63,   Method: Composition-based stats.
 Identities = 27/121 (22%), Positives = 45/121 (37%), Gaps = 7/121 (5%)

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALS--E 118
           A  AGD +  +   Q A    + +   QA  + + QR  + +   ++++E  Q A    E
Sbjct: 202 AKVAGDCLDEKQCKQCANKVLQHMKAVQADQERERQRRLEVEREAEKKREAKQQAKEAKE 261

Query: 119 FEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNA 178
            E       EE +    E   Q   +    K P     K  + +  + +   RPR  P  
Sbjct: 262 RELRKREKAEEKERRRKEYDAQKASKREQEKKP-----KKEANQAPKSKSGSRPRKPPPR 316

Query: 179 K 179
           K
Sbjct: 317 K 317


>gi|74196946|dbj|BAE35030.1| unnamed protein product [Mus musculus]
          Length = 386

 Score = 38.4 bits (87), Expect = 0.63,   Method: Composition-based stats.
 Identities = 27/121 (22%), Positives = 45/121 (37%), Gaps = 7/121 (5%)

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALS--E 118
           A  AGD +  +   Q A    + +   QA  + + QR  + +   ++++E  Q A    E
Sbjct: 204 AKVAGDCLDEKQCKQCANKVLQHMKAVQADQERERQRRLEVEREAEKKREAKQQAKEAKE 263

Query: 119 FEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNA 178
            E       EE +    E   Q   +    K P     K  + +  + +   RPR  P  
Sbjct: 264 RELRKREKAEEKERRRKEYDAQKASKREQEKKP-----KKEANQAPKSKSGSRPRKPPPR 318

Query: 179 K 179
           K
Sbjct: 319 K 319


>gi|225860655|ref|YP_002742164.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae Taiwan19F-14]
 gi|298229824|ref|ZP_06963505.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae str. Canada
           MDR_19F]
 gi|298502458|ref|YP_003724398.1| zinc metalloprotease [Streptococcus pneumoniae TCH8431/19A]
 gi|225727208|gb|ACO23059.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae Taiwan19F-14]
 gi|298238053|gb|ADI69184.1| zinc metalloprotease [Streptococcus pneumoniae TCH8431/19A]
 gi|327390394|gb|EGE88735.1| LPXTG-motif cell wall anchor domain protein [Streptococcus
           pneumoniae GA04375]
          Length = 1902

 Score = 38.4 bits (87), Expect = 0.63,   Method: Composition-based stats.
 Identities = 26/116 (22%), Positives = 43/116 (37%), Gaps = 8/116 (6%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPC----PLIEEGKEPIFENSIQ 140
           +  QA+ + ++   E+       + E +     + E  P     P +EEGKE   E +  
Sbjct: 186 NQEQARTENQVVEAEEAPKEEAPKTEESPKEEPKSEVKPTDDTLPKVEEGKEDSAEPAPV 245

Query: 141 PKVEDVAFKTPDISR-EKDVSYKKVRRRRPLR--PRVFPNAKSGNQPVEATETIVP 193
            +V       P+     K  S    +     +  P V   AK   QPV+ T+   P
Sbjct: 246 EEVGGEVESKPEEKVAVKPESQPSDKPAEESKVEPPV-EQAKGPEQPVQPTQAEQP 300


>gi|149636355|ref|XP_001516152.1| PREDICTED: similar to C1orf22 [Ornithorhynchus anatinus]
          Length = 1013

 Score = 38.4 bits (87), Expect = 0.63,   Method: Composition-based stats.
 Identities = 24/111 (21%), Positives = 45/111 (40%), Gaps = 8/111 (7%)

Query: 84  VSMAQAQIQEKLQRDEQ-----DDLLVKEQKERAQNAL--SEFEASPCPLIEEGKEPIFE 136
           +     +   + QR EQ      DL + + +   +N+L      ASP         P  E
Sbjct: 884 LEQKSPENDSQNQRSEQIPESSQDLSLAKPEPVGENSLVSEPDPASPVEADSTSVSPSKE 943

Query: 137 NSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEA 187
           NS  P+ ++   + P+ +   +   ++ +      P V P  K+  QP+E+
Sbjct: 944 NSRPPETQETPIQEPECTELDNQPQEQSQTEEDSSPAV-PWDKNKVQPMES 993


>gi|323444907|gb|EGB01807.1| hypothetical protein AURANDRAFT_69476 [Aureococcus anophagefferens]
          Length = 350

 Score = 38.4 bits (87), Expect = 0.64,   Method: Composition-based stats.
 Identities = 12/78 (15%), Positives = 20/78 (25%), Gaps = 5/78 (6%)

Query: 123 PCPLIEEGKEPIFENSIQPKVEDVAF----KTPDISREK-DVSYKKVRRRRPLRPRVFPN 177
           P P +     P +  + +P V          TP+ S                + P   P+
Sbjct: 219 PAPSVSPTPAPSYSPTPEPTVSPTPAPSYSPTPEPSVSPTPAPSYAPTPAPSVSPTPAPS 278

Query: 178 AKSGNQPVEATETIVPQE 195
            +    P  A        
Sbjct: 279 PEPTVSPTPAPSYSPTPA 296


>gi|296416549|ref|XP_002837939.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295633830|emb|CAZ82130.1| unnamed protein product [Tuber melanosporum]
          Length = 708

 Score = 38.4 bits (87), Expect = 0.64,   Method: Composition-based stats.
 Identities = 18/128 (14%), Positives = 41/128 (32%), Gaps = 9/128 (7%)

Query: 82  RIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQN------ALSEFEASPCPLIEEGKEPIF 135
           RI++ A+        R  +     ++    + +             +P  +  +      
Sbjct: 87  RIIASARNAAPPSANRKRRMATGDEDSYASSSSDGGVPLGTGPAPPAPKKIKTDAARAGS 146

Query: 136 ENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQE 195
              I PK + +      ++ +   S  K   +    P+   ++K+     E T   VP  
Sbjct: 147 AAPIAPKPKSILRAHAKVNSQTPSSTFKPNAQAQNSPKPKTHSKAR---AEDTSKSVPVP 203

Query: 196 LNSDNASS 203
             +  AS+
Sbjct: 204 RGAGGASA 211


>gi|167516360|ref|XP_001742521.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163779145|gb|EDQ92759.1| predicted protein [Monosiga brevicollis MX1]
          Length = 1131

 Score = 38.4 bits (87), Expect = 0.64,   Method: Composition-based stats.
 Identities = 18/106 (16%), Positives = 38/106 (35%), Gaps = 1/106 (0%)

Query: 99  EQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKD 158
             D L + + + RAQ+ L+          +           +P+ E      P+++ E  
Sbjct: 360 RTDILDMSDSESRAQSELTPKALPKTEGSKTEGSKTAGPKTEPQPESKPESKPELNPEPK 419

Query: 159 VSYKKVRRRRPLR-PRVFPNAKSGNQPVEATETIVPQELNSDNASS 203
              K   +      P+V P A+   +P    +     + ++DN  +
Sbjct: 420 PEPKVEAKAESRTLPKVLPKAEPKGEPEHTPKASSKSKASTDNGLT 465


>gi|84618128|emb|CAJ19701.1| surface protein [Streptococcus agalactiae]
 gi|115252915|emb|CAJ66786.1| putative cell-wall anchored surface adhesin [Streptococcus
           agalactiae]
 gi|115252941|emb|CAJ66799.1| putative cell-wall anchored surface adhesin [Streptococcus
           agalactiae]
 gi|115252945|emb|CAJ66801.1| putative cell-wall anchored surface adhesin [Streptococcus
           agalactiae]
 gi|115252949|emb|CAJ66803.1| putative cell-wall anchored surface adhesin [Streptococcus
           agalactiae]
 gi|115252951|emb|CAJ66804.1| putative cell-wall anchored surface adhesin [Streptococcus
           agalactiae]
 gi|115252953|emb|CAJ66805.1| putative cell-wall anchored surface adhesin [Streptococcus
           agalactiae]
 gi|115252955|emb|CAJ66806.1| putative cell-wall anchored surface adhesin [Streptococcus
           agalactiae]
 gi|115252961|emb|CAJ66809.1| putative cell-wall anchored surface adhesin [Streptococcus
           agalactiae]
 gi|115252963|emb|CAJ66810.1| putative cell-wall anchored surface adhesin [Streptococcus
           agalactiae]
 gi|115252967|emb|CAJ66812.1| putative cell-wall anchored surface adhesin [Streptococcus
           agalactiae]
 gi|115252971|emb|CAJ66814.1| putative cell-wall anchored surface adhesin [Streptococcus
           agalactiae]
 gi|255961197|gb|ACU44474.1| BibA [Streptococcus agalactiae]
 gi|255961199|gb|ACU44475.1| BibA [Streptococcus agalactiae]
 gi|255961203|gb|ACU44477.1| BibA [Streptococcus agalactiae]
 gi|255961205|gb|ACU44478.1| BibA [Streptococcus agalactiae]
 gi|255961207|gb|ACU44479.1| BibA [Streptococcus agalactiae]
 gi|255961209|gb|ACU44480.1| BibA [Streptococcus agalactiae]
 gi|255961211|gb|ACU44481.1| BibA [Streptococcus agalactiae]
          Length = 594

 Score = 38.4 bits (87), Expect = 0.64,   Method: Composition-based stats.
 Identities = 14/74 (18%), Positives = 27/74 (36%), Gaps = 5/74 (6%)

Query: 124 CPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRP-----LRPRVFPNA 178
            P ++   +P  +  ++P V+  A        + DV  +     +P     ++P V P A
Sbjct: 468 KPDVKPEAKPEAKPEVKPDVKPEAKPEAKPEVKSDVKPEAKPEAKPEAKPEVKPDVKPEA 527

Query: 179 KSGNQPVEATETIV 192
           K   +P        
Sbjct: 528 KPEAKPATKKSVNT 541


>gi|225865294|ref|YP_002750672.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus
           03BB102]
 gi|225790753|gb|ACO30970.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus
           03BB102]
          Length = 607

 Score = 38.4 bits (87), Expect = 0.66,   Method: Composition-based stats.
 Identities = 13/93 (13%), Positives = 38/93 (40%)

Query: 71  ENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEG 130
           E   Q  + +    ++ + +  +  Q   ++      ++E+ +   ++   S  P   + 
Sbjct: 138 ETLQQTLDKFGTCKTVEEPKTDDPKQEKPEEPKTDDLKQEKPEEPKTDDPKSEKPEEPKT 197

Query: 131 KEPIFENSIQPKVEDVAFKTPDISREKDVSYKK 163
            +P  E   +PK +D   + PD ++  +   ++
Sbjct: 198 DDPKQEKPEEPKTDDPKQENPDGTKTPEQPKQE 230



 Score = 38.0 bits (86), Expect = 0.96,   Method: Composition-based stats.
 Identities = 13/108 (12%), Positives = 34/108 (31%), Gaps = 3/108 (2%)

Query: 100 QDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDV 159
           ++      ++E+ +   ++      P   +  +P  E   +PK +D   + P+   E   
Sbjct: 154 EEPKTDDPKQEKPEEPKTDDLKQEKPEEPKTDDPKSEKPEEPKTDDPKQEKPE---EPKT 210

Query: 160 SYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQD 207
              K       +    P  ++   P       + +         ++ D
Sbjct: 211 DDPKQENPDGTKTPEQPKQENIQVPAAQVNEAISKTSEKMLQDGIESD 258


>gi|49117362|gb|AAH72701.1| Zgc:110800 protein [Danio rerio]
          Length = 460

 Score = 38.4 bits (87), Expect = 0.66,   Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 28/83 (33%), Gaps = 1/83 (1%)

Query: 118 EFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPL-RPRVFP 176
             E  P P       P+ E +        A  TP+ S E      K     PL  P    
Sbjct: 267 PSEPEPNPAPALEAAPVTEAAPVEDTVPDAESTPEPSPEPLAETVKESTIEPLEAPAAGA 326

Query: 177 NAKSGNQPVEATETIVPQELNSD 199
              +  +P  ++ET V   + SD
Sbjct: 327 VIDTAPEPTPSSETEVTSVVESD 349


>gi|15828260|ref|NP_302523.1| hypothetical protein ML2337 [Mycobacterium leprae TN]
 gi|221230737|ref|YP_002504153.1| hypothetical protein MLBr_02337 [Mycobacterium leprae Br4923]
 gi|3150101|emb|CAA19153.1| hypothetical protein MLCB2407.13c [Mycobacterium leprae]
 gi|13093953|emb|CAC31853.1| putative membrane protein [Mycobacterium leprae]
 gi|219933844|emb|CAR72435.1| putative membrane protein [Mycobacterium leprae Br4923]
          Length = 250

 Score = 38.4 bits (87), Expect = 0.66,   Method: Composition-based stats.
 Identities = 17/74 (22%), Positives = 27/74 (36%), Gaps = 13/74 (17%)

Query: 101 DDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDIS-----R 155
           D+    E+ +  ++  +E  A          E +   + QP  E  A K PD        
Sbjct: 166 DNEAEDEEADAGEHNEAETPA--------QAEEVTSENPQPAPESGAQKEPDELLANKTE 217

Query: 156 EKDVSYKKVRRRRP 169
           E D   + +  RRP
Sbjct: 218 ETDEPRRGLHNRRP 231


>gi|324509587|gb|ADY44028.1| HBS1-like protein [Ascaris suum]
          Length = 639

 Score = 38.4 bits (87), Expect = 0.66,   Method: Composition-based stats.
 Identities = 28/153 (18%), Positives = 45/153 (29%), Gaps = 18/153 (11%)

Query: 60  DAMSAGDYVVAENHLQHAEHYNRIVSM------AQAQIQEKLQRDEQDDLLVKEQKERAQ 113
           +     D V  E+  Q     +R+V        AQ           Q D           
Sbjct: 65  EEQLENDVVYDEHDSQFELEVDRLVPETKKSLPAQPSSSVTFITSRQRDRKAPAGANAKV 124

Query: 114 NALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPR 173
           +   + + +P    +E +  +      P+VE+         R  +VS K         P 
Sbjct: 125 STEEKRDQTPKRAAKEEQPRLLI----PEVEN--------LRLSEVSEKARGDSSVRPPT 172

Query: 174 VFPNAKSGNQPVEATETIVPQELNSDNASSVDQ 206
           + PNA S      A     P         +VD+
Sbjct: 173 LTPNASSKRLSALAVAQATPTASPKVRHRTVDE 205


>gi|108797429|ref|YP_637626.1| hypothetical protein Mmcs_0449 [Mycobacterium sp. MCS]
 gi|119866513|ref|YP_936465.1| hypothetical protein Mkms_0459 [Mycobacterium sp. KMS]
 gi|108767848|gb|ABG06570.1| conserved hypothetical proline rich protein [Mycobacterium sp. MCS]
 gi|119692602|gb|ABL89675.1| conserved hypothetical proline rich protein [Mycobacterium sp. KMS]
          Length = 611

 Score = 38.4 bits (87), Expect = 0.66,   Method: Composition-based stats.
 Identities = 12/60 (20%), Positives = 18/60 (30%), Gaps = 1/60 (1%)

Query: 121 ASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKS 180
             P P  E   EP      +P V       P+                P +P   P+A++
Sbjct: 551 QEPQPTQEPEPEPTVAPEPEPTVVPEPTVAPEPESTAAPEPSAEAPAEP-QPECVPDAET 609



 Score = 35.3 bits (79), Expect = 4.8,   Method: Composition-based stats.
 Identities = 10/52 (19%), Positives = 14/52 (26%)

Query: 113 QNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKV 164
           Q      E  P P +    EP          E  +   P+ S E     +  
Sbjct: 551 QEPQPTQEPEPEPTVAPEPEPTVVPEPTVAPEPESTAAPEPSAEAPAEPQPE 602


>gi|312885078|ref|ZP_07744766.1| hypothetical protein VIBC2010_16929 [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309367288|gb|EFP94852.1| hypothetical protein VIBC2010_16929 [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 488

 Score = 38.4 bits (87), Expect = 0.67,   Method: Composition-based stats.
 Identities = 17/81 (20%), Positives = 30/81 (37%), Gaps = 3/81 (3%)

Query: 123 PCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGN 182
             P  ++  EP    + QPK+   A  +P     + V+ K     +P  P      KS  
Sbjct: 241 QTPSFKKQPEPSLTQAQQPKIHQQAESSP---VREPVNQKWEEVTQPFTPSSQQTQKSEE 297

Query: 183 QPVEATETIVPQELNSDNASS 203
            P    + ++P+   S    +
Sbjct: 298 TPTPKVDVVIPEAAVSQAVET 318


>gi|95981804|gb|ABF57893.1| ballchen [Drosophila simulans]
          Length = 603

 Score = 38.4 bits (87), Expect = 0.67,   Method: Composition-based stats.
 Identities = 16/68 (23%), Positives = 23/68 (33%), Gaps = 2/68 (2%)

Query: 120 EASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK-KVRRRRPLRPRVF-PN 177
             +P P  E           +PK       TP  S +   + K   + + P   R+  PN
Sbjct: 422 RVAPAPAAESSPPGRKRVKTEPKSTPKERATPKTSPKPKGTPKASPKPQTPTAARLKTPN 481

Query: 178 AKSGNQPV 185
           AK    P 
Sbjct: 482 AKINFSPS 489


>gi|302423530|ref|XP_003009595.1| mixed-linked glucanase [Verticillium albo-atrum VaMs.102]
 gi|261352741|gb|EEY15169.1| mixed-linked glucanase [Verticillium albo-atrum VaMs.102]
          Length = 921

 Score = 38.4 bits (87), Expect = 0.67,   Method: Composition-based stats.
 Identities = 13/84 (15%), Positives = 21/84 (25%), Gaps = 3/84 (3%)

Query: 114 NALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPR 173
            + +  + +P     E   P      QP  E    + P   +             P +P 
Sbjct: 781 ESPTPEQPTPEQPTPEQPTPEQPTPEQPTPEQPTPEQPTPEQPIPEQPTPEEPLTPGQPT 840

Query: 174 V---FPNAKSGNQPVEATETIVPQ 194
                P       P      +VP 
Sbjct: 841 PDYPAPEEPVPQPPSPTASQVVPP 864


>gi|19527026|ref|NP_598568.1| leucine-rich repeat-containing protein 59 [Mus musculus]
 gi|81916386|sp|Q922Q8|LRC59_MOUSE RecName: Full=Leucine-rich repeat-containing protein 59
 gi|13905170|gb|AAH06877.1| Leucine rich repeat containing 59 [Mus musculus]
 gi|26343467|dbj|BAC35390.1| unnamed protein product [Mus musculus]
 gi|42490949|gb|AAH66172.1| Leucine rich repeat containing 59 [Mus musculus]
 gi|56206968|emb|CAI24964.1| leucine rich repeat containing 59 [Mus musculus]
 gi|74151576|dbj|BAE41137.1| unnamed protein product [Mus musculus]
 gi|148683988|gb|EDL15935.1| leucine rich repeat containing 59, isoform CRA_a [Mus musculus]
          Length = 307

 Score = 38.4 bits (87), Expect = 0.68,   Method: Composition-based stats.
 Identities = 27/121 (22%), Positives = 45/121 (37%), Gaps = 7/121 (5%)

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALS--E 118
           A  AGD +  +   Q A    + +   QA  + + QR  + +   ++++E  Q A    E
Sbjct: 125 AKVAGDCLDEKQCKQCANKVLQHMKAVQADQERERQRRLEVEREAEKKREAKQQAKEAKE 184

Query: 119 FEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNA 178
            E       EE +    E   Q   +    K P     K  + +  + +   RPR  P  
Sbjct: 185 RELRKREKAEEKERRRKEYDAQKASKREQEKKP-----KKEANQAPKSKSGSRPRKPPPR 239

Query: 179 K 179
           K
Sbjct: 240 K 240


>gi|86140761|ref|ZP_01059320.1| translation initiation factor [Leeuwenhoekiella blandensis MED217]
 gi|85832703|gb|EAQ51152.1| translation initiation factor [Leeuwenhoekiella blandensis MED217]
          Length = 929

 Score = 38.4 bits (87), Expect = 0.68,   Method: Composition-based stats.
 Identities = 24/107 (22%), Positives = 39/107 (36%), Gaps = 9/107 (8%)

Query: 110 ERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRP 169
           +  ++   +  A P    EE   P  E    P VE+   +TP    + + + KK   +  
Sbjct: 117 DLDKSGKPKPAAEPEKAKEEAPAP--EQKETPAVEEEKEETPKAEAKPEQTEKKEAPKAE 174

Query: 170 LRPRV----FPNAK---SGNQPVEATETIVPQELNSDNASSVDQDCK 209
            +P+V     P AK      +P EA +     E        +  D K
Sbjct: 175 EKPKVEAAAKPEAKKEAPKPKPAEAKKAEAKTEEPKLGDDVLKTDYK 221


>gi|261879728|ref|ZP_06006155.1| conserved hypothetical protein [Prevotella bergensis DSM 17361]
 gi|270333601|gb|EFA44387.1| conserved hypothetical protein [Prevotella bergensis DSM 17361]
          Length = 1497

 Score = 38.4 bits (87), Expect = 0.69,   Method: Composition-based stats.
 Identities = 16/92 (17%), Positives = 40/92 (43%), Gaps = 1/92 (1%)

Query: 83  IVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPK 142
           I+   + + ++++ R  Q+D L +E+ E     +++   +     +E +      +I+P+
Sbjct: 554 IIEEVKEENRQEVLRPVQEDTLPQEKVEDGNKIVADESRNESETEKEAQAAQVLPTIEPE 613

Query: 143 VEDVAFKTPDISREKDVSYK-KVRRRRPLRPR 173
            E      P I+ ++    + +  R     PR
Sbjct: 614 TEPAPEGVPVITLQRQYEQESREIRTDVESPR 645


>gi|330469184|ref|YP_004406927.1| lytic transglycosylase catalytic subunit [Verrucosispora maris
           AB-18-032]
 gi|328812155|gb|AEB46327.1| lytic transglycosylase catalytic [Verrucosispora maris AB-18-032]
          Length = 296

 Score = 38.4 bits (87), Expect = 0.71,   Method: Composition-based stats.
 Identities = 25/93 (26%), Positives = 32/93 (34%), Gaps = 7/93 (7%)

Query: 122 SPCPLIEEGKEPIFENSIQPKVEDVAFK----TPDISREKDVSYK-KVRRRRPLRPRVFP 176
           +P  L EE  +P  E   +P     A +     P +SR    S K       P +P+   
Sbjct: 36  APVALPEEETQPSSE-PAEPSPTPEAVESMGAAPKVSRSPSASPKASASPEPPPKPKRTS 94

Query: 177 NAKSGNQPVEATETIVPQELNSDNASSVDQDCK 209
            A     P   TET VP        SS     K
Sbjct: 95  TA-PRAVPKPPTETKVPPAPPKPAPSSCKPSYK 126


>gi|95981802|gb|ABF57892.1| ballchen [Drosophila simulans]
          Length = 603

 Score = 38.4 bits (87), Expect = 0.71,   Method: Composition-based stats.
 Identities = 16/68 (23%), Positives = 22/68 (32%), Gaps = 2/68 (2%)

Query: 120 EASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK-KVRRRRPLRPR-VFPN 177
             +P P  E           +PK       TP  S +   + K   + + P   R   PN
Sbjct: 422 RVAPAPAAESSPPGRKRVKTEPKSTPKERATPKTSPKPKGTPKASPKPQTPTAARLRTPN 481

Query: 178 AKSGNQPV 185
           AK    P 
Sbjct: 482 AKINFSPS 489


>gi|25349361|pir||F85073 hypothetical protein AT4g07520 [imported] - Arabidopsis thaliana
 gi|5032278|gb|AAD38226.1|AF147264_9 contains similarity to several [Arabidopsis thaliana hypothetical
           proteins including AC002983 and AF007271; my be a
           pseudogene
 gi|7267349|emb|CAB81122.1| hypothetical protein [Arabidopsis thaliana]
          Length = 734

 Score = 38.4 bits (87), Expect = 0.71,   Method: Composition-based stats.
 Identities = 22/96 (22%), Positives = 39/96 (40%), Gaps = 7/96 (7%)

Query: 77  AEHYNRIVSMAQAQ-------IQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEE 129
           AEH  R+V++ + Q        ++K+  D   +      KE+  N   E EAS  P    
Sbjct: 497 AEHNERLVTIERRQAGESVPPFEKKVHSDVNKEKEDGGNKEKNVNVAIETEASVEPEASV 556

Query: 130 GKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVR 165
             E    + ++P+  +     P+ +   DV  + V 
Sbjct: 557 EPEANETHDVEPEANETHDVEPEANETHDVEPEAVE 592


>gi|291443428|ref|ZP_06582818.1| cob(II)yrinic acid a,c-diamide reductase [Streptomyces roseosporus
           NRRL 15998]
 gi|291346375|gb|EFE73279.1| cob(II)yrinic acid a,c-diamide reductase [Streptomyces roseosporus
           NRRL 15998]
          Length = 901

 Score = 38.4 bits (87), Expect = 0.71,   Method: Composition-based stats.
 Identities = 24/115 (20%), Positives = 39/115 (33%), Gaps = 4/115 (3%)

Query: 84  VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV 143
           V  AQA    + Q           Q E+    L+     P P+ EE  EP    + +   
Sbjct: 162 VEPAQAVAVAEGQEAVVAREPAVAQPEQVAAELTPEPVQPEPVAEEPVEPAEPVAEETAG 221

Query: 144 EDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
           E    + P  + E  V+  +        P + P+A+ G  P       +  E  +
Sbjct: 222 EAAPEQEPAPTPEPAVAETEPE----AAPAIAPDAEDGTGPEVIETPELLPEPQA 272



 Score = 36.1 bits (81), Expect = 3.4,   Method: Composition-based stats.
 Identities = 15/114 (13%), Positives = 34/114 (29%)

Query: 84  VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV 143
           V     +   +   +  +   V       +   +  EA+P         P+ E   QP+ 
Sbjct: 87  VQAPADEATAQELPEPVEAQQVVVVTPEPEAQAAPVEAAPEHRAPVQASPVVEPVAQPEP 146

Query: 144 EDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELN 197
                +     +E+ V   +       +  V     +  QP +    + P+ + 
Sbjct: 147 VVQPEQVAQPEQEQPVEPAQAVAVAEGQEAVVAREPAVAQPEQVAAELTPEPVQ 200


>gi|300118301|ref|ZP_07056048.1| cell wall anchor domain-containing protein [Bacillus cereus SJ1]
 gi|298724270|gb|EFI64965.1| cell wall anchor domain-containing protein [Bacillus cereus SJ1]
          Length = 300

 Score = 38.4 bits (87), Expect = 0.72,   Method: Composition-based stats.
 Identities = 12/93 (12%), Positives = 37/93 (39%)

Query: 71  ENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEG 130
           E   Q  + +    ++ + +  +  Q   ++      ++E+ +   ++      P   + 
Sbjct: 138 ETLQQTLDKFGTCKTVEEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTDDPKQEKPEEPKT 197

Query: 131 KEPIFENSIQPKVEDVAFKTPDISREKDVSYKK 163
            +P  E   +PK +D   + PD ++  +   ++
Sbjct: 198 DDPKQEKPEEPKTDDSKQENPDGTKTPEQPKQE 230



 Score = 35.3 bits (79), Expect = 5.9,   Method: Composition-based stats.
 Identities = 13/108 (12%), Positives = 34/108 (31%), Gaps = 3/108 (2%)

Query: 100 QDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDV 159
           ++      ++E+ +   ++      P   +  +P  E   +PK +D   + P+   E   
Sbjct: 154 EEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTDDPKQEKPE---EPKT 210

Query: 160 SYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQD 207
              K       +    P  ++   P       + +         ++ D
Sbjct: 211 DDSKQENPDGTKTPEQPKQENIQVPAAQVNDAISKTSEKMLQDGIESD 258


>gi|195574224|ref|XP_002105089.1| GD18116 [Drosophila simulans]
 gi|194201016|gb|EDX14592.1| GD18116 [Drosophila simulans]
          Length = 603

 Score = 38.4 bits (87), Expect = 0.72,   Method: Composition-based stats.
 Identities = 16/68 (23%), Positives = 24/68 (35%), Gaps = 2/68 (2%)

Query: 120 EASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK-KVRRRRPLRPRVF-PN 177
             +P P  E           +PK   +   TP  S +   + K   + + P   R+  PN
Sbjct: 422 RVAPAPAAESSPPGRKRVKTEPKSTPMERATPKTSPKPKGTPKASPKPQTPTAARLKTPN 481

Query: 178 AKSGNQPV 185
           AK    P 
Sbjct: 482 AKINFSPS 489


>gi|124430474|dbj|BAF46263.1| putative zinc metalloprotease [Streptococcus pneumoniae]
          Length = 1877

 Score = 38.4 bits (87), Expect = 0.72,   Method: Composition-based stats.
 Identities = 26/116 (22%), Positives = 43/116 (37%), Gaps = 8/116 (6%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPC----PLIEEGKEPIFENSIQ 140
           +  QA+ + ++   E+       + E +     + E  P     P +EEGKE   E +  
Sbjct: 161 NQEQARTENQVVEAEEAPKEEAPKTEESPKEEPKSEVKPTDDTLPKVEEGKEDSAEPAPV 220

Query: 141 PKVEDVAFKTPDISR-EKDVSYKKVRRRRPLR--PRVFPNAKSGNQPVEATETIVP 193
            +V       P+     K  S    +     +  P V   AK   QPV+ T+   P
Sbjct: 221 EEVGGEVESKPEEKVAVKPESQPSDKPAEESKVEPPV-EQAKGPEQPVQPTQAEQP 275


>gi|330800495|ref|XP_003288271.1| hypothetical protein DICPUDRAFT_33784 [Dictyostelium purpureum]
 gi|325081676|gb|EGC35183.1| hypothetical protein DICPUDRAFT_33784 [Dictyostelium purpureum]
          Length = 1800

 Score = 38.4 bits (87), Expect = 0.72,   Method: Composition-based stats.
 Identities = 31/202 (15%), Positives = 67/202 (33%), Gaps = 24/202 (11%)

Query: 2    RSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDA 61
            R ++   + R R S       + +N     RN  S+  D   RG ++   +  + L RD+
Sbjct: 1408 RDIRDRSKERERESTRTENRSDNRNDFRDNRNDRSDRNDRNDRGESK---DGRNEL-RDS 1463

Query: 62   MSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEA 121
                D                         + + +RD  D  +  E+ ER +   S  E 
Sbjct: 1464 -GRNDR-----------------GERNDLREGRNERDRSDKDIKNERSERNERNESRAER 1505

Query: 122  SPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSG 181
                  ++  +   +N     +++   +  + +   D + +  R  R  R       K+ 
Sbjct: 1506 DNKSDNKDKNDRDIKNDR--DIKNDRNERSERNERNDRNERNDRNDRGDRNESKERNKNN 1563

Query: 182  NQPVEATETIVPQELNSDNASS 203
              P ++     P   +++   +
Sbjct: 1564 ETPQQSPPQKSPPHRSNNRNEN 1585


>gi|298529940|ref|ZP_07017342.1| CheA signal transduction histidine kinase [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298509314|gb|EFI33218.1| CheA signal transduction histidine kinase [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 1094

 Score = 38.4 bits (87), Expect = 0.72,   Method: Composition-based stats.
 Identities = 19/95 (20%), Positives = 37/95 (38%), Gaps = 7/95 (7%)

Query: 112 AQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDV-SYKKVRRRRPL 170
           + ++  + + SP P     KEP  E   Q   E+   + P++  E         +  +P 
Sbjct: 262 SDSSTLDAQNSPQP----EKEPEHEQVYQEDEEEDKAREPEVEPETKAPPPPDPQEEKPA 317

Query: 171 RPRVFPNAKSGNQP--VEATETIVPQELNSDNASS 203
            P+     KS  +P   +  +   PQ+  +  A +
Sbjct: 318 PPQAEQKEKSQARPQKTQPDKDKKPQDKQAAQAQT 352


>gi|257898505|ref|ZP_05678158.1| cell wall surface adhesion protein [Enterococcus faecium Com15]
 gi|257836417|gb|EEV61491.1| cell wall surface adhesion protein [Enterococcus faecium Com15]
          Length = 376

 Score = 38.4 bits (87), Expect = 0.72,   Method: Composition-based stats.
 Identities = 18/116 (15%), Positives = 38/116 (32%), Gaps = 2/116 (1%)

Query: 88  QAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVA 147
           + + + K      ++   ++Q E       + E  P P  E   E   E       E   
Sbjct: 185 KPENENKPDIPPTENPDGEQQPEIESGEEPDTEMKPEPDNESKPETTPEEKPGTDNETEN 244

Query: 148 FKTPDISREKDVSYKKVRRR-RPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
            + PD++ E      + +    P  P   P      + + +T+    +E    + +
Sbjct: 245 PEKPDVTPEPPNRVPEEKPDVSPEMPEKTPETNITAKEI-STQKDEKKESQKIDTT 299


>gi|88866509|gb|ABD57304.1| REV3 [Neurospora crassa]
          Length = 1581

 Score = 38.4 bits (87), Expect = 0.72,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 35/94 (37%), Gaps = 5/94 (5%)

Query: 82  RIVSMAQAQIQEK-LQRDEQDDLLVKEQK--ERAQNALSEFEASPCPLIEEGKEPI-FEN 137
           R+   AQ ++  K  QR  + D    +QK  E+ Q+          P       P+    
Sbjct: 563 RVHEEAQPEVDRKAQQRSREHDQKQGQQKIQEQTQDHDQGGGQKEAPENSTFTTPVRTVQ 622

Query: 138 SIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLR 171
            ++P  +D A +         V   K R  +P++
Sbjct: 623 PMKPNNQDSAGEE-QSMNSLQVEPPKPRTSQPMK 655


>gi|294656125|ref|XP_002770225.1| DEHA2C15774p [Debaryomyces hansenii CBS767]
 gi|199430877|emb|CAR65588.1| DEHA2C15774p [Debaryomyces hansenii]
          Length = 1100

 Score = 38.4 bits (87), Expect = 0.73,   Method: Composition-based stats.
 Identities = 32/174 (18%), Positives = 66/174 (37%), Gaps = 18/174 (10%)

Query: 41  VKVRGTAQHIAERYSV---LAR-DAMSAGDYVV--AENHLQHAEHYNRIVSMAQAQIQEK 94
             +R   Q + + Y+    L R +A       +   E   Q  E   R++   Q Q +  
Sbjct: 106 GNLREITQWLTDNYNKAEILGRHEAELKRQRELGQEEKMKQEKE---RLLREYQRQEEIN 162

Query: 95  LQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDIS 154
            +R++++    +++ +   +   + + SP  +   GK  I   +  P    V  ++P+  
Sbjct: 163 QRREQEEKERSEKEGQNIDDQYDDEDLSPIKVR--GKARIKSAAPPPPPPPVLLESPEKQ 220

Query: 155 REKDVSYKKVR----RRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSV 204
               V   K +     +   +P+  P+     +P E    I P+      AS+V
Sbjct: 221 SSTKVHISKPKVSILDKYKYKPKQQPSIDQVFRPQE---DIQPKRRKLVRASTV 271


>gi|77406642|ref|ZP_00783686.1| pathogenicity protein, putative [Streptococcus agalactiae H36B]
 gi|77174742|gb|EAO77567.1| pathogenicity protein, putative [Streptococcus agalactiae H36B]
          Length = 800

 Score = 38.4 bits (87), Expect = 0.73,   Method: Composition-based stats.
 Identities = 26/134 (19%), Positives = 45/134 (33%), Gaps = 9/134 (6%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKE--PIFENSIQPK 142
            +A          + +D  + K + +      ++ EA P    E   E  P  +   +P 
Sbjct: 581 QLANKLRDALQSLELKDKKVAKPEAKPEVKPEAKPEAKPEAKPEAKPEVKPDVKPEAKPD 640

Query: 143 VEDVAFKTPDISREKDVSYK-----KVRRRRPLRPRVFPNAKSGNQP--VEATETIVPQE 195
           V+  A        + DV  +     K   +  ++P V P AK   +P      +  V  E
Sbjct: 641 VKPEAKPDVKPEVKPDVKPEAKPDVKPEAKPDVKPEVKPEAKPEAKPEAKPEIKPDVKPE 700

Query: 196 LNSDNASSVDQDCK 209
              +    V  D K
Sbjct: 701 ARPEAKPEVKPDVK 714



 Score = 38.0 bits (86), Expect = 0.82,   Method: Composition-based stats.
 Identities = 17/108 (15%), Positives = 41/108 (37%), Gaps = 1/108 (0%)

Query: 86  MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVED 145
             + + +  ++ + + D+  + + +    A  + +    P  +   +P  +  I+P V+ 
Sbjct: 640 DVKPEAKPDVKPEVKPDVKPEAKPDVKPEAKPDVKPEVKPEAKPEAKPEAKPEIKPDVKP 699

Query: 146 VAFKTPDISREKDVSYKKVRRRRP-LRPRVFPNAKSGNQPVEATETIV 192
            A        + DV  +     +P ++P V P AK   +P        
Sbjct: 700 EARPEAKPEVKPDVKPEAKPEAKPEVKPDVKPEAKPEAKPATKKSVNT 747



 Score = 36.4 bits (82), Expect = 2.3,   Method: Composition-based stats.
 Identities = 17/97 (17%), Positives = 32/97 (32%), Gaps = 1/97 (1%)

Query: 93  EKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPD 152
           ++  +         +  E     +++ EA P    E   E   E   + K E      P+
Sbjct: 577 DQANQLANKLRDALQSLELKDKKVAKPEAKPEVKPEAKPEAKPEAKPEAKPEVKPDVKPE 636

Query: 153 ISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATE 189
              +      K   +  ++P V P AK   +P    +
Sbjct: 637 AKPDVK-PEAKPDVKPEVKPDVKPEAKPDVKPEAKPD 672


>gi|229197422|ref|ZP_04324149.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus m1293]
 gi|228586046|gb|EEK44137.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus m1293]
          Length = 601

 Score = 38.4 bits (87), Expect = 0.74,   Method: Composition-based stats.
 Identities = 14/101 (13%), Positives = 37/101 (36%), Gaps = 2/101 (1%)

Query: 100 QDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDV 159
           ++      ++E+ +   ++      P   +  +P  E   +PK +D   + P+    K  
Sbjct: 154 EEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTDDPKQEKPE--EPKTD 211

Query: 160 SYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDN 200
             K+ +  +P +  +       N  +  T   + Q+    +
Sbjct: 212 DPKQEKPEQPKQENIQIPVAQVNDAISKTSEKMLQDGIESD 252


>gi|114600474|ref|XP_517788.2| PREDICTED: caspase recruitment domain-containing protein 6 isoform 2
            [Pan troglodytes]
          Length = 1037

 Score = 38.0 bits (86), Expect = 0.74,   Method: Composition-based stats.
 Identities = 20/119 (16%), Positives = 38/119 (31%), Gaps = 3/119 (2%)

Query: 74   LQHAEHYNRIVSMAQAQIQEKLQRDEQDD-LLVKEQKERAQNALSEFEASPCPLIEEGKE 132
             Q A    ++   +Q   Q K Q    +  L +        +     +++P  +     +
Sbjct: 899  FQPAGATQKLRPASQQGAQMKTQGGASNPALQIGSHPMSKSSQFKSDQSNPSTVKHSQPK 958

Query: 133  PIFENSIQPKVEDVAFKTPDISREKDVSYKK--VRRRRPLRPRVFPNAKSGNQPVEATE 189
            P      QPK           S+ K    K    +  +P  P+  P+     QP  ++ 
Sbjct: 959  PFRSVPSQPKSSQTKSCQSQPSQTKPSPCKSTQPKPSQPRPPQSKPSQPRPTQPKSSST 1017


>gi|110833809|ref|YP_692668.1| cell division protein ZipA [Alcanivorax borkumensis SK2]
 gi|110646920|emb|CAL16396.1| cell division protein ZipA [Alcanivorax borkumensis SK2]
          Length = 306

 Score = 38.0 bits (86), Expect = 0.74,   Method: Composition-based stats.
 Identities = 16/96 (16%), Positives = 32/96 (33%), Gaps = 4/96 (4%)

Query: 82  RIVSMAQAQIQEKLQ---RDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENS 138
           R++  A  + Q++      +  +        E+     +E  ++P P      +P    +
Sbjct: 64  RVIRRAMEEDQKERPPMVMEPDEAAADTRTAEQQSLFEAEQGSAPQPGGAPEPQPEVAPA 123

Query: 139 IQP-KVEDVAFKTPDISREKDVSYKKVRRRRPLRPR 173
             P  VE     TP+         +   +  P  PR
Sbjct: 124 PNPSAVERQPESTPEPREAPRQEPRIEPKAAPKTPR 159



 Score = 38.0 bits (86), Expect = 0.75,   Method: Composition-based stats.
 Identities = 21/111 (18%), Positives = 41/111 (36%), Gaps = 2/111 (1%)

Query: 84  VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV 143
           +  +   I+  ++ D+++   +  + + A       E       E+G  P    + +P+ 
Sbjct: 59  LIGSARVIRRAMEEDQKERPPMVMEPDEAAADTRTAEQQSLFEAEQGSAPQPGGAPEPQP 118

Query: 144 EDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNA--KSGNQPVEATETIV 192
           E      P     +  S  + R      PR+ P A  K+  +P    E IV
Sbjct: 119 EVAPAPNPSAVERQPESTPEPREAPRQEPRIEPKAAPKTPREPQPVLEVIV 169


>gi|320165831|gb|EFW42730.1| conserved hypothetical protein [Capsaspora owczarzaki ATCC 30864]
          Length = 830

 Score = 38.0 bits (86), Expect = 0.75,   Method: Composition-based stats.
 Identities = 21/140 (15%), Positives = 52/140 (37%), Gaps = 4/140 (2%)

Query: 59  RDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSE 118
           R+    G  +V E  L  +  + R+++  +   +      +Q+       +  + N    
Sbjct: 403 REVQGKG-KIVNERWLTDSHKHRRLMNWRKYTYEPVTDESDQEQEQPPPPRTPSPNKPPS 461

Query: 119 FEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPL---RPRVF 175
             ++  P   + ++P   +    +    A K   ++ + D   +   R+RPL   +P   
Sbjct: 462 SHSASLPHTPKQQQPTAASPPLRQTPPSAAKRRAVASDTDEDEQSPLRQRPLPAPQPSSV 521

Query: 176 PNAKSGNQPVEATETIVPQE 195
             +K     V+ +  + P+ 
Sbjct: 522 HASKRARLEVDESNEVSPRA 541


>gi|158285445|ref|XP_308312.4| AGAP007563-PB [Anopheles gambiae str. PEST]
 gi|157019995|gb|EAA45411.4| AGAP007563-PB [Anopheles gambiae str. PEST]
          Length = 7484

 Score = 38.0 bits (86), Expect = 0.75,   Method: Composition-based stats.
 Identities = 22/110 (20%), Positives = 34/110 (30%), Gaps = 10/110 (9%)

Query: 88   QAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEAS----PCPLIEEGKEPIFENSIQPKV 143
            + Q + K Q +  ++      K R      + E      P P  E       E +I+PK 
Sbjct: 5809 RRQQKPKPQEEVPEEKQWPTGKRRPLPEEPKEEVVLKPIPKPTKEVEPTESKEPTIKPKP 5868

Query: 144  EDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVP 193
                   P+   E        +   P      P  + G +PV   E   P
Sbjct: 5869 MPELDDKPEPELEL------EQPAVPEEDTSLPPWRRGKKPVPKREIPAP 5912



 Score = 36.8 bits (83), Expect = 1.9,   Method: Composition-based stats.
 Identities = 20/119 (16%), Positives = 38/119 (31%), Gaps = 8/119 (6%)

Query: 86   MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVED 145
              + + QE++  ++Q     +             +  P P  E   +   E +I+PK   
Sbjct: 5595 QQKPKPQEEVPEEKQWPTGKRRPLPEEPKEEIVLKPIPKPTKENEPKETKEQTIKPKPIS 5654

Query: 146  VAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSV 204
                 P+   E        +   P      P  + G +PVE  +  +P     +    V
Sbjct: 5655 ELDDKPEPELEL------EKPAVPEEDTSLPPWRRGKKPVE--KKPLPPPAEPEKVEQV 5705



 Score = 36.4 bits (82), Expect = 2.4,   Method: Composition-based stats.
 Identities = 22/121 (18%), Positives = 37/121 (30%), Gaps = 10/121 (8%)

Query: 88   QAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEAS----PCPLIEEGKEPIFENSIQPKV 143
            + Q + K Q +  ++      K R      + E      P P  E   +   E +I+PK 
Sbjct: 5377 RRQQKLKPQEEVPEEKQWPTGKRRPLPEEPKEEVVLKPIPKPTKENEPKETKEQTIKPKP 5436

Query: 144  EDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASS 203
                   P+   E        +   P      P  + G + VE      P E       +
Sbjct: 5437 MPELDDKPEPELEL------EKPAVPEEDTSLPPWRRGKKSVEKKPLPTPAEPEKVEQVT 5490

Query: 204  V 204
            +
Sbjct: 5491 L 5491


>gi|115252947|emb|CAJ66802.1| putative cell-wall anchored surface adhesin [Streptococcus
           agalactiae]
          Length = 639

 Score = 38.0 bits (86), Expect = 0.76,   Method: Composition-based stats.
 Identities = 18/102 (17%), Positives = 32/102 (31%), Gaps = 3/102 (2%)

Query: 93  EKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPD 152
           ++  +         +  E     +++ EA P    E   E   E   + K E      P+
Sbjct: 484 DQANQLANKLRDALQSLELKDKKVAKPEAKPEAKPEAKPEAKPEAKPEAKPEAKPDVKPE 543

Query: 153 ISREKDVSYKKVRRRRPLRPRVFPNAKSGNQP--VEATETIV 192
              +      K   +   +    P AK   +P    AT+  V
Sbjct: 544 AKPDVK-PEAKPEAKPEAKSEAKPEAKLEAKPEAKPATKKSV 584


>gi|95981806|gb|ABF57894.1| ballchen [Drosophila simulans]
          Length = 603

 Score = 38.0 bits (86), Expect = 0.76,   Method: Composition-based stats.
 Identities = 16/68 (23%), Positives = 23/68 (33%), Gaps = 2/68 (2%)

Query: 120 EASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK-KVRRRRPLRPRVF-PN 177
             +P P  E           +PK       TP  S +   + K   + + P   R+  PN
Sbjct: 422 RVAPAPAAESSPPGRKRVKTEPKSTPKERATPKTSPKPKGTPKASPKPQTPTAARLKTPN 481

Query: 178 AKSGNQPV 185
           AK    P 
Sbjct: 482 AKINFSPS 489


>gi|95981796|gb|ABF57889.1| ballchen [Drosophila simulans]
          Length = 603

 Score = 38.0 bits (86), Expect = 0.76,   Method: Composition-based stats.
 Identities = 16/68 (23%), Positives = 23/68 (33%), Gaps = 2/68 (2%)

Query: 120 EASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK-KVRRRRPLRPRVF-PN 177
             +P P  E           +PK       TP  S +   + K   + + P   R+  PN
Sbjct: 422 RVAPAPAAESSPPGRKRVKTEPKSTPKERATPKTSPKPKGTPKASPKPQTPTAARLKTPN 481

Query: 178 AKSGNQPV 185
           AK    P 
Sbjct: 482 AKINFSPS 489


>gi|195565283|ref|XP_002106231.1| GD16230 [Drosophila simulans]
 gi|194203605|gb|EDX17181.1| GD16230 [Drosophila simulans]
          Length = 1114

 Score = 38.0 bits (86), Expect = 0.76,   Method: Composition-based stats.
 Identities = 14/96 (14%), Positives = 38/96 (39%), Gaps = 4/96 (4%)

Query: 86  MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGK----EPIFENSIQP 141
            AQ + + +L+ + Q ++  + + E      ++ E  P P +E       +P  E+  +P
Sbjct: 264 EAQPEAEPQLEVEPQPEVESQPEVESQPEVEAQPEVEPQPEVEPQPEVETQPEAESQSEP 323

Query: 142 KVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPN 177
           + +      P++    +   +  +       ++  N
Sbjct: 324 ETQPEVEAQPEVETLPEAESQPEKEPEVEAEKISDN 359



 Score = 36.8 bits (83), Expect = 1.8,   Method: Composition-based stats.
 Identities = 18/115 (15%), Positives = 44/115 (38%), Gaps = 4/115 (3%)

Query: 86  MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLI----EEGKEPIFENSIQP 141
            AQ +++ + + + Q ++  + + E      S+ E    P +    E   +P  E   + 
Sbjct: 258 EAQPEVEAQPEAEPQLEVEPQPEVESQPEVESQPEVEAQPEVEPQPEVEPQPEVETQPEA 317

Query: 142 KVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQEL 196
           + +      P++  + +V        +P +       K  +  V+ TE  + + L
Sbjct: 318 ESQSEPETQPEVEAQPEVETLPEAESQPEKEPEVEAEKISDNEVDTTEASLMETL 372



 Score = 35.3 bits (79), Expect = 5.5,   Method: Composition-based stats.
 Identities = 20/106 (18%), Positives = 36/106 (33%), Gaps = 3/106 (2%)

Query: 92  QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKE--PIFENSIQPKVEDVAFK 149
           +E   + EQ      + +   + A  + E    P +E   E  P  E   QP+VE     
Sbjct: 228 EESETQPEQVKPEEYQSESDGELAEKKPEIEAQPEVEAQPEAEPQLEVEPQPEVESQPEV 287

Query: 150 TPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQE 195
                 E      + +     +P V    ++ +Q    T+  V  +
Sbjct: 288 ESQPEVEAQ-PEVEPQPEVEPQPEVETQPEAESQSEPETQPEVEAQ 332


>gi|73945441|ref|XP_857366.1| PREDICTED: similar to vacuolar protein sorting factor 4B isoform 8
           [Canis familiaris]
          Length = 468

 Score = 38.0 bits (86), Expect = 0.76,   Method: Composition-based stats.
 Identities = 29/116 (25%), Positives = 42/116 (36%), Gaps = 12/116 (10%)

Query: 51  AERYSVLARDAMS---AGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKE 107
            ++   LA  A     AG+Y  A    QHA  Y   V   +AQ  +  Q          +
Sbjct: 8   FQKAVDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLD 67

Query: 108 QKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKK 163
           + E+ +  L + E +P   ++EG         QP   D      D   E D   KK
Sbjct: 68  RAEKLKEYLKKKEKTPQKPVKEG---------QPSPADEKGNDSDGEGETDDPEKK 114


>gi|241948121|ref|XP_002416783.1| sulfur metabolism repression control protein, putative [Candida
           dubliniensis CD36]
 gi|223640121|emb|CAX44367.1| sulfur metabolism repression control protein, putative [Candida
           dubliniensis CD36]
          Length = 715

 Score = 38.0 bits (86), Expect = 0.77,   Method: Composition-based stats.
 Identities = 30/160 (18%), Positives = 57/160 (35%), Gaps = 7/160 (4%)

Query: 40  DVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDE 99
           D +    A  ++ ++  LA D     D V      QH +            +  K  R+ 
Sbjct: 229 DCRSLCNAAQVSRKWKSLADD-----DRVWHYMCQQHIDRKCPNCGWGLPLMHMKRAREM 283

Query: 100 QDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDV 159
            DD  +K  K   +    + +  P     + +  + +   QP  + +   TP+ + +K +
Sbjct: 284 TDDDNIKPIKRNDEQQQQQQQQQPQQGSSQSQ--VLDAEGQPDKKKLKLDTPEDNHKKTI 341

Query: 160 SYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSD 199
               V ++RP +       K      + T TI     +SD
Sbjct: 342 PPSVVVKKRPWKSVYSERFKLEKNWRKGTHTIKTFTGHSD 381


>gi|153807176|ref|ZP_01959844.1| hypothetical protein BACCAC_01454 [Bacteroides caccae ATCC 43185]
 gi|149130296|gb|EDM21506.1| hypothetical protein BACCAC_01454 [Bacteroides caccae ATCC 43185]
          Length = 489

 Score = 38.0 bits (86), Expect = 0.77,   Method: Composition-based stats.
 Identities = 23/88 (26%), Positives = 33/88 (37%), Gaps = 2/88 (2%)

Query: 103 LLVKEQKERAQNALSEFEASPCPLIEEGKE-PIFENSIQPKVEDVAFKTPDISREKDVSY 161
              KE K R +        S      EG   P  E   +P+ E+  FK  + +RE+    
Sbjct: 403 RERKEYKPRREGEFKPRRESEFRPRREGDSRPRREGEYKPRREEGEFKR-EGNRERKPQG 461

Query: 162 KKVRRRRPLRPRVFPNAKSGNQPVEATE 189
           +   RR P  PR F   +    P +  E
Sbjct: 462 EFRSRRDPKAPREFKGNREPRIPKKEEE 489


>gi|9632538|ref|NP_049532.1| hypothetical protein 933Wp72 [Enterobacteria phage 933W]
 gi|15800989|ref|NP_287005.1| hypothetical protein Z1495 [Escherichia coli O157:H7 EDL933]
 gi|20065846|ref|NP_612929.1| hypothetical protein Stx2Ip050 [Stx2 converting phage I]
 gi|4585449|gb|AAD25477.1|AF125520_72 hypothetical protein [Enterobacteria phage 933W]
 gi|12514354|gb|AAG55616.1|AE005299_5 unknown protein encoded by bacteriophage BP-933W [Escherichia coli
           O157:H7 str. EDL933]
 gi|19911638|dbj|BAB87898.1| hypothetical protein [Stx2 converting phage I]
          Length = 2806

 Score = 38.0 bits (86), Expect = 0.77,   Method: Composition-based stats.
 Identities = 28/152 (18%), Positives = 51/152 (33%), Gaps = 14/152 (9%)

Query: 46  TAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLV 105
             + + E+Y+    D  + GD   A        H     S    ++ E+ +R    + L 
Sbjct: 483 NREQLLEQYAD--ADMATEGDASAA--------HRREAASQLLNELDEQTKRQAVMNELK 532

Query: 106 KEQKERAQNALSEFEASPCPLIEEGKE---PIFENSIQPKVEDVAFKTPDISREKDVS-Y 161
            + +                   E ++          Q +V   A   P+ + + + S Y
Sbjct: 533 AKPRSELLEEYRRLSQKEGRTETEEQQFQAIREVIRPQQEVTPEAQSQPENAEDGNGSIY 592

Query: 162 KKVRRRRPLRPRVFPNAKSGNQPVEATETIVP 193
             VR R P   R+  N    ++P E  E + P
Sbjct: 593 PTVRFRDPNEVRIEINGNGASRPAERIEKVRP 624


>gi|330935029|ref|XP_003304805.1| hypothetical protein PTT_17481 [Pyrenophora teres f. teres 0-1]
 gi|311318461|gb|EFQ87124.1| hypothetical protein PTT_17481 [Pyrenophora teres f. teres 0-1]
          Length = 462

 Score = 38.0 bits (86), Expect = 0.77,   Method: Composition-based stats.
 Identities = 21/108 (19%), Positives = 45/108 (41%), Gaps = 5/108 (4%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEG-KEPIFENSIQ-PK 142
           + A+ + +E    +++     + Q+E+++    + E+ P P  +E   +P  E+  Q PK
Sbjct: 155 TEAKDEPKEPASSEQETSSQPEGQQEKSEAP--KEESKPEPTKQEQKPQPTKESKPQPPK 212

Query: 143 VEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATET 190
            E      P  +       ++V+  R +R R+    K       +  T
Sbjct: 213 KESKPQDEPKPATPGSREERRVKMNR-MRLRIAERLKQSQNTAASLTT 259


>gi|195349776|ref|XP_002041418.1| GM10162 [Drosophila sechellia]
 gi|95981794|gb|ABF57888.1| ballchen [Drosophila sechellia]
 gi|194123113|gb|EDW45156.1| GM10162 [Drosophila sechellia]
          Length = 603

 Score = 38.0 bits (86), Expect = 0.77,   Method: Composition-based stats.
 Identities = 16/68 (23%), Positives = 22/68 (32%), Gaps = 2/68 (2%)

Query: 120 EASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK-KVRRRRPLRPR-VFPN 177
             +P P  E           +PK       TP  S +   + K   + + P   R   PN
Sbjct: 422 RVAPAPAAESSPPGRKRVKTEPKSTPKERATPKTSPKPKGTPKASPKPQTPTAARLRTPN 481

Query: 178 AKSGNQPV 185
           AK    P 
Sbjct: 482 AKINFSPS 489


>gi|9633467|ref|NP_050570.1| hypothetical protein VT2-Sap73 [Enterobacteria phage VT2-Sakai]
 gi|5881663|dbj|BAA84354.1| hypothetical protein [Enterobacteria phage VT2-Sakai]
 gi|32128062|dbj|BAC77866.1| hypothetical protein [Stx1 converting phage]
          Length = 2806

 Score = 38.0 bits (86), Expect = 0.77,   Method: Composition-based stats.
 Identities = 28/152 (18%), Positives = 51/152 (33%), Gaps = 14/152 (9%)

Query: 46  TAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLV 105
             + + E+Y+    D  + GD   A        H     S    ++ E+ +R    + L 
Sbjct: 483 NREQLLEQYAD--ADMATEGDASAA--------HRREAASQLLNELDEQTKRQAVMNELK 532

Query: 106 KEQKERAQNALSEFEASPCPLIEEGKE---PIFENSIQPKVEDVAFKTPDISREKDVS-Y 161
            + +                   E ++          Q +V   A   P+ + + + S Y
Sbjct: 533 AKPRSELLEEYRRLSQKEGRTETEEQQFQAIREVIRPQQEVTPEAQSQPENAEDGNGSIY 592

Query: 162 KKVRRRRPLRPRVFPNAKSGNQPVEATETIVP 193
             VR R P   R+  N    ++P E  E + P
Sbjct: 593 PTVRFRDPNEVRIEINGNGASRPAERIEKVRP 624


>gi|7649900|dbj|BAA94178.1| hypothetical protein [Enterobacteria phage VT2-Sakai]
          Length = 2806

 Score = 38.0 bits (86), Expect = 0.77,   Method: Composition-based stats.
 Identities = 28/152 (18%), Positives = 51/152 (33%), Gaps = 14/152 (9%)

Query: 46  TAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLV 105
             + + E+Y+    D  + GD   A        H     S    ++ E+ +R    + L 
Sbjct: 483 NREQLLEQYAD--ADMATEGDASAA--------HRREAASQLLNELDEQTKRQAVMNELK 532

Query: 106 KEQKERAQNALSEFEASPCPLIEEGKE---PIFENSIQPKVEDVAFKTPDISREKDVS-Y 161
            + +                   E ++          Q +V   A   P+ + + + S Y
Sbjct: 533 AKPRSELLEEYRRLSQKEGRTETEEQQFQAIREVIRPQQEVTPEAQSQPENAEDGNGSIY 592

Query: 162 KKVRRRRPLRPRVFPNAKSGNQPVEATETIVP 193
             VR R P   R+  N    ++P E  E + P
Sbjct: 593 PTVRFRDPNEVRIEINGNGASRPAERIEKVRP 624


>gi|315274348|gb|ADU03756.1| conserved hypothetical protein [Enterobacteria phage VT2phi_272]
          Length = 2806

 Score = 38.0 bits (86), Expect = 0.78,   Method: Composition-based stats.
 Identities = 28/152 (18%), Positives = 51/152 (33%), Gaps = 14/152 (9%)

Query: 46  TAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLV 105
             + + E+Y+    D  + GD   A        H     S    ++ E+ +R    + L 
Sbjct: 483 NREQLLEQYAD--ADMATEGDASAA--------HRREAASQLLNELDEQTKRQAVMNELK 532

Query: 106 KEQKERAQNALSEFEASPCPLIEEGKE---PIFENSIQPKVEDVAFKTPDISREKDVS-Y 161
            + +                   E ++          Q +V   A   P+ + + + S Y
Sbjct: 533 AKPRSELLEEYRRLSQKEGRTETEEQQFQAIREVIRPQQEVTPEAQSQPENAEDGNGSIY 592

Query: 162 KKVRRRRPLRPRVFPNAKSGNQPVEATETIVP 193
             VR R P   R+  N    ++P E  E + P
Sbjct: 593 PTVRFRDPNEVRIEINGNGASRPAERIEKVRP 624


>gi|301625246|ref|XP_002941827.1| PREDICTED: hypothetical protein LOC100486913 [Xenopus (Silurana)
           tropicalis]
          Length = 551

 Score = 38.0 bits (86), Expect = 0.78,   Method: Composition-based stats.
 Identities = 20/116 (17%), Positives = 35/116 (30%), Gaps = 8/116 (6%)

Query: 88  QAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEE-GKEPIFENSIQPKVEDV 146
           Q  + E   +    +   +      +   +  E  P P   E   +P   N  +PK +  
Sbjct: 148 QPNLSEPNPQPNPSEPNPQPNPSEPKPQPNPSEPKPQPNPSELKPQP---NPSEPKPQPN 204

Query: 147 AFK---TPDISREKDVSYKKVRRRRPLRPRVFPN-AKSGNQPVEATETIVPQELNS 198
             +    P+ S  K        + +P    + P    S  +P        PQ   S
Sbjct: 205 PSELKPQPNPSELKPQPNPSEPKPQPNSSELKPQPNPSEPKPQPNPSEPKPQPTES 260



 Score = 36.1 bits (81), Expect = 3.3,   Method: Composition-based stats.
 Identities = 18/114 (15%), Positives = 34/114 (29%), Gaps = 4/114 (3%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
           S    Q        + +    K Q   ++       + P P     +     N  +PK +
Sbjct: 125 SELNPQPNPSEPNPQPNPSEPKPQPNLSEPNPQPNPSEPNPQPNPSEPKPQPNPSEPKPQ 184

Query: 145 DVAFK---TPDISREKDVSYKKVRRRRPLRPRVFPN-AKSGNQPVEATETIVPQ 194
               +    P+ S  K        + +P    + P    S  +P   +  + PQ
Sbjct: 185 PNPSELKPQPNPSEPKPQPNPSELKPQPNPSELKPQPNPSEPKPQPNSSELKPQ 238


>gi|157502231|ref|NP_001098994.1| tubulin polyglutamylase ttll6 [Danio rerio]
 gi|172045622|sp|A8CVX7|TTLL6_DANRE RecName: Full=Tubulin polyglutamylase ttll6; AltName: Full=Tubulin
           tyrosine ligase-like family member 6
 gi|157266762|gb|ABV26100.1| tubulin tyrosine ligase-like family member 6 [Danio rerio]
          Length = 778

 Score = 38.0 bits (86), Expect = 0.79,   Method: Composition-based stats.
 Identities = 28/174 (16%), Positives = 60/174 (34%), Gaps = 20/174 (11%)

Query: 2   RSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDA 61
           R  ++ +++R R +       ++     L++ Y++       R   +   E+Y       
Sbjct: 399 RVKERLQQNRSREARNEEPRQSQAASMELMQKYEAKHMGGFRRIFPRDGGEKY------- 451

Query: 62  MSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEA 121
                    E + QH+    +  + A    +E  ++  Q+  L +EQKER +   S  + 
Sbjct: 452 ---------EKYFQHSSSLFQ-ETAASKAREECARQQLQELRLKQEQKERDKKG-SRKQD 500

Query: 122 SPCPLIEEGKEPIFENSIQPKVE--DVAFKTPDISREKDVSYKKVRRRRPLRPR 173
                  E  +P                 +   +  E  VS +++ +    R R
Sbjct: 501 LQGESAGEKVKPRKSQPPHKTSNSLPAMLELSSVREETPVSLERIEKEEAERVR 554


>gi|297697299|ref|XP_002825798.1| PREDICTED: transmembrane channel-like protein 3-like [Pongo abelii]
          Length = 1103

 Score = 38.0 bits (86), Expect = 0.81,   Method: Composition-based stats.
 Identities = 28/129 (21%), Positives = 44/129 (34%), Gaps = 7/129 (5%)

Query: 63   SAGDYVV--AENHLQHAEHYNRIVSMAQ-AQIQEKLQRDEQDDLLVKE---QKERAQNAL 116
            ++GD V     N  Q+A    R     Q ++ +E  +RD     L         RA +  
Sbjct: 913  ASGDIVELYPRNVRQYASRVPRQPPSPQLSEEEETPRRDWIKRSLPPRSLIDLRRAPHFY 972

Query: 117  SEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFP 176
                +    L  E +  +   S     E    + P    +K  S      + PL+PR  P
Sbjct: 973  IGERSESQTLAPEHQGRVHYKSWNEDFE-GHLERPAYVPKKPRSRNFQYPQPPLKPRGKP 1031

Query: 177  NAKSGNQPV 185
              K   +P 
Sbjct: 1032 RGKPRFEPS 1040


>gi|220673038|emb|CAX13171.1| novel protein (zgc:110800) [Danio rerio]
          Length = 466

 Score = 38.0 bits (86), Expect = 0.81,   Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 28/83 (33%), Gaps = 1/83 (1%)

Query: 118 EFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPL-RPRVFP 176
             E  P P       P+ E +        A  TP+ S E      K     PL  P    
Sbjct: 273 PSEPEPNPAPALEAAPVTEAAPVEDTVPDAESTPEPSPEPIAETVKESTIEPLEAPAAGA 332

Query: 177 NAKSGNQPVEATETIVPQELNSD 199
              +  +P  ++ET V   + SD
Sbjct: 333 VIDTAPEPTPSSETEVTSVVESD 355


>gi|47222189|emb|CAG11615.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 2009

 Score = 38.0 bits (86), Expect = 0.81,   Method: Composition-based stats.
 Identities = 20/116 (17%), Positives = 45/116 (38%), Gaps = 5/116 (4%)

Query: 84   VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIE-----EGKEPIFENS 138
            +S  ++Q + +L R E++   ++ Q+ER +      EA P    E     E ++   + +
Sbjct: 1302 MSALKSQYEGRLSRQERELRDLRGQQERQEPRDEPPEAGPSKPQEQQRSTEQRQISLKTT 1361

Query: 139  IQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQ 194
                    +   P  +  K         ++P+ P   P  ++  +P+     +V  
Sbjct: 1362 PAADRGSASTSEPPTANIKPTPVVATASKQPVNPGNKPTPRASIRPMITPAPVVTP 1417


>gi|115252925|emb|CAJ66791.1| putative cell-wall anchored surface adhesin [Streptococcus
           agalactiae]
          Length = 776

 Score = 38.0 bits (86), Expect = 0.82,   Method: Composition-based stats.
 Identities = 25/116 (21%), Positives = 42/116 (36%), Gaps = 8/116 (6%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKE--PIFENSIQPK 142
            +A          + +D  + K + +      ++ EA P    E   E  P  +   +P 
Sbjct: 581 QLANKLRDALQSLELKDKKVAKPEAKPEVKPEAKPEAKPEAKPEAKPEVKPDVKPEAKPD 640

Query: 143 VEDVAFKTPDISREKDVSYK-----KVRRRRPLRPRVFPNAKSGNQPVEATETIVP 193
           V+  A        + DV  +     K   +  ++P V P AK   +P EA   I P
Sbjct: 641 VKPEAKPDVKPEVKPDVKPEAKPDVKPEAKPDVKPEVKPEAKPEAKP-EAKPEIKP 695



 Score = 37.2 bits (84), Expect = 1.4,   Method: Composition-based stats.
 Identities = 17/97 (17%), Positives = 32/97 (32%), Gaps = 1/97 (1%)

Query: 93  EKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPD 152
           ++  +         +  E     +++ EA P    E   E   E   + K E      P+
Sbjct: 577 DQANQLANKLRDALQSLELKDKKVAKPEAKPEVKPEAKPEAKPEAKPEAKPEVKPDVKPE 636

Query: 153 ISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATE 189
              +      K   +  ++P V P AK   +P    +
Sbjct: 637 AKPDVK-PEAKPDVKPEVKPDVKPEAKPDVKPEAKPD 672


>gi|308487710|ref|XP_003106050.1| hypothetical protein CRE_20323 [Caenorhabditis remanei]
 gi|308254624|gb|EFO98576.1| hypothetical protein CRE_20323 [Caenorhabditis remanei]
          Length = 847

 Score = 38.0 bits (86), Expect = 0.83,   Method: Composition-based stats.
 Identities = 27/131 (20%), Positives = 46/131 (35%), Gaps = 13/131 (9%)

Query: 81  NRIVSMAQAQIQ----EKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFE 136
           NR    A+ Q+Q    E   RD+     + ++     + +   + SP    E   +P   
Sbjct: 5   NRPNQTARKQMQNLTVELFARDKNARRQLIDEALSVSSTIPVNDISPSKTPE---QPAIS 61

Query: 137 NSIQPKVEDVAFK-TPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQE 195
            + +P  E V     P+         +  R+  P +P+  P     N PV+ TE      
Sbjct: 62  PTPEPIQELVQVLLAPEPGNHIPRKPRSPRKSAPAKPKTVPKISQPN-PVQQTEKS---- 116

Query: 196 LNSDNASSVDQ 206
              D    V +
Sbjct: 117 EQQDKPEVVQK 127


>gi|257138411|ref|ZP_05586673.1| RE17165p [Burkholderia thailandensis E264]
          Length = 860

 Score = 38.0 bits (86), Expect = 0.83,   Method: Composition-based stats.
 Identities = 21/106 (19%), Positives = 33/106 (31%), Gaps = 3/106 (2%)

Query: 88  QAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVA 147
           Q +  E   R   +       +   QNAL    ++P P       P      QP+    A
Sbjct: 696 QQRANEGQPRASGEPNAPLNYRSPTQNALPPIRSTPTPTHSAQPAPQPAGRAQPQP---A 752

Query: 148 FKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVP 193
           ++TP        + + V R+    P    N      P    +   P
Sbjct: 753 WQTPRNEMRAPEAPRSVPRQEVAPPPAPRNEYRAPAPAPRPQVEAP 798



 Score = 36.1 bits (81), Expect = 3.4,   Method: Composition-based stats.
 Identities = 15/97 (15%), Positives = 27/97 (27%), Gaps = 4/97 (4%)

Query: 97  RDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISRE 156
           + ++ +             L+    +   L      P   +S QP  +      P  + +
Sbjct: 695 QQQRANEGQPRASGEPNAPLNYRSPTQNALPPIRSTPTPTHSAQPAPQPAGRAQPQPAWQ 754

Query: 157 KDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVP 193
                 +   R P  PR  P  +    P    E   P
Sbjct: 755 TP----RNEMRAPEAPRSVPRQEVAPPPAPRNEYRAP 787


>gi|323358297|ref|YP_004224693.1| hypothetical protein MTES_1849 [Microbacterium testaceum StLB037]
 gi|323274668|dbj|BAJ74813.1| hypothetical protein MTES_1849 [Microbacterium testaceum StLB037]
          Length = 1589

 Score = 38.0 bits (86), Expect = 0.85,   Method: Composition-based stats.
 Identities = 20/117 (17%), Positives = 33/117 (28%), Gaps = 15/117 (12%)

Query: 81  NRIVSMAQAQIQEKLQRDEQDDLLVKEQKER-------AQNALSEFEAS-PCPLIEEGKE 132
             ++S++Q        RDE    +  +                    AS P P+     E
Sbjct: 54  FDVLSLSQRIAGLARARDEALRRIRTDAVPAAEPAVAPGTAPAGPAPASVPAPVAASAPE 113

Query: 133 PIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPL-RPRVFPNAKSGNQPVEAT 188
           P  + +  P  E  +        E   + +   R  P   P   P       P  A+
Sbjct: 114 PTPDTASGPVAEPASVPEAAARPEPASAPEAAPRPEPASAPEAAPR------PEPAS 164


>gi|206969877|ref|ZP_03230831.1| cell surface protein [Bacillus cereus AH1134]
 gi|206735565|gb|EDZ52733.1| cell surface protein [Bacillus cereus AH1134]
          Length = 814

 Score = 38.0 bits (86), Expect = 0.85,   Method: Composition-based stats.
 Identities = 18/146 (12%), Positives = 47/146 (32%), Gaps = 9/146 (6%)

Query: 68  VVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLI 127
           + + N+ Q  +           QI+ + ++ E +    ++ +     A       P    
Sbjct: 294 MASRNYKQTHDVQLLFEQDKLEQIKNEEKQPEVEKPEAEKPEVEKPEAEKPEVEKPEAEK 353

Query: 128 EEGKEPIFENSI--QPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSG---- 181
            E ++P  E     +P+ E    + P+  + +    +  +          P A+      
Sbjct: 354 PEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEAEKPEAEKPEAEKPEVEK 413

Query: 182 ---NQPVEATETIVPQELNSDNASSV 204
               +P      +   E+   +A ++
Sbjct: 414 PEVEKPEVEKPEVEKPEVEKPDAETI 439


>gi|311245226|ref|XP_003121747.1| PREDICTED: vacuolar protein sorting-associated protein 4B-like [Sus
           scrofa]
          Length = 525

 Score = 38.0 bits (86), Expect = 0.86,   Method: Composition-based stats.
 Identities = 28/116 (24%), Positives = 42/116 (36%), Gaps = 12/116 (10%)

Query: 51  AERYSVLARDAMS---AGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKE 107
            ++   LA  A     AG+Y  A    QHA  Y   +   +AQ  +  Q          +
Sbjct: 8   LQKAIDLASKAAQEDKAGNYEEALQFYQHAVQYFLHIIKYEAQGDKAKQNIRAKCTEYLD 67

Query: 108 QKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKK 163
           + E+ +  L + E+ P   ++EG         QP   D      D   E D   KK
Sbjct: 68  RAEKLKEYLKKKESKPQKPVKEG---------QPSPADEKGNDSDGEGESDDPEKK 114


>gi|297672064|ref|XP_002814134.1| PREDICTED: zinc finger protein DZIP1L-like [Pongo abelii]
          Length = 767

 Score = 38.0 bits (86), Expect = 0.86,   Method: Composition-based stats.
 Identities = 20/139 (14%), Positives = 42/139 (30%), Gaps = 10/139 (7%)

Query: 74  LQHAEHYNRIVSMAQAQIQEKLQ--RDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGK 131
           L+H E   R+    +A+   +    R +    +    KER +N     +    P ++  +
Sbjct: 484 LRHLESLLRVQREQKARKFSEFLSLRGKLVKEVTSRAKERQENGAVVSQPDGQPSVKSQQ 543

Query: 132 EPIFENSIQPKVEDVAFKTPDISREKDVSYK--------KVRRRRPLRPRVFPNAKSGNQ 183
             +     QPK   +    P    E     +         + +     PR   +      
Sbjct: 544 STVVTREAQPKTRTLQVALPSTRAEPPPPTRQGHGSHGSSLTQVSAPAPRPRVHGPFSTP 603

Query: 184 PVEATETIVPQELNSDNAS 202
           P        P   + +++ 
Sbjct: 604 PSSGPGMSTPPFSSEEDSE 622


>gi|125975557|ref|YP_001039467.1| cellulosome anchoring protein, cohesin region [Clostridium
            thermocellum ATCC 27405]
 gi|145559529|sp|Q06852|SLAP1_CLOTH RecName: Full=Cell surface glycoprotein 1; AltName: Full=Outer layer
            protein B; AltName: Full=S-layer protein 1; Flags:
            Precursor
 gi|125715782|gb|ABN54274.1| cellulosome anchoring protein, cohesin region [Clostridium
            thermocellum ATCC 27405]
          Length = 2313

 Score = 38.0 bits (86), Expect = 0.86,   Method: Composition-based stats.
 Identities = 17/108 (15%), Positives = 25/108 (23%), Gaps = 4/108 (3%)

Query: 92   QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQ----PKVEDVA 147
             E    DE          E  +  +     S  P   +   P  E +      P  E   
Sbjct: 1398 DEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTP 1457

Query: 148  FKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQE 195
             +TP+     D    +        P   P       P +        E
Sbjct: 1458 SETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPE 1505



 Score = 38.0 bits (86), Expect = 0.86,   Method: Composition-based stats.
 Identities = 17/108 (15%), Positives = 25/108 (23%), Gaps = 4/108 (3%)

Query: 92   QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQ----PKVEDVA 147
             E    DE          E  +  +     S  P   +   P  E +      P  E   
Sbjct: 1441 DEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTP 1500

Query: 148  FKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQE 195
             +TP+     D    +        P   P       P +        E
Sbjct: 1501 SETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPE 1548



 Score = 38.0 bits (86), Expect = 0.86,   Method: Composition-based stats.
 Identities = 17/108 (15%), Positives = 25/108 (23%), Gaps = 4/108 (3%)

Query: 92   QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQ----PKVEDVA 147
             E    DE          E  +  +     S  P   +   P  E +      P  E   
Sbjct: 1637 DEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTP 1696

Query: 148  FKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQE 195
             +TP+     D    +        P   P       P +        E
Sbjct: 1697 SETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPE 1744



 Score = 38.0 bits (86), Expect = 0.86,   Method: Composition-based stats.
 Identities = 17/108 (15%), Positives = 25/108 (23%), Gaps = 4/108 (3%)

Query: 92   QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQ----PKVEDVA 147
             E    DE          E  +  +     S  P   +   P  E +      P  E   
Sbjct: 1680 DEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTP 1739

Query: 148  FKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQE 195
             +TP+     D    +        P   P       P +        E
Sbjct: 1740 SETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPE 1787



 Score = 38.0 bits (86), Expect = 0.86,   Method: Composition-based stats.
 Identities = 17/108 (15%), Positives = 25/108 (23%), Gaps = 4/108 (3%)

Query: 92   QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQ----PKVEDVA 147
             E    DE          E  +  +     S  P   +   P  E +      P  E   
Sbjct: 1723 DEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTP 1782

Query: 148  FKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQE 195
             +TP+     D    +        P   P       P +        E
Sbjct: 1783 SETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPE 1830



 Score = 38.0 bits (86), Expect = 0.86,   Method: Composition-based stats.
 Identities = 17/108 (15%), Positives = 25/108 (23%), Gaps = 4/108 (3%)

Query: 92   QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQ----PKVEDVA 147
             E    DE          E  +  +     S  P   +   P  E +      P  E   
Sbjct: 1766 DEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTP 1825

Query: 148  FKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQE 195
             +TP+     D    +        P   P       P +        E
Sbjct: 1826 SETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPE 1873



 Score = 38.0 bits (86), Expect = 0.86,   Method: Composition-based stats.
 Identities = 17/108 (15%), Positives = 25/108 (23%), Gaps = 4/108 (3%)

Query: 92   QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQ----PKVEDVA 147
             E    DE          E  +  +     S  P   +   P  E +      P  E   
Sbjct: 1809 DEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTP 1868

Query: 148  FKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQE 195
             +TP+     D    +        P   P       P +        E
Sbjct: 1869 SETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPE 1916



 Score = 36.4 bits (82), Expect = 2.2,   Method: Composition-based stats.
 Identities = 16/107 (14%), Positives = 24/107 (22%), Gaps = 4/107 (3%)

Query: 92   QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQ----PKVEDVA 147
             E    DE          E  +  +     S  P   +   P  E +      P  E   
Sbjct: 1484 DEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTP 1543

Query: 148  FKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQ 194
             +TP+     D    +        P   P       P +        
Sbjct: 1544 SETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEP 1590



 Score = 36.4 bits (82), Expect = 2.2,   Method: Composition-based stats.
 Identities = 16/107 (14%), Positives = 24/107 (22%), Gaps = 4/107 (3%)

Query: 92   QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQ----PKVEDVA 147
             E    DE          E  +  +     S  P   +   P  E +      P  E   
Sbjct: 1852 DEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTP 1911

Query: 148  FKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQ 194
             +TP+     D    +        P   P       P +        
Sbjct: 1912 SETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEP 1958



 Score = 35.3 bits (79), Expect = 5.9,   Method: Composition-based stats.
 Identities = 15/100 (15%), Positives = 24/100 (24%), Gaps = 3/100 (3%)

Query: 98   DEQDDLLVKEQKERAQNALSEFEASPCPLIEEGK--EPIFENSIQPKVEDVAFKTPDISR 155
            +E         +    +  +     P P  E     EP   +   P  E    +TP+   
Sbjct: 1603 EEPIPTDTPSDEPTPSDEPTPS-DEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPI 1661

Query: 156  EKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQE 195
              D    +        P   P       P +        E
Sbjct: 1662 PTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPE 1701


>gi|195935730|ref|ZP_03081112.1| hypothetical protein EscherichcoliO157_04587 [Escherichia coli
           O157:H7 str. EC4024]
 gi|254794240|ref|YP_003079077.1| hypothetical protein ECSP_3222 [Escherichia coli O157:H7 str.
           TW14359]
 gi|254593640|gb|ACT73001.1| hypothetical protein ECSP_3222 [Escherichia coli O157:H7 str.
           TW14359]
          Length = 2791

 Score = 38.0 bits (86), Expect = 0.87,   Method: Composition-based stats.
 Identities = 29/150 (19%), Positives = 53/150 (35%), Gaps = 12/150 (8%)

Query: 46  TAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLV 105
             + + E+Y+    D  + GD   A        H     S    ++ E+ +R    D L 
Sbjct: 470 NREQLLEQYAD--ADMATEGDASAA--------HRREAASQLLNELDEQAKRQAVMDELK 519

Query: 106 KEQKERAQNALSEFEASPCPLIEEGKE-PIFENSIQPKVEDVAFKTPDISREKDVS-YKK 163
            + +                   E ++     + ++P+ E      P+ + + D S Y  
Sbjct: 520 AKPRPELLEEYRRLSLKEGRTETEEQQLQAIRDVLRPQQEARPEAQPENTDDGDGSIYPT 579

Query: 164 VRRRRPLRPRVFPNAKSGNQPVEATETIVP 193
           VR R P   R+  N    ++P E  E + P
Sbjct: 580 VRFRDPDEVRIEINGSGASRPAERIEKVRP 609


>gi|62122901|ref|NP_001014373.1| hypothetical protein LOC541537 [Danio rerio]
 gi|61403541|gb|AAH91888.1| Zgc:110800 [Danio rerio]
          Length = 457

 Score = 38.0 bits (86), Expect = 0.87,   Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 28/83 (33%), Gaps = 1/83 (1%)

Query: 118 EFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPL-RPRVFP 176
             E  P P       P+ E +        A  TP+ S E      K     PL  P    
Sbjct: 264 PSEPEPNPAPALEAAPVTEAAPVEDTVPDAESTPEPSPEPIAETVKESTIEPLEAPAAGA 323

Query: 177 NAKSGNQPVEATETIVPQELNSD 199
              +  +P  ++ET V   + SD
Sbjct: 324 VIDTAPEPTPSSETEVTSVVESD 346


>gi|22209012|gb|AAC98688.2| surface antigen PHGST#5 [Trypanosoma cruzi]
          Length = 796

 Score = 38.0 bits (86), Expect = 0.89,   Method: Composition-based stats.
 Identities = 16/114 (14%), Positives = 29/114 (25%), Gaps = 1/114 (0%)

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
              + K    +  +    E K           A P P   +  EP        + E    
Sbjct: 498 KSAEPKPAEPKSAEPKPAEPKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPEPAEP 557

Query: 149 KTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
           K+ +    +  S  + +   P      P      +P  A       E     ++
Sbjct: 558 KSAEPKPAEPKS-AEPKPAEPKSAEPKPTEPKSAEPKPAEPKSAEPEPAEPKSA 610



 Score = 36.8 bits (83), Expect = 1.7,   Method: Composition-based stats.
 Identities = 17/109 (15%), Positives = 25/109 (22%), Gaps = 4/109 (3%)

Query: 98  DEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFEN--SIQPKVEDVAFKTPDISR 155
            +Q D                  A P     E  EP        +PK  +     P  + 
Sbjct: 452 PQQTDQTTLNASSVPSGGAPSKPAEPKSAEPEPAEPKSAGPKPAEPKSAEPKPAEPKSAE 511

Query: 156 EKDVSYKK--VRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
            K    K    +   P      P      +P  A       E     ++
Sbjct: 512 PKPAEPKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPEPAEPKSA 560



 Score = 35.7 bits (80), Expect = 3.7,   Method: Composition-based stats.
 Identities = 22/124 (17%), Positives = 34/124 (27%), Gaps = 2/124 (1%)

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIE--EGKEPIFENSIQPKVEDV 146
              + K    +  +    E K         + A P P        EP    S +P+  + 
Sbjct: 618 KSAEPKPAEPKSAEPEPTEPKSAGPKPAEPYSAEPKPAEPKSAEPEPTEPKSAEPEPTEP 677

Query: 147 AFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQ 206
               P  +       K    +        P+A+ G     A+ T          ASS D 
Sbjct: 678 KSAGPKPAEPYSAEPKPAEPKSAELNATTPSAREGAADQSASVTSSGASSTDVGASSSDD 737

Query: 207 DCKV 210
              V
Sbjct: 738 AQTV 741



 Score = 35.3 bits (79), Expect = 5.9,   Method: Composition-based stats.
 Identities = 15/96 (15%), Positives = 23/96 (23%), Gaps = 3/96 (3%)

Query: 107 EQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRR 166
           +  E         E  P        EP    S +PK  +     P  +  K       + 
Sbjct: 528 KSAEPKPAEPKSAEPKPAEPKSAEPEPAEPKSAEPKPAEPKSAEPKPAEPKSAEP---KP 584

Query: 167 RRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
             P      P      +P  A       E     ++
Sbjct: 585 TEPKSAEPKPAEPKSAEPEPAEPKSAEPEPAEPKSA 620



 Score = 34.5 bits (77), Expect = 9.7,   Method: Composition-based stats.
 Identities = 16/114 (14%), Positives = 28/114 (24%), Gaps = 1/114 (0%)

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
              + K    +  +    E K           A P P   +  EP        + E    
Sbjct: 558 KSAEPKPAEPKSAEPKPAEPKSAEPKPTEPKSAEPKPAEPKSAEPEPAEPKSAEPEPAEP 617

Query: 149 KTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
           K+ +    +  S  +     P      P      +P  A       E     ++
Sbjct: 618 KSAEPKPAEPKS-AEPEPTEPKSAGPKPAEPYSAEPKPAEPKSAEPEPTEPKSA 670


>gi|77409150|ref|ZP_00785863.1| pathogenicity protein, putative [Streptococcus agalactiae COH1]
 gi|77172234|gb|EAO75390.1| pathogenicity protein, putative [Streptococcus agalactiae COH1]
 gi|115252913|emb|CAJ66785.1| putative cell-wall anchored surface adhesin [Streptococcus
           agalactiae]
 gi|115252935|emb|CAJ66796.1| putative cell-wall anchored surface adhesin [Streptococcus
           agalactiae COH1]
          Length = 522

 Score = 38.0 bits (86), Expect = 0.89,   Method: Composition-based stats.
 Identities = 14/74 (18%), Positives = 27/74 (36%), Gaps = 5/74 (6%)

Query: 124 CPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRP-----LRPRVFPNA 178
            P ++   +P  +  ++P V+  A        + DV  +     +P     ++P V P A
Sbjct: 396 KPDVKPEAKPEAKPEVKPDVKPEAKPEAKPEVKSDVKPEAKPEAKPEAKPEVKPDVKPEA 455

Query: 179 KSGNQPVEATETIV 192
           K   +P        
Sbjct: 456 KPEAKPATKKSVNT 469


>gi|317506767|ref|ZP_07964546.1| cysteine-rich domain-containing protein [Segniliparus rugosus ATCC
           BAA-974]
 gi|316254932|gb|EFV14223.1| cysteine-rich domain-containing protein [Segniliparus rugosus ATCC
           BAA-974]
          Length = 1081

 Score = 38.0 bits (86), Expect = 0.90,   Method: Composition-based stats.
 Identities = 14/65 (21%), Positives = 22/65 (33%), Gaps = 1/65 (1%)

Query: 129 EGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEAT 188
              EP  +++ Q   E ++   P     K    K++      RP+  P  K    P   T
Sbjct: 891 SADEPEQKDAEQKDAEPISAADPSPPTSKGRPSKRLPPSSRSRPQS-PRHKRSRFPSPPT 949

Query: 189 ETIVP 193
               P
Sbjct: 950 RNPRP 954


>gi|118101492|ref|XP_417695.2| PREDICTED: similar to absent in melanoma 1-like [Gallus gallus]
          Length = 1408

 Score = 38.0 bits (86), Expect = 0.90,   Method: Composition-based stats.
 Identities = 18/99 (18%), Positives = 37/99 (37%), Gaps = 11/99 (11%)

Query: 113 QNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSY-KKVRRRRPLR 171
           Q    + ++ P P +E  +EP  E+  +P+ E +    P+   +       K +    L+
Sbjct: 373 QGVAQDTQSIPEPPMESTEEPQPESIAKPQPESIPKPQPESVPKLQSEGVPKPQPESVLK 432

Query: 172 PR----VFPNAKSGNQPVEATE-----TIVP-QELNSDN 200
           P+      P  +   +P   +        VP  +  S +
Sbjct: 433 PQPEGVPKPQPEGVPKPQPESTPKHQSESVPEPQSKSIS 471



 Score = 36.4 bits (82), Expect = 2.4,   Method: Composition-based stats.
 Identities = 15/104 (14%), Positives = 31/104 (29%), Gaps = 9/104 (8%)

Query: 103 LLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPK----VEDVAFKTPDISREKD 158
             V +  +       E    P P      +P      QP+    ++      P       
Sbjct: 373 QGVAQDTQSIPEPPMESTEEPQPESIAKPQPESIPKPQPESVPKLQSEGVPKPQPESVLK 432

Query: 159 VSYKKVRRRRPL-----RPRVFPNAKSGNQPVEATETIVPQELN 197
              + V + +P      +P   P  +S + P   +++I   +  
Sbjct: 433 PQPEGVPKPQPEGVPKPQPESTPKHQSESVPEPQSKSISKPQTE 476


>gi|114052442|ref|NP_057922.2| misshapen-like kinase 1 isoform 1 [Mus musculus]
 gi|56205373|emb|CAI24008.1| misshapen-like kinase 1 (zebrafish) [Mus musculus]
 gi|123233527|emb|CAM28125.1| misshapen-like kinase 1 (zebrafish) [Mus musculus]
 gi|148680634|gb|EDL12581.1| misshapen-like kinase 1 (zebrafish), isoform CRA_c [Mus musculus]
          Length = 1300

 Score = 38.0 bits (86), Expect = 0.91,   Method: Composition-based stats.
 Identities = 22/140 (15%), Positives = 48/140 (34%), Gaps = 15/140 (10%)

Query: 79  HYNRIVSMAQ-----AQIQEKLQRDEQDDLLVKEQKERAQNALSE-FEASPCPLIEEGKE 132
           HY R ++ A       +++E+ + ++Q +  + + K  +        +ASP P     + 
Sbjct: 508 HYGRGINPADKPAWAREVEERARMNKQQNSPLAKAKPSSAGPEPPISQASPSPPGPLSQT 567

Query: 133 PIFENSIQPKVED-------VAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPV 185
           P  +  ++P+               P  +        + +  R L    FP +   +   
Sbjct: 568 PPMQRPVEPQEGPHKSLVAHRVPLKPYAAPVPRSQSLQDQPTRNLA--AFPASHDPDPAA 625

Query: 186 EATETIVPQELNSDNASSVD 205
             T T  P    +    + D
Sbjct: 626 VPTPTATPSARGAVIRQNSD 645


>gi|327275261|ref|XP_003222392.1| PREDICTED: DNA-directed RNA polymerase I subunit RPA1-like [Anolis
            carolinensis]
          Length = 1690

 Score = 38.0 bits (86), Expect = 0.92,   Method: Composition-based stats.
 Identities = 17/119 (14%), Positives = 44/119 (36%), Gaps = 1/119 (0%)

Query: 90   QIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFK 149
            Q  +     E ++       E  +      +A      EE  +   +++ + + ED+  +
Sbjct: 1372 QENQDNNEAEPEEEGRVPDGETGEEDADAADAKRKANQEEEVDYESDDANETEDEDIPEQ 1431

Query: 150  TP-DISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQD 207
               +++ ++  S  +     PLR +     K  N+  +   + V +   +  + + D D
Sbjct: 1432 EENEVNPDEPESQDEPSAPCPLRRKSHKKKKEPNEFAQQRISAVLESHGAIESYTYDTD 1490


>gi|242220128|ref|XP_002475834.1| predicted protein [Postia placenta Mad-698-R]
 gi|220724937|gb|EED78949.1| predicted protein [Postia placenta Mad-698-R]
          Length = 1481

 Score = 38.0 bits (86), Expect = 0.92,   Method: Composition-based stats.
 Identities = 19/116 (16%), Positives = 41/116 (35%), Gaps = 6/116 (5%)

Query: 90   QIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCP-LIEEGKEPIFENSIQPKVEDVAF 148
             +Q + Q +E     + + +  A  A         P  ++   +P  ++ +QP V+  A 
Sbjct: 983  DMQAETQSEEAQPEALPDVQAVADPAALPDVPPDAPMDVQVELQPEVKSEVQPDVQPEAP 1042

Query: 149  KTPDISREKDVSYKK-----VRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSD 199
                   E++VS +         +  ++P   P A+         +     E+  D
Sbjct: 1043 TEVQPQVEREVSPQARPEVPPPPQLEVQPEAQPEAQPQLAAQPQLDAPAQPEMQPD 1098


>gi|108709708|gb|ABF97503.1| retrotransposon protein, putative, unclassified [Oryza sativa
           Japonica Group]
          Length = 1172

 Score = 38.0 bits (86), Expect = 0.92,   Method: Composition-based stats.
 Identities = 35/175 (20%), Positives = 51/175 (29%), Gaps = 10/175 (5%)

Query: 3   SVQQYKRSRGRGSNGGNGSF-NRKNLNPLVRNYDSNGY-DVKVRGTAQHIAERYSVLARD 60
                   RG GS G   SF +     P    Y   G    + + +   + +       +
Sbjct: 214 PSAANNGRRGFGSTGAAPSFPSAAQPTPQHFKYSPFGPPGGEYKSSPCQVQDIIEASVIN 273

Query: 61  AMSAG------DYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQN 114
           A SAG         +A   +Q  EH  RI+       ++  +         K     AQ 
Sbjct: 274 ATSAGLLEDELTRKIANKEMQTLEHLLRIIDGFTRGEEDSKRWQAIQVEYDKASVTTAQA 333

Query: 115 ALSEFEASPCPLIEEGKEPIF--ENSIQPKVEDVAFKTPDISREKDVSYKKVRRR 167
                 A P PL+    +P    +   Q   E V F   D             RR
Sbjct: 334 QQQVQVAEPPPLVVRQPQPAIQAQPPRQEDAEGVTFPHQDPLVISAEIAGFEVRR 388


>gi|74197265|dbj|BAE39660.1| unnamed protein product [Mus musculus]
          Length = 364

 Score = 38.0 bits (86), Expect = 0.92,   Method: Composition-based stats.
 Identities = 27/121 (22%), Positives = 45/121 (37%), Gaps = 7/121 (5%)

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALS--E 118
           A  AGD +  +   Q A    + +   QA  + + QR  + +   ++++E  Q A    E
Sbjct: 182 AKVAGDCLDEKQCKQCANKVLQHMKAVQADQERERQRRLEVEREAEKKREAKQQAKEAKE 241

Query: 119 FEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNA 178
            E       EE +    E   Q   +    K P     K  + +  + +   RPR  P  
Sbjct: 242 RELRKREKAEEKERRRKEYDAQKASKREQEKKP-----KKEANQAPKSKSGSRPRKPPPR 296

Query: 179 K 179
           K
Sbjct: 297 K 297


>gi|15830496|ref|NP_309269.1| hypothetical protein ECs1242 [Escherichia coli O157:H7 str. Sakai]
 gi|217327986|ref|ZP_03444068.1| hypothetical protein ESCCO14588_2683 [Escherichia coli O157:H7 str.
           TW14588]
 gi|302861144|ref|YP_003848845.1| hypothetical protein Stx1_gp23 [Stx1 converting phage]
 gi|13360702|dbj|BAB34665.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|217318413|gb|EEC26839.1| hypothetical protein ESCCO14588_2683 [Escherichia coli O157:H7 str.
           TW14588]
 gi|326345544|gb|EGD69284.1| Phage protein [Escherichia coli O157:H7 str. 1044]
          Length = 2793

 Score = 38.0 bits (86), Expect = 0.92,   Method: Composition-based stats.
 Identities = 28/152 (18%), Positives = 51/152 (33%), Gaps = 14/152 (9%)

Query: 46  TAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLV 105
             + + E+Y+    D  + GD   A        H     S    ++ E+ +R    + L 
Sbjct: 470 NREQLLEQYAD--ADMATEGDASAA--------HRREAASQLLNELDEQTKRQAVMNELK 519

Query: 106 KEQKERAQNALSEFEASPCPLIEEGKE---PIFENSIQPKVEDVAFKTPDISREKDVS-Y 161
            + +                   E ++          Q +V   A   P+ + + + S Y
Sbjct: 520 AKPRSELLEEYRRLSQKEGRTETEEQQFQAIREVIRPQQEVTPEAQSQPENAEDGNGSIY 579

Query: 162 KKVRRRRPLRPRVFPNAKSGNQPVEATETIVP 193
             VR R P   R+  N    ++P E  E + P
Sbjct: 580 PTVRFRDPNEVRIEINGNGASRPAERIEKVRP 611


>gi|325567445|ref|ZP_08144112.1| family 4 N-acetylmuramoyl-L-alanine amidase [Enterococcus
           casseliflavus ATCC 12755]
 gi|325158878|gb|EGC71024.1| family 4 N-acetylmuramoyl-L-alanine amidase [Enterococcus
           casseliflavus ATCC 12755]
          Length = 505

 Score = 38.0 bits (86), Expect = 0.92,   Method: Composition-based stats.
 Identities = 25/119 (21%), Positives = 43/119 (36%), Gaps = 1/119 (0%)

Query: 84  VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV 143
           V       + ++   EQ    V+   E ++ A    E +  P  +    P  +   +P+ 
Sbjct: 55  VEETAPAGEGQVSDSEQGSAPVESVPEGSETAPEGTEQTEEPTPDPQPTPEPKPEPKPEP 114

Query: 144 EDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
           E  +   P    E   + K  +  +P  P+     +   QP E  ET    E NSD + 
Sbjct: 115 ELPSKPEPSQPEEPTPAPKPEKPTKPEAPKPETQPE-KPQPSEPVETQPTPEANSDASQ 172


>gi|255961099|gb|ACU44425.1| BibA [Streptococcus agalactiae]
 gi|255961125|gb|ACU44438.1| BibA [Streptococcus agalactiae]
          Length = 655

 Score = 38.0 bits (86), Expect = 0.92,   Method: Composition-based stats.
 Identities = 23/120 (19%), Positives = 41/120 (34%), Gaps = 10/120 (8%)

Query: 93  EKLQRDEQDDLLVKEQKERAQNALSEFEASP--CPLIEEGKEPIFENSIQPKVEDV--AF 148
           ++  +         +  E     +++ EA P   P ++   +P  +   +P V+      
Sbjct: 484 DQANQLANKLRDALQSLELKDKKVAKPEAKPEAKPDVKPEAKPDVKPEAKPDVKPEAKPE 543

Query: 149 KTPDISREKD---VSYKKVRRRRPLRPRVFPNAKSGNQP---VEATETIVPQELNSDNAS 202
             P+   E         K   +   +P   P AKS  +P   +EA     P    S N S
Sbjct: 544 AKPEAKPEAKPDVKPEAKPDVKPEAKPEAKPEAKSEAKPEAKLEAKPEAKPATKKSVNTS 603


>gi|50838920|gb|AAT81681.1| putative retrotransposon protein [Oryza sativa Japonica Group]
          Length = 1168

 Score = 38.0 bits (86), Expect = 0.92,   Method: Composition-based stats.
 Identities = 35/175 (20%), Positives = 51/175 (29%), Gaps = 10/175 (5%)

Query: 3   SVQQYKRSRGRGSNGGNGSF-NRKNLNPLVRNYDSNGY-DVKVRGTAQHIAERYSVLARD 60
                   RG GS G   SF +     P    Y   G    + + +   + +       +
Sbjct: 210 PSAANNGRRGFGSTGAAPSFPSAAQPTPQHFKYSPFGPPGGEYKSSPCQVQDIIEASVIN 269

Query: 61  AMSAG------DYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQN 114
           A SAG         +A   +Q  EH  RI+       ++  +         K     AQ 
Sbjct: 270 ATSAGLLEDELTRKIANKEMQTLEHLLRIIDGFTRGEEDSKRWQAIQVEYDKASVTTAQA 329

Query: 115 ALSEFEASPCPLIEEGKEPIF--ENSIQPKVEDVAFKTPDISREKDVSYKKVRRR 167
                 A P PL+    +P    +   Q   E V F   D             RR
Sbjct: 330 QQQVQVAEPPPLVVRQPQPAIQAQPPRQEDAEGVTFPHQDPLVISAEIAGFEVRR 384


>gi|114052416|ref|NP_795712.2| misshapen-like kinase 1 isoform 2 [Mus musculus]
 gi|56205375|emb|CAI24010.1| misshapen-like kinase 1 (zebrafish) [Mus musculus]
 gi|123233524|emb|CAM28122.1| misshapen-like kinase 1 (zebrafish) [Mus musculus]
 gi|148680632|gb|EDL12579.1| misshapen-like kinase 1 (zebrafish), isoform CRA_a [Mus musculus]
          Length = 1308

 Score = 38.0 bits (86), Expect = 0.92,   Method: Composition-based stats.
 Identities = 22/140 (15%), Positives = 48/140 (34%), Gaps = 15/140 (10%)

Query: 79  HYNRIVSMAQ-----AQIQEKLQRDEQDDLLVKEQKERAQNALSE-FEASPCPLIEEGKE 132
           HY R ++ A       +++E+ + ++Q +  + + K  +        +ASP P     + 
Sbjct: 508 HYGRGINPADKPAWAREVEERARMNKQQNSPLAKAKPSSAGPEPPISQASPSPPGPLSQT 567

Query: 133 PIFENSIQPKVED-------VAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPV 185
           P  +  ++P+               P  +        + +  R L    FP +   +   
Sbjct: 568 PPMQRPVEPQEGPHKSLVAHRVPLKPYAAPVPRSQSLQDQPTRNLA--AFPASHDPDPAA 625

Query: 186 EATETIVPQELNSDNASSVD 205
             T T  P    +    + D
Sbjct: 626 VPTPTATPSARGAVIRQNSD 645


>gi|312218323|emb|CBX98269.1| hypothetical protein [Leptosphaeria maculans]
          Length = 740

 Score = 38.0 bits (86), Expect = 0.94,   Method: Composition-based stats.
 Identities = 19/104 (18%), Positives = 39/104 (37%), Gaps = 7/104 (6%)

Query: 107 EQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRR 166
           E+ +      +   A+  P  E   +P+ E+  +P+V++      D + E D     VR 
Sbjct: 22  EEVDSGDQDNTRRAANAQPEPESEPQPVSESGPKPEVQETIADIDDSNPEIDALRSSVR- 80

Query: 167 RRPLRPRVFPNAKSGNQPV---EATETIVPQELNSDNASSVDQD 207
              +  R  P++ +          T   +P      + ++V  D
Sbjct: 81  ---VVMRNVPSSAAIVTVACIDPETNKRIPVGAAISSLTTVSMD 121


>gi|323176725|gb|EFZ62315.1| hypothetical protein ECOK1180_4090 [Escherichia coli 1180]
          Length = 2793

 Score = 38.0 bits (86), Expect = 0.95,   Method: Composition-based stats.
 Identities = 28/152 (18%), Positives = 51/152 (33%), Gaps = 14/152 (9%)

Query: 46  TAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLV 105
             + + E+Y+    D  + GD   A        H     S    ++ E+ +R    + L 
Sbjct: 470 NREQLLEQYAD--ADMATEGDASAA--------HRREAASQLLNELDEQTKRQAVMNELK 519

Query: 106 KEQKERAQNALSEFEASPCPLIEEGKE---PIFENSIQPKVEDVAFKTPDISREKDVS-Y 161
            + +                   E ++          Q +V   A   P+ + + + S Y
Sbjct: 520 AKPRSELLEEYRRLSQKEGRTETEEQQFQAIREVIRPQQEVTPEAQSQPENAEDGNGSIY 579

Query: 162 KKVRRRRPLRPRVFPNAKSGNQPVEATETIVP 193
             VR R P   R+  N    ++P E  E + P
Sbjct: 580 PTVRFRDPNEVRIEINGNGASRPAERIEKVRP 611


>gi|95981798|gb|ABF57890.1| ballchen [Drosophila simulans]
          Length = 603

 Score = 38.0 bits (86), Expect = 0.95,   Method: Composition-based stats.
 Identities = 16/68 (23%), Positives = 22/68 (32%), Gaps = 2/68 (2%)

Query: 120 EASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK-KVRRRRPLRPR-VFPN 177
             +P P  E           +PK       TP  S +   + K   + + P   R   PN
Sbjct: 422 RVAPAPAAESSPPGRKRVKTEPKSTPKERATPKTSPKPKGTPKASPKPQTPTAARLRTPN 481

Query: 178 AKSGNQPV 185
           AK    P 
Sbjct: 482 AKINFSPS 489


>gi|32128229|dbj|BAC78032.1| hypothetical protein [Stx2 converting phage II]
          Length = 2576

 Score = 38.0 bits (86), Expect = 0.95,   Method: Composition-based stats.
 Identities = 28/152 (18%), Positives = 51/152 (33%), Gaps = 14/152 (9%)

Query: 46  TAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLV 105
             + + E+Y+    D  + GD   A        H     S    ++ E+ +R    + L 
Sbjct: 483 NREQLLEQYAD--ADMATEGDASAA--------HRREAASQLLNELDEQTKRQAVMNELK 532

Query: 106 KEQKERAQNALSEFEASPCPLIEEGKE---PIFENSIQPKVEDVAFKTPDISREKDVS-Y 161
            + +                   E ++          Q +V   A   P+ + + + S Y
Sbjct: 533 AKPRSELLEEYRRLSQKEGRTETEEQQFQAIREVIRPQQEVTPEAQSQPENAEDGNGSIY 592

Query: 162 KKVRRRRPLRPRVFPNAKSGNQPVEATETIVP 193
             VR R P   R+  N    ++P E  E + P
Sbjct: 593 PTVRFRDPNEVRIEINGNGASRPAERIEKVRP 624


>gi|260867280|ref|YP_003233682.1| hypothetical protein ECO111_1183 [Escherichia coli O111:H- str.
           11128]
 gi|257763636|dbj|BAI35131.1| hypothetical protein ECO111_1183 [Escherichia coli O111:H- str.
           11128]
          Length = 2793

 Score = 38.0 bits (86), Expect = 0.95,   Method: Composition-based stats.
 Identities = 28/152 (18%), Positives = 51/152 (33%), Gaps = 14/152 (9%)

Query: 46  TAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLV 105
             + + E+Y+    D  + GD   A        H     S    ++ E+ +R    + L 
Sbjct: 470 NREQLLEQYAD--ADMATEGDASAA--------HRREAASQLLNELDEQTKRQAVMNELK 519

Query: 106 KEQKERAQNALSEFEASPCPLIEEGKE---PIFENSIQPKVEDVAFKTPDISREKDVS-Y 161
            + +                   E ++          Q +V   A   P+ + + + S Y
Sbjct: 520 AKPRSELLEEYRRLSQKEGRTETEEQQFQAIREVIRPQQEVTPEAQSQPENAEDGNGSIY 579

Query: 162 KKVRRRRPLRPRVFPNAKSGNQPVEATETIVP 193
             VR R P   R+  N    ++P E  E + P
Sbjct: 580 PTVRFRDPNEVRIEINGNGASRPAERIEKVRP 611


>gi|168798528|ref|ZP_02823535.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC508]
 gi|189378926|gb|EDU97342.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC508]
 gi|326339702|gb|EGD63513.1| Phage protein [Escherichia coli O157:H7 str. 1125]
          Length = 2793

 Score = 38.0 bits (86), Expect = 0.95,   Method: Composition-based stats.
 Identities = 28/152 (18%), Positives = 51/152 (33%), Gaps = 14/152 (9%)

Query: 46  TAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLV 105
             + + E+Y+    D  + GD   A        H     S    ++ E+ +R    + L 
Sbjct: 470 NREQLLEQYAD--ADMATEGDASAA--------HRREAASQLLNELDEQTKRQAVMNELK 519

Query: 106 KEQKERAQNALSEFEASPCPLIEEGKE---PIFENSIQPKVEDVAFKTPDISREKDVS-Y 161
            + +                   E ++          Q +V   A   P+ + + + S Y
Sbjct: 520 AKPRSELLEEYRRLSQKEGRTETEEQQFQAIREVIRPQQEVTPEAQSQPENAEDGNGSIY 579

Query: 162 KKVRRRRPLRPRVFPNAKSGNQPVEATETIVP 193
             VR R P   R+  N    ++P E  E + P
Sbjct: 580 PTVRFRDPNEVRIEINGNGASRPAERIEKVRP 611


>gi|34497849|ref|NP_902064.1| cell division ftsk transmembrane protein [Chromobacterium violaceum
           ATCC 12472]
 gi|34103705|gb|AAQ60066.1| probable cell division ftsk transmembrane protein [Chromobacterium
           violaceum ATCC 12472]
          Length = 964

 Score = 38.0 bits (86), Expect = 0.95,   Method: Composition-based stats.
 Identities = 18/100 (18%), Positives = 33/100 (33%), Gaps = 4/100 (4%)

Query: 91  IQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGK-EPIFENSIQPK---VEDV 146
           ++ + +R + D      Q   A       +A+  P  +    EP  +    P+    E V
Sbjct: 37  VEGRSERYQPDYFAEASQHPPAGEGPPVAQAAEQPDQQAQAAEPALQAQPAPRREQPEPV 96

Query: 147 AFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVE 186
               P     ++    + R R  +     P + S   P E
Sbjct: 97  RIPQPRPQARREAPPPEERPRETIILPKRPQSASHEPPAE 136


>gi|291241097|ref|XP_002740454.1| PREDICTED: heterogeneous nuclear ribonucleoprotein U-like 1-like
           [Saccoglossus kowalevskii]
          Length = 615

 Score = 38.0 bits (86), Expect = 0.96,   Method: Composition-based stats.
 Identities = 28/125 (22%), Positives = 44/125 (35%), Gaps = 6/125 (4%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIF--ENSIQPK 142
             AQ QI+   ++ E D     E  E AQ   +  E  P P+ E   EP    E  I+P 
Sbjct: 85  QSAQPQIEATDEQTESDPTPAIE-MEVAQPEPTVPEIQPEPVKEIEPEPEIAAEPVIEPT 143

Query: 143 VEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
            E    + P+   E +   K      P      P     ++P +  + +  Q +      
Sbjct: 144 PELQVTQEPESVVEAEEPSKTTDAEVPTADVAEPE---ESKPADKEQPVEEQPMEEQPTE 200

Query: 203 SVDQD 207
              Q+
Sbjct: 201 QTPQE 205


>gi|170052850|ref|XP_001862409.1| zinc finger and SCAN domain-containing protein 21 [Culex
           quinquefasciatus]
 gi|167873631|gb|EDS37014.1| zinc finger and SCAN domain-containing protein 21 [Culex
           quinquefasciatus]
          Length = 622

 Score = 38.0 bits (86), Expect = 0.96,   Method: Composition-based stats.
 Identities = 19/78 (24%), Positives = 34/78 (43%), Gaps = 2/78 (2%)

Query: 130 GKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAK-SGNQPVEAT 188
             EP+ +   Q + E       D +R  D S +  +R R L+    P  K +  +P + +
Sbjct: 169 KPEPVHD-DEQEQNESDEDSDWDPARNDDSSDEAPKRTRALKVVKKPRKKYAPRKPKDPS 227

Query: 189 ETIVPQELNSDNASSVDQ 206
           E  VP+E    + +  D+
Sbjct: 228 EVKVPKERKKRDIAKEDE 245


>gi|330944878|ref|XP_003306442.1| hypothetical protein PTT_19584 [Pyrenophora teres f. teres 0-1]
 gi|311316055|gb|EFQ85466.1| hypothetical protein PTT_19584 [Pyrenophora teres f. teres 0-1]
          Length = 478

 Score = 37.6 bits (85), Expect = 0.97,   Method: Composition-based stats.
 Identities = 16/79 (20%), Positives = 30/79 (37%), Gaps = 7/79 (8%)

Query: 136 ENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNA-KSGNQPVEATETIVPQ 194
           E + +PK +  +    +    +    +K R  +P      P A  S + P+ +     P 
Sbjct: 102 EPTSKPKPKPESESKTEKPPPEPTPSQKPRPEKPHSQEPAPPAPTSSSNPLPSPNQDAPP 161

Query: 195 ELNSDNASS------VDQD 207
           +    + SS      VD+D
Sbjct: 162 KQQQPDTSSNPWAGMVDKD 180


>gi|194766662|ref|XP_001965443.1| GF22447 [Drosophila ananassae]
 gi|190619434|gb|EDV34958.1| GF22447 [Drosophila ananassae]
          Length = 601

 Score = 37.6 bits (85), Expect = 0.98,   Method: Composition-based stats.
 Identities = 16/86 (18%), Positives = 34/86 (39%)

Query: 86  MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVED 145
           MA+ +++ + Q++E+      + +E+    L   E     L  E  +P      +PK +D
Sbjct: 321 MAKLEVKSEEQKNEEQKSEEHKDQEQKPEELKPEEPKQEELKIEEPKPEELRPEEPKDKD 380

Query: 146 VAFKTPDISREKDVSYKKVRRRRPLR 171
              + P    +K    K   +   + 
Sbjct: 381 PETEEPKAEEQKQEEPKNATQEDVVA 406


>gi|217327473|ref|ZP_03443556.1| hypothetical protein ESCCO14588_4802 [Escherichia coli O157:H7 str.
           TW14588]
 gi|217319840|gb|EEC28265.1| hypothetical protein ESCCO14588_4802 [Escherichia coli O157:H7 str.
           TW14588]
          Length = 2794

 Score = 37.6 bits (85), Expect = 0.99,   Method: Composition-based stats.
 Identities = 28/152 (18%), Positives = 51/152 (33%), Gaps = 14/152 (9%)

Query: 46  TAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLV 105
             + + E+Y+    D  + GD   A        H     S    ++ E+ +R    + L 
Sbjct: 470 NREQLLEQYAD--ADMATEGDASAA--------HRREAASQLLNELDEQTKRQAVMNELK 519

Query: 106 KEQKERAQNALSEFEASPCPLIEEGKE---PIFENSIQPKVEDVAFKTPDISREKDVS-Y 161
            + +                   E ++          Q +V   A   P+ + + + S Y
Sbjct: 520 AKPRSELLEEYRRLSQKEGRTETEEQQFQAIREVIRPQQEVTPEAQSQPENAEDGNGSIY 579

Query: 162 KKVRRRRPLRPRVFPNAKSGNQPVEATETIVP 193
             VR R P   R+  N    ++P E  E + P
Sbjct: 580 PTVRFRDPNEVRIEINGNGASRPAERIEKVRP 611


>gi|299115326|emb|CBN74143.1| SRS domain-containing protein [Ectocarpus siliculosus]
          Length = 1718

 Score = 37.6 bits (85), Expect = 1.0,   Method: Composition-based stats.
 Identities = 16/128 (12%), Positives = 40/128 (31%), Gaps = 4/128 (3%)

Query: 75   QHAEHYNRIVSMAQAQIQEKLQRDEQDDLLV--KEQKERAQNALSEFEASPCPLIEEGKE 132
            Q  +H  ++V     Q+     ++E+++ +    ++++ AQ           P  +E +E
Sbjct: 1127 QEEDH-AQVVPGPSTQVSPPSNQEEEEEGIAPPAQEEDHAQVVPGPSTQVSPPSKQEEEE 1185

Query: 133  PIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIV 192
                   Q +        P          ++        P       +   P  +T+   
Sbjct: 1186 EGVAPPAQEEDHTQVVPGPSTQVSPPSKQQQEEEEGVASP-TQEEDHAQVVPGPSTQASP 1244

Query: 193  PQELNSDN 200
            P +   + 
Sbjct: 1245 PPKQQEEE 1252


>gi|126726396|ref|ZP_01742237.1| ribonuclease, Rne/Rng family protein [Rhodobacterales bacterium
           HTCC2150]
 gi|126704259|gb|EBA03351.1| ribonuclease, Rne/Rng family protein [Rhodobacterales bacterium
           HTCC2150]
          Length = 939

 Score = 37.6 bits (85), Expect = 1.0,   Method: Composition-based stats.
 Identities = 12/44 (27%), Positives = 19/44 (43%)

Query: 124 CPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRR 167
            P      EP+ E++ +P  E VA   P+    +     K +RR
Sbjct: 890 APETAVVPEPVVESTPEPTPEPVAESVPEPVAPEPEVPAKPKRR 933


>gi|167044156|gb|ABZ08838.1| putative ribosomal protein L13 [uncultured marine crenarchaeote
           HF4000_APKG5E24]
          Length = 210

 Score = 37.6 bits (85), Expect = 1.0,   Method: Composition-based stats.
 Identities = 14/69 (20%), Positives = 25/69 (36%), Gaps = 1/69 (1%)

Query: 121 ASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKS 180
           A P P  +   EP  +     K +      P  S +   S    + +   + +  P AK 
Sbjct: 2   AKPKPSAKPKSEPATKPKPSAKPKSEPATKPKPSAKPK-SEPATKPKPSAKLKSEPAAKP 60

Query: 181 GNQPVEATE 189
             +P++ T 
Sbjct: 61  EEKPIDKTS 69


>gi|95981814|gb|ABF57898.1| ballchen [Drosophila simulans]
          Length = 603

 Score = 37.6 bits (85), Expect = 1.0,   Method: Composition-based stats.
 Identities = 16/68 (23%), Positives = 23/68 (33%), Gaps = 2/68 (2%)

Query: 120 EASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK-KVRRRRPLRPRVF-PN 177
             +P P  E           +PK       TP  S +   + K   + + P   R+  PN
Sbjct: 422 RVAPAPAAESSPPGRKRVKTEPKSFPKERATPKTSPKPKGTPKASPKPQTPTAARLKTPN 481

Query: 178 AKSGNQPV 185
           AK    P 
Sbjct: 482 AKINFSPS 489


>gi|195470086|ref|XP_002099964.1| GE16785 [Drosophila yakuba]
 gi|194187488|gb|EDX01072.1| GE16785 [Drosophila yakuba]
          Length = 1131

 Score = 37.6 bits (85), Expect = 1.0,   Method: Composition-based stats.
 Identities = 19/115 (16%), Positives = 45/115 (39%), Gaps = 5/115 (4%)

Query: 86  MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVED 145
            AQ +++ + + + Q ++  + + E      ++ E    P +E   E   +  ++ + E 
Sbjct: 263 EAQPEVEAQPEVESQPEVESQPEVESQPEVETQPEVEAQPEVESQPEVEPQPEVEAQPEA 322

Query: 146 VAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDN 200
            +   P+   E +   +        +P      ++ +QP +  E     E  SDN
Sbjct: 323 ESQSEPESQPEVEAQPEVE-----AQPEAESQPEADSQPEKEPEVEAEAEKVSDN 372



 Score = 36.1 bits (81), Expect = 3.6,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 38/119 (31%), Gaps = 12/119 (10%)

Query: 84  VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV 143
           V  A     E++Q +E       EQ ER     ++ E    P +E       E   QP+V
Sbjct: 231 VPEASETQPEQMQPEESQSESDGEQAERKPEIEAQPEVEAQPEVESQP----EVESQPEV 286

Query: 144 EDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
           E           E        +     +P V P  +   QP EA     P+      A 
Sbjct: 287 ESQPEVETQPEVEA-------QPEVESQPEVEPQPEVEAQP-EAESQSEPESQPEVEAQ 337



 Score = 35.3 bits (79), Expect = 5.4,   Method: Composition-based stats.
 Identities = 20/123 (16%), Positives = 45/123 (36%), Gaps = 2/123 (1%)

Query: 86  MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVED 145
            +Q +++ + + + Q +   + + E      ++ E    P  E   E   +   +P+VE 
Sbjct: 305 ESQPEVEPQPEVEAQPEAESQSEPESQPEVEAQPEVEAQPEAESQPEADSQPEKEPEVEA 364

Query: 146 VAFKTPDISREKDVSYKKVRRRRPLRP--RVFPNAKSGNQPVEATETIVPQELNSDNASS 203
            A K  D   +   +         +        +     +  EA++  VP+  + D  S 
Sbjct: 365 EAEKVSDNEVDTTEASLMETLVEGIEDGLTAAMDNLVPEELAEASDHQVPEPESEDQQSP 424

Query: 204 VDQ 206
           V +
Sbjct: 425 VTE 427


>gi|170744609|ref|YP_001773264.1| peptidase M23B [Methylobacterium sp. 4-46]
 gi|168198883|gb|ACA20830.1| peptidase M23B [Methylobacterium sp. 4-46]
          Length = 501

 Score = 37.6 bits (85), Expect = 1.0,   Method: Composition-based stats.
 Identities = 17/96 (17%), Positives = 38/96 (39%), Gaps = 1/96 (1%)

Query: 86  MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEF-EASPCPLIEEGKEPIFENSIQPKVE 144
             +A+ +++ +RD ++     +   + +  ++   E  P P +    EP      +PK E
Sbjct: 242 EGKAESRQEAKRDAKETKAAAKPAPKPEPKVAAKPEPKPEPKVAAKPEPKVAAKPEPKPE 301

Query: 145 DVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKS 180
                 P+   E  V+ K   ++    P+    A+ 
Sbjct: 302 PKVAAKPEPKPEPKVAAKPEPKKPAEAPKQVAKAEI 337


>gi|307328251|ref|ZP_07607429.1| thymidylate kinase [Streptomyces violaceusniger Tu 4113]
 gi|306886085|gb|EFN17093.1| thymidylate kinase [Streptomyces violaceusniger Tu 4113]
          Length = 1100

 Score = 37.6 bits (85), Expect = 1.0,   Method: Composition-based stats.
 Identities = 16/110 (14%), Positives = 32/110 (29%), Gaps = 7/110 (6%)

Query: 86  MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE-ASPCPLIEEGKEPIFENSIQPKVE 144
            A+ Q +   QR E      +E ++R +              +E   E +     + + +
Sbjct: 777 EAERQAEAARQRAEDARRRAEEDRKRIEAEDRARAVDEERRRLEAEAEAVRRAEAEARRQ 836

Query: 145 DVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQ 194
           +   K  +         +  + R          +     P   TET  P 
Sbjct: 837 EEQRKAEEALL------RAEQARLAADAADAAASSGAEAPTVETETPAPP 880


>gi|254565589|ref|XP_002489905.1| GTPase [Pichia pastoris GS115]
 gi|238029701|emb|CAY67624.1| GTPase [Pichia pastoris GS115]
 gi|328350316|emb|CCA36716.1| Translation initiation factor IF-2 [Pichia pastoris CBS 7435]
          Length = 1040

 Score = 37.6 bits (85), Expect = 1.0,   Method: Composition-based stats.
 Identities = 27/128 (21%), Positives = 48/128 (37%), Gaps = 12/128 (9%)

Query: 84  VSMAQAQIQEKLQRDEQ---DDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQ 140
           V++ +   QEK   +E    DD      +E  +  +  +EA    + +E  E     S Q
Sbjct: 310 VAVKEESTQEKDSEEENAIADDWEKLALEENDEPIVDSWEALEDVIKDEKSEAAEAPSKQ 369

Query: 141 PKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVF--PNAKSGNQPVEATETIVPQELNS 198
           P  E+   +TP    E+    K       L P     P  +   +P++A   I   + + 
Sbjct: 370 PSKEEAPKETPKKVEEQKAPQK-------LAPEKKSAPVEQKETKPIKAASKIEELDKSG 422

Query: 199 DNASSVDQ 206
             + S  +
Sbjct: 423 KVSKSASK 430


>gi|37519820|ref|NP_923197.1| cell division protein FtsY-like protein [Gloeobacter violaceus PCC
           7421]
 gi|35210811|dbj|BAC88192.1| glr0251 [Gloeobacter violaceus PCC 7421]
          Length = 774

 Score = 37.6 bits (85), Expect = 1.0,   Method: Composition-based stats.
 Identities = 17/83 (20%), Positives = 32/83 (38%), Gaps = 2/83 (2%)

Query: 122 SPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSG 181
            P P   + +EP+      P  E  A   PD  +   ++ +K+ +    +P V P A + 
Sbjct: 17  EPTPEPTQAQEPVEAQPPAPVEEPAA--EPDYMKWARLAQEKLNQELAAQPAVEPEAPAA 74

Query: 182 NQPVEATETIVPQELNSDNASSV 204
            +       I P    + +  +V
Sbjct: 75  FEEAPTAPPIEPPSAPAYDWQAV 97


>gi|291388151|ref|XP_002710692.1| PREDICTED: zinc finger homeodomain 4 [Oryctolagus cuniculus]
          Length = 3619

 Score = 37.6 bits (85), Expect = 1.1,   Method: Composition-based stats.
 Identities = 20/115 (17%), Positives = 40/115 (34%), Gaps = 15/115 (13%)

Query: 86   MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVED 145
             AQ + Q +   D  D ++ K      Q  +++  A+P      G       S +P+ E 
Sbjct: 2349 DAQDESQTEDSMDATDQVVYKHCTGSGQTEVAKTTAAPAASSGSGTSTPLIPSPKPEPEK 2408

Query: 146  VAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVE--ATETIVPQELNS 198
             + K    + +   S      +             G +PV   A+ +  P + ++
Sbjct: 2409 ASPKPEYPTEKPKQSDPSPAPQ-------------GTKPVPPLASTSSDPPQASA 2450


>gi|30851421|gb|AAH52474.1| Mink1 protein [Mus musculus]
          Length = 1334

 Score = 37.6 bits (85), Expect = 1.1,   Method: Composition-based stats.
 Identities = 22/140 (15%), Positives = 48/140 (34%), Gaps = 15/140 (10%)

Query: 79  HYNRIVSMAQ-----AQIQEKLQRDEQDDLLVKEQKERAQNALSE-FEASPCPLIEEGKE 132
           HY R ++ A       +++E+ + ++Q +  + + K  +        +ASP P     + 
Sbjct: 505 HYGRGINPADKPAWAREVEERARMNKQQNSPLAKAKPSSAGPEPPISQASPSPPGPLSQT 564

Query: 133 PIFENSIQPKVED-------VAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPV 185
           P  +  ++P+               P  +        + +  R L    FP +   +   
Sbjct: 565 PPMQRPVEPQEGPHKSLVAHRVPLKPYAAPVPRSQSLQDQPTRNLA--AFPASHDPDPAA 622

Query: 186 EATETIVPQELNSDNASSVD 205
             T T  P    +    + D
Sbjct: 623 VPTPTATPSARGAVIRQNSD 642


>gi|315027009|gb|EFT38941.1| LPXTG-motif protein cell wall anchor domain protein [Enterococcus
           faecalis TX2137]
          Length = 797

 Score = 37.6 bits (85), Expect = 1.1,   Method: Composition-based stats.
 Identities = 14/109 (12%), Positives = 34/109 (31%)

Query: 90  QIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFK 149
           +   K+ +   ++    ++ + +       + +     ++ KEP          +  A  
Sbjct: 571 ENNHKINQPHVEEPDKDKEPDASGEPEKGKDPAASGEPDKDKEPDASGEADKDKDPNASG 630

Query: 150 TPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
            PD  +E D S +  + + P         K  +   E  +   P     
Sbjct: 631 EPDKDKEPDASGEADKDKEPNASGEPDKDKEPDASGEPEKDKEPDASGE 679



 Score = 37.2 bits (84), Expect = 1.6,   Method: Composition-based stats.
 Identities = 17/120 (14%), Positives = 36/120 (30%), Gaps = 3/120 (2%)

Query: 86  MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVED 145
            A  +  +  + D   +    +    +     + E       ++ KEP          E 
Sbjct: 603 AASGEPDKDKEPDASGEADKDKDPNASGEPDKDKEPDASGEADKDKEPNASGEPDKDKEP 662

Query: 146 VAFKTPDISREKDVSYKKVRRRRPL---RPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
            A   P+  +E D S +  + +      +P      K+   P+E  +     +      S
Sbjct: 663 DASGEPEKDKEPDASGEPEKDKDSDASGKPDKDKETKTSEGPIEGKDQNQNPDKAGKTTS 722


>gi|311741093|ref|ZP_07714918.1| DNA polymerase III, gamma/tau subunit DnaX [Corynebacterium
           pseudogenitalium ATCC 33035]
 gi|311303895|gb|EFQ79973.1| DNA polymerase III, gamma/tau subunit DnaX [Corynebacterium
           pseudogenitalium ATCC 33035]
          Length = 787

 Score = 37.6 bits (85), Expect = 1.1,   Method: Composition-based stats.
 Identities = 20/123 (16%), Positives = 43/123 (34%), Gaps = 3/123 (2%)

Query: 84  VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV 143
           +  AQ + Q +     +     K Q +  Q    E   +  P  +E ++   +   Q + 
Sbjct: 461 LPDAQPKAQPEQPEAAEPQRTQKPQDQEPQPQRDEVAVAKQPAKQEQQQEAGD-PWQRER 519

Query: 144 EDVAFKTPDISREKDVSYKKVRRRRPLR--PRVFPNAKSGNQPVEATETIVPQELNSDNA 201
           +    + P     +    ++ RR    +  P     + +   P  A ++   +E   D A
Sbjct: 520 QIPQAEAPAQQTPQPAPDQQERREPLEKPVPARAEESATETAPEPAAQSQAAEEPAGDFA 579

Query: 202 SSV 204
            +V
Sbjct: 580 EAV 582



 Score = 36.1 bits (81), Expect = 3.5,   Method: Composition-based stats.
 Identities = 24/133 (18%), Positives = 40/133 (30%), Gaps = 9/133 (6%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
           S   AQ Q   Q +   D   K Q E+ + A  +    P     + +      + QP  +
Sbjct: 446 SAPAAQPQAPSQPESLPDAQPKAQPEQPEAAEPQRTQKPQDQEPQPQRDEVAVAKQPAKQ 505

Query: 145 DVAFKTPDISREKDVSYKKVRRRRPL---RPRVFPNAKSGNQPVE------ATETIVPQE 195
           +   +  D  + +    +     +      P      +   +PV       ATET     
Sbjct: 506 EQQQEAGDPWQRERQIPQAEAPAQQTPQPAPDQQERREPLEKPVPARAEESATETAPEPA 565

Query: 196 LNSDNASSVDQDC 208
             S  A     D 
Sbjct: 566 AQSQAAEEPAGDF 578



 Score = 34.9 bits (78), Expect = 7.4,   Method: Composition-based stats.
 Identities = 17/99 (17%), Positives = 35/99 (35%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
           ++A AQ  +            K Q+++A    S   ++P    +   +P      QPK +
Sbjct: 410 AVAGAQDPQSAAAAIIARRRAKSQEQQASAPSSAPTSAPAAQPQAPSQPESLPDAQPKAQ 469

Query: 145 DVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQ 183
               +  +  R +    ++ + +R         AK   Q
Sbjct: 470 PEQPEAAEPQRTQKPQDQEPQPQRDEVAVAKQPAKQEQQ 508


>gi|126433048|ref|YP_001068739.1| hypothetical protein Mjls_0436 [Mycobacterium sp. JLS]
 gi|126232848|gb|ABN96248.1| conserved hypothetical proline rich protein [Mycobacterium sp. JLS]
          Length = 613

 Score = 37.6 bits (85), Expect = 1.1,   Method: Composition-based stats.
 Identities = 12/60 (20%), Positives = 17/60 (28%), Gaps = 1/60 (1%)

Query: 121 ASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKS 180
             P P  E   EP      +P V       P                 P +P   P+A++
Sbjct: 553 QEPQPTQEPEPEPTVAPEPEPTVVPEPTVAPQPEPTAAPEPSAEAPAEP-QPECVPDAET 611



 Score = 36.1 bits (81), Expect = 2.8,   Method: Composition-based stats.
 Identities = 9/52 (17%), Positives = 13/52 (25%)

Query: 113 QNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKV 164
           Q      E  P P +    EP          +      P+ S E     +  
Sbjct: 553 QEPQPTQEPEPEPTVAPEPEPTVVPEPTVAPQPEPTAAPEPSAEAPAEPQPE 604


>gi|77919635|ref|YP_357450.1| ribonuclease E [Pelobacter carbinolicus DSM 2380]
 gi|77545718|gb|ABA89280.1| RNAse E [Pelobacter carbinolicus DSM 2380]
          Length = 926

 Score = 37.6 bits (85), Expect = 1.1,   Method: Composition-based stats.
 Identities = 22/119 (18%), Positives = 39/119 (32%), Gaps = 2/119 (1%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
           +   +  +E+ Q+  +       +K   +   ++ EA P    E   E   E   + K E
Sbjct: 604 AEPASAAEEQPQKPSRPRSRSGRRKPATKKTEAKPEAKPEAKPEAKPEAKPEAKPEAKPE 663

Query: 145 DVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASS 203
                 P+   E      K   +   +P   P AK   +P EA     P+        +
Sbjct: 664 AKPEAKPEAKPEAK-PEAKPEAKPEAKPEAKPEAKPEAKP-EAKPEAKPEAKPEAKPEA 720



 Score = 34.9 bits (78), Expect = 7.9,   Method: Composition-based stats.
 Identities = 22/116 (18%), Positives = 38/116 (32%), Gaps = 2/116 (1%)

Query: 88  QAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVA 147
           +A+ + K +   +     K + +      ++ EA P    E   E   E   + K E   
Sbjct: 643 EAKPEAKPEAKPEAKPEAKPEAKPEAKPEAKPEAKPEAKPEAKPEAKPEAKPEAKPEAKP 702

Query: 148 FKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASS 203
              P+   E      K   +   +P   P AK   +P EA     P+        +
Sbjct: 703 EAKPEAKPEAK-PEAKPEAKPEAKPEAKPEAKPEAKP-EAKPEAKPEAKPEAKPEA 756


>gi|56205374|emb|CAI24009.1| misshapen-like kinase 1 (zebrafish) [Mus musculus]
 gi|123233526|emb|CAM28124.1| misshapen-like kinase 1 (zebrafish) [Mus musculus]
          Length = 1334

 Score = 37.6 bits (85), Expect = 1.1,   Method: Composition-based stats.
 Identities = 22/140 (15%), Positives = 48/140 (34%), Gaps = 15/140 (10%)

Query: 79  HYNRIVSMAQ-----AQIQEKLQRDEQDDLLVKEQKERAQNALSE-FEASPCPLIEEGKE 132
           HY R ++ A       +++E+ + ++Q +  + + K  +        +ASP P     + 
Sbjct: 505 HYGRGINPADKPAWAREVEERARMNKQQNSPLAKAKPSSAGPEPPISQASPSPPGPLSQT 564

Query: 133 PIFENSIQPKVED-------VAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPV 185
           P  +  ++P+               P  +        + +  R L    FP +   +   
Sbjct: 565 PPMQRPVEPQEGPHKSLVAHRVPLKPYAAPVPRSQSLQDQPTRNLA--AFPASHDPDPAA 622

Query: 186 EATETIVPQELNSDNASSVD 205
             T T  P    +    + D
Sbjct: 623 VPTPTATPSARGAVIRQNSD 642


>gi|295671048|ref|XP_002796071.1| conserved hypothetical protein [Paracoccidioides brasiliensis Pb01]
 gi|226284204|gb|EEH39770.1| conserved hypothetical protein [Paracoccidioides brasiliensis Pb01]
          Length = 1097

 Score = 37.6 bits (85), Expect = 1.1,   Method: Composition-based stats.
 Identities = 25/155 (16%), Positives = 53/155 (34%), Gaps = 31/155 (20%)

Query: 77  AEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGK----- 131
           +EHY RI++  +       Q+   D +    Q++ ++  +S       P +++       
Sbjct: 392 SEHYMRILAQYEQAWLSSQQKQFPDQMHGSPQRDASEGTISVNPQQISPPVKQQPPMGNH 451

Query: 132 ----------EPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPR-------- 173
                      P+   + Q +  + A   P       V  K  +R    + R        
Sbjct: 452 NNSFDMGQQFSPVPAQAPQMQPHNHAQPIPVNGFSTPVQSKSQQRHVNHQQRSSLSRPPE 511

Query: 174 -VFPN---AKSGNQPVEATETIVPQ----ELNSDN 200
            + PN   A+    P++  +  VP+    +   D+
Sbjct: 512 SMSPNGRVAQFSASPIQTEKKSVPKTTKSQPGGDD 546


>gi|71416200|ref|XP_810140.1| trans-sialidase [Trypanosoma cruzi strain CL Brener]
 gi|70874628|gb|EAN88289.1| trans-sialidase, putative [Trypanosoma cruzi]
          Length = 923

 Score = 37.6 bits (85), Expect = 1.1,   Method: Composition-based stats.
 Identities = 16/86 (18%), Positives = 30/86 (34%), Gaps = 7/86 (8%)

Query: 123 PCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGN 182
           P     E  +P    S +PK  +   + P      +   ++ +   P          + +
Sbjct: 752 PAVSESEEPKPAESESEEPKPAESESEEPKP---VESESEEPKPAEPNAATSSAREGTAD 808

Query: 183 QPVEATETIVPQ----ELNSDNASSV 204
           QP  AT +          +SD+A +V
Sbjct: 809 QPASATSSSAAITDFGAFSSDDAQTV 834


>gi|71749174|ref|XP_827926.1| hypothetical protein [Trypanosoma brucei TREU927]
 gi|70833310|gb|EAN78814.1| hypothetical protein, conserved [Trypanosoma brucei]
          Length = 1012

 Score = 37.6 bits (85), Expect = 1.1,   Method: Composition-based stats.
 Identities = 15/97 (15%), Positives = 40/97 (41%), Gaps = 2/97 (2%)

Query: 90  QIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV--EDVA 147
           +++++ +  + +     ++    Q+A+     +      + ++ +     Q +   EDV 
Sbjct: 871 EVEKRRETTDDETETSSDEGALPQDAVFMTGVALEGKRTKRRKKVEIEDAQSEALKEDVE 930

Query: 148 FKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQP 184
            K P    E      + ++R P+RP+    A++   P
Sbjct: 931 RKEPVQKPETPKPPPQSKQRGPVRPKRRGGARADQAP 967


>gi|304396183|ref|ZP_07378065.1| Fertility inhibition FinO-like protein [Pantoea sp. aB]
 gi|304356552|gb|EFM20917.1| Fertility inhibition FinO-like protein [Pantoea sp. aB]
          Length = 234

 Score = 37.6 bits (85), Expect = 1.1,   Method: Composition-based stats.
 Identities = 17/96 (17%), Positives = 36/96 (37%), Gaps = 7/96 (7%)

Query: 75  QHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPI 134
           QH EH  + +  A+A++Q +  +         E +E A        A+  P   +     
Sbjct: 94  QHVEHARKQLEEAKARVQAQRDQQRAARREAGESEEGAAPRRPRKPAARKPAEGDAAR-- 151

Query: 135 FENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPL 170
                +P+ +  A      S+ +  + +  +  RP+
Sbjct: 152 -----KPRPQTTAAPRATASQHRKPAPRPEQEARPI 182


>gi|295838566|ref|ZP_06825499.1| integral membrane protein [Streptomyces sp. SPB74]
 gi|295827062|gb|EDY44742.2| integral membrane protein [Streptomyces sp. SPB74]
          Length = 463

 Score = 37.6 bits (85), Expect = 1.1,   Method: Composition-based stats.
 Identities = 14/70 (20%), Positives = 21/70 (30%), Gaps = 3/70 (4%)

Query: 105 VKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKV 164
                ERA +     +A+P P   E   P    + +P         P  + +        
Sbjct: 127 AGADAERAPDPERGADAAPGPGPAEAPGPRGAVAAEPVPVQPLAAEPVPAGDAR---PGP 183

Query: 165 RRRRPLRPRV 174
            R RP   R 
Sbjct: 184 ERARPAPSRR 193


>gi|123418875|ref|XP_001305425.1| hypothetical protein [Trichomonas vaginalis G3]
 gi|121886943|gb|EAX92495.1| conserved hypothetical protein [Trichomonas vaginalis G3]
          Length = 478

 Score = 37.6 bits (85), Expect = 1.1,   Method: Composition-based stats.
 Identities = 18/112 (16%), Positives = 36/112 (32%)

Query: 90  QIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFK 149
           Q  EK  ++ +      E+  +     ++    P P  E+  +   + +  P+    A +
Sbjct: 278 QEPEKPTQEPEKPTPAPEKPTQEPENPTQEPEKPTPAPEKPTQEPEKPTPAPEKPTPAPE 337

Query: 150 TPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNA 201
            P    EK     +   + P +P   P   S +    A       E     +
Sbjct: 338 KPTQEPEKPTQEPENPTQEPEKPTQEPTQISSSSGQPANVDERKAEKGGLGS 389



 Score = 36.4 bits (82), Expect = 2.2,   Method: Composition-based stats.
 Identities = 18/115 (15%), Positives = 40/115 (34%), Gaps = 4/115 (3%)

Query: 84  VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPI---FENSIQ 140
           V  A        ++  Q+     ++ E+   A  +    P    +E ++P     + + +
Sbjct: 262 VQEADPNETPAPEKPTQEPEKPTQEPEKPTPAPEKPTQEPENPTQEPEKPTPAPEKPTQE 321

Query: 141 PKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQE 195
           P+    A + P  + EK     +   + P  P   P  K   +P + + +     
Sbjct: 322 PEKPTPAPEKPTPAPEKPTQEPEKPTQEPENPTQEPE-KPTQEPTQISSSSGQPA 375



 Score = 36.4 bits (82), Expect = 2.7,   Method: Composition-based stats.
 Identities = 20/118 (16%), Positives = 43/118 (36%), Gaps = 8/118 (6%)

Query: 96  QRDEQDDLLVKEQKERAQNALSEFEASPCPLIE----EGKEPIFE---NSIQPKVEDVAF 148
           Q  + ++    E+  +     ++    P P  E    E + P  E    +  P+      
Sbjct: 263 QEADPNETPAPEKPTQEPEKPTQEPEKPTPAPEKPTQEPENPTQEPEKPTPAPEKPTQEP 322

Query: 149 KTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQ 206
           + P  + EK     +   + P +P   P   +  +P + T+       +S   ++VD+
Sbjct: 323 EKPTPAPEKPTPAPEKPTQEPEKPTQEPENPT-QEPEKPTQEPTQISSSSGQPANVDE 379


>gi|83644101|ref|YP_432536.1| translation initiation factor IF-2 [Hahella chejuensis KCTC 2396]
 gi|123726450|sp|Q2SML3|IF2_HAHCH RecName: Full=Translation initiation factor IF-2
 gi|83632144|gb|ABC28111.1| translation initiation factor IF-2 [Hahella chejuensis KCTC 2396]
          Length = 861

 Score = 37.6 bits (85), Expect = 1.1,   Method: Composition-based stats.
 Identities = 20/105 (19%), Positives = 36/105 (34%), Gaps = 10/105 (9%)

Query: 108 QKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISR--EKDVSYKKVR 165
           Q+E A     E EA+P   ++E          Q K    A +  + ++  E   + K  R
Sbjct: 150 QQEAANMDTQEAEAAPQASVDESVSATTAGGSQEKAGVAADQEAEDAQKSEARKTSKHRR 209

Query: 166 RRRPLRPRVFP--------NAKSGNQPVEATETIVPQELNSDNAS 202
            +     R  P          K   +P    ++     +  D++S
Sbjct: 210 NKEDSEVRREPADAEDLKRREKHKPKPAPQLKSSKVIAIEEDDSS 254


>gi|330823703|ref|YP_004387006.1| AAA ATPase [Alicycliphilus denitrificans K601]
 gi|329309075|gb|AEB83490.1| AAA ATPase [Alicycliphilus denitrificans K601]
          Length = 421

 Score = 37.6 bits (85), Expect = 1.1,   Method: Composition-based stats.
 Identities = 13/66 (19%), Positives = 24/66 (36%)

Query: 97  RDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISRE 156
           R+ +D        E + +  S     PCP+  E + P       P+ E    ++   + E
Sbjct: 7   RNNEDISEDARDAEASCDTSSTEVGEPCPVAVEAQTPATVQDEVPQPEPNLPESEPSNDE 66

Query: 157 KDVSYK 162
            D   +
Sbjct: 67  VDSDPR 72


>gi|302393103|ref|YP_003828933.1| hypothetical protein Stx2II_gp23 [Stx2 converting phage II]
          Length = 2563

 Score = 37.6 bits (85), Expect = 1.1,   Method: Composition-based stats.
 Identities = 28/152 (18%), Positives = 51/152 (33%), Gaps = 14/152 (9%)

Query: 46  TAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLV 105
             + + E+Y+    D  + GD   A        H     S    ++ E+ +R    + L 
Sbjct: 470 NREQLLEQYAD--ADMATEGDASAA--------HRREAASQLLNELDEQTKRQAVMNELK 519

Query: 106 KEQKERAQNALSEFEASPCPLIEEGKE---PIFENSIQPKVEDVAFKTPDISREKDVS-Y 161
            + +                   E ++          Q +V   A   P+ + + + S Y
Sbjct: 520 AKPRSELLEEYRRLSQKEGRTETEEQQFQAIREVIRPQQEVTPEAQSQPENAEDGNGSIY 579

Query: 162 KKVRRRRPLRPRVFPNAKSGNQPVEATETIVP 193
             VR R P   R+  N    ++P E  E + P
Sbjct: 580 PTVRFRDPNEVRIEINGNGASRPAERIEKVRP 611


>gi|114052522|ref|NP_001039424.1| misshapen-like kinase 1 isoform 3 [Mus musculus]
 gi|56205376|emb|CAI24011.1| misshapen-like kinase 1 (zebrafish) [Mus musculus]
 gi|123233525|emb|CAM28123.1| misshapen-like kinase 1 (zebrafish) [Mus musculus]
          Length = 1337

 Score = 37.6 bits (85), Expect = 1.1,   Method: Composition-based stats.
 Identities = 22/140 (15%), Positives = 48/140 (34%), Gaps = 15/140 (10%)

Query: 79  HYNRIVSMAQ-----AQIQEKLQRDEQDDLLVKEQKERAQNALSE-FEASPCPLIEEGKE 132
           HY R ++ A       +++E+ + ++Q +  + + K  +        +ASP P     + 
Sbjct: 508 HYGRGINPADKPAWAREVEERARMNKQQNSPLAKAKPSSAGPEPPISQASPSPPGPLSQT 567

Query: 133 PIFENSIQPKVED-------VAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPV 185
           P  +  ++P+               P  +        + +  R L    FP +   +   
Sbjct: 568 PPMQRPVEPQEGPHKSLVAHRVPLKPYAAPVPRSQSLQDQPTRNLA--AFPASHDPDPAA 625

Query: 186 EATETIVPQELNSDNASSVD 205
             T T  P    +    + D
Sbjct: 626 VPTPTATPSARGAVIRQNSD 645


>gi|197101974|ref|NP_001126608.1| vacuolar protein sorting-associated protein 4B [Pongo abelii]
 gi|75070512|sp|Q5R658|VPS4B_PONAB RecName: Full=Vacuolar protein sorting-associated protein 4B
 gi|55732104|emb|CAH92758.1| hypothetical protein [Pongo abelii]
          Length = 444

 Score = 37.6 bits (85), Expect = 1.1,   Method: Composition-based stats.
 Identities = 28/116 (24%), Positives = 39/116 (33%), Gaps = 12/116 (10%)

Query: 51  AERYSVLARDAMS---AGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKE 107
            ++   LA  A     AG+Y  A    QHA  Y   V   +AQ  +  Q          +
Sbjct: 8   LQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAQCTEYLD 67

Query: 108 QKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKK 163
           + E+ +  L   E      ++EG         QP   D      D   E D   KK
Sbjct: 68  RAEKLKEYLKNKEKKAQKPVKEG---------QPSPADEKGNDSDGEGESDDPEKK 114


>gi|331265725|ref|YP_004325355.1| cell wall surface anchor family protein [Streptococcus oralis Uo5]
 gi|326682397|emb|CBZ00014.1| cell wall surface anchor family protein [Streptococcus oralis Uo5]
          Length = 2064

 Score = 37.6 bits (85), Expect = 1.1,   Method: Composition-based stats.
 Identities = 17/114 (14%), Positives = 38/114 (33%), Gaps = 3/114 (2%)

Query: 84   VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKE--PIFENSIQP 141
            +  AQ +   + ++  Q +   + +         + E    P      E     E   QP
Sbjct: 1673 LEAAQPEKPAEPEKPVQPENPTQPENPVQPEKPGQPEKPAQPEKPTQPETPAQPEKPAQP 1732

Query: 142  KVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQE 195
            + +    + P    +       V+  +P +P      ++  QP + T+   P +
Sbjct: 1733 E-KPAQPEKPAQPEKPTQPENPVQPEKPAQPETPTQPETPAQPEKPTQPETPAQ 1785



 Score = 36.4 bits (82), Expect = 2.7,   Method: Composition-based stats.
 Identities = 18/108 (16%), Positives = 36/108 (33%), Gaps = 4/108 (3%)

Query: 90   QIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPK--VEDVA 147
            Q +   Q ++        Q E+        E       E+  +P  EN  QP+   +   
Sbjct: 1767 QPETPAQPEKPTQPETPAQPEKPTQPEKPAEPEKPAQPEKPVQP--ENPTQPEQPAQPET 1824

Query: 148  FKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQE 195
               PD   + +   +  +  +P +P          +PV+      P++
Sbjct: 1825 PAQPDNPVQPEKPAEPEKPAQPEKPVQPETPAQPEKPVQPETPAQPEK 1872



 Score = 36.1 bits (81), Expect = 2.9,   Method: Composition-based stats.
 Identities = 17/100 (17%), Positives = 39/100 (39%), Gaps = 3/100 (3%)

Query: 97   RDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIF-ENSIQPK--VEDVAFKTPDI 153
            ++ +    V +  E A   +++ EA+      E ++P+  EN  QP+  V+      P+ 
Sbjct: 1651 QEAKTQEAVNKALETALEQINKLEAAQPEKPAEPEKPVQPENPTQPENPVQPEKPGQPEK 1710

Query: 154  SREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVP 193
              + +   +     +P +P          +P +  +   P
Sbjct: 1711 PAQPEKPTQPETPAQPEKPAQPEKPAQPEKPAQPEKPTQP 1750



 Score = 35.3 bits (79), Expect = 5.6,   Method: Composition-based stats.
 Identities = 19/109 (17%), Positives = 32/109 (29%), Gaps = 6/109 (5%)

Query: 87   AQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKE--PIFENSIQPKVE 144
            AQ +   + ++  Q +   + +K        + E    P      E     E   QP+  
Sbjct: 1724 AQPEKPAQPEKPAQPEKPAQPEKPTQPENPVQPEKPAQPETPTQPETPAQPEKPTQPETP 1783

Query: 145  DVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVP 193
                K      EK       +  +P +P    N     QP +      P
Sbjct: 1784 AQPEKPTQP--EKPAEP--EKPAQPEKPVQPENPTQPEQPAQPETPAQP 1828


>gi|167761980|ref|ZP_02434107.1| hypothetical protein BACSTE_00325 [Bacteroides stercoris ATCC
           43183]
 gi|167700212|gb|EDS16791.1| hypothetical protein BACSTE_00325 [Bacteroides stercoris ATCC
           43183]
          Length = 659

 Score = 37.6 bits (85), Expect = 1.1,   Method: Composition-based stats.
 Identities = 26/116 (22%), Positives = 45/116 (38%), Gaps = 7/116 (6%)

Query: 87  AQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDV 146
           A  +++E+ + D+Q    V  +KE A    +  +       +  + P  + S+Q      
Sbjct: 53  AADKLKEERKGDKQKRSRVTVKKEAADKVFTANKNGELTKGKTEEAPAVQASVQ---AAE 109

Query: 147 AFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
           A K P ++       +  +R+ P RPR     K    PV  T   VP E   +   
Sbjct: 110 AAKEPAVAATPAAETEVPKRK-PGRPR---KVKQEAAPVAETPKTVPAETKVETTE 161


>gi|170102565|ref|XP_001882498.1| retrovirus-related pol polyprotein [Laccaria bicolor S238N-H82]
 gi|164642395|gb|EDR06651.1| retrovirus-related pol polyprotein [Laccaria bicolor S238N-H82]
          Length = 1450

 Score = 37.6 bits (85), Expect = 1.1,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 17/50 (34%), Gaps = 1/50 (2%)

Query: 145 DVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQ 194
                T   +          R  RP  P + PNA +   P EAT T  P 
Sbjct: 848 SSVDSTDPGAVVVPRKPLAPRP-RPTDPPLHPNATTPTVPAEATPTPTPL 896


>gi|123975142|ref|XP_001330214.1| hypothetical protein [Trichomonas vaginalis G3]
 gi|121896202|gb|EAY01361.1| conserved hypothetical protein [Trichomonas vaginalis G3]
          Length = 961

 Score = 37.6 bits (85), Expect = 1.1,   Method: Composition-based stats.
 Identities = 23/136 (16%), Positives = 46/136 (33%), Gaps = 17/136 (12%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEF---EASPCPLIEEGKEPIFENSIQP 141
           S+AQ +     QR    +     +        ++    +    P+    K+   ++ IQP
Sbjct: 239 SVAQNRSDSSQQRPNNQNQTQSPKSPTQTQQNTQNKQPQPVQQPISAPEKQEKPQSQIQP 298

Query: 142 -----------KVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATET 190
                      + +    + P+  +E   S  K + ++P+ P   P  +   QP     T
Sbjct: 299 PKQETTVQQPQQQKVQQEQKPESVQEPKESAPKPKIQKPI-PEEKP--QEPKQPAPVVTT 355

Query: 191 IVPQELNSDNASSVDQ 206
                    +A SV +
Sbjct: 356 TSEPSTPHVSAQSVPK 371


>gi|114052104|ref|NP_001039429.1| misshapen-like kinase 1 isoform 4 [Mus musculus]
 gi|148680635|gb|EDL12582.1| misshapen-like kinase 1 (zebrafish), isoform CRA_d [Mus musculus]
          Length = 1344

 Score = 37.6 bits (85), Expect = 1.1,   Method: Composition-based stats.
 Identities = 22/140 (15%), Positives = 48/140 (34%), Gaps = 15/140 (10%)

Query: 79  HYNRIVSMAQ-----AQIQEKLQRDEQDDLLVKEQKERAQNALSE-FEASPCPLIEEGKE 132
           HY R ++ A       +++E+ + ++Q +  + + K  +        +ASP P     + 
Sbjct: 508 HYGRGINPADKPAWAREVEERARMNKQQNSPLAKAKPSSAGPEPPISQASPSPPGPLSQT 567

Query: 133 PIFENSIQPKVED-------VAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPV 185
           P  +  ++P+               P  +        + +  R L    FP +   +   
Sbjct: 568 PPMQRPVEPQEGPHKSLVAHRVPLKPYAAPVPRSQSLQDQPTRNLA--AFPASHDPDPAA 625

Query: 186 EATETIVPQELNSDNASSVD 205
             T T  P    +    + D
Sbjct: 626 VPTPTATPSARGAVIRQNSD 645


>gi|156093940|ref|XP_001613008.1| serine-repeat antigen 4 (SERA) [Plasmodium vivax SaI-1]
 gi|1381089|gb|AAB41486.1| V-SERA 4 [Plasmodium vivax]
 gi|148801882|gb|EDL43281.1| serine-repeat antigen 4 (SERA) [Plasmodium vivax]
          Length = 1231

 Score = 37.6 bits (85), Expect = 1.2,   Method: Composition-based stats.
 Identities = 22/127 (17%), Positives = 42/127 (33%), Gaps = 7/127 (5%)

Query: 87  AQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEA-SPCPLIEEGKEPIFENSIQPKVED 145
           A+  + + L +          ++   Q      +  +  P+ +   +PI + + QP  + 
Sbjct: 76  AEQAVDQPLTQSTDQPADQPAEQPADQALTQPTDQPANQPVDQPTDQPIDQPTDQPVDQT 135

Query: 146 VAFKTPDISREKDVSYKKVRRRRPL-----RPRVFPNAKSGNQPV-EATETIVPQELNSD 199
               T   + E           +PL     +P   P  +S +QP  E       Q  +  
Sbjct: 136 TDQTTEQPAGEPLTQSTDEPVDQPLTQSTDQPAGEPLTQSTDQPAGEPLTQSTDQPADQP 195

Query: 200 NASSVDQ 206
              S DQ
Sbjct: 196 ADQSADQ 202


>gi|148680633|gb|EDL12580.1| misshapen-like kinase 1 (zebrafish), isoform CRA_b [Mus musculus]
          Length = 1345

 Score = 37.6 bits (85), Expect = 1.2,   Method: Composition-based stats.
 Identities = 22/140 (15%), Positives = 48/140 (34%), Gaps = 15/140 (10%)

Query: 79  HYNRIVSMAQ-----AQIQEKLQRDEQDDLLVKEQKERAQNALSE-FEASPCPLIEEGKE 132
           HY R ++ A       +++E+ + ++Q +  + + K  +        +ASP P     + 
Sbjct: 516 HYGRGINPADKPAWAREVEERARMNKQQNSPLAKAKPSSAGPEPPISQASPSPPGPLSQT 575

Query: 133 PIFENSIQPKVED-------VAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPV 185
           P  +  ++P+               P  +        + +  R L    FP +   +   
Sbjct: 576 PPMQRPVEPQEGPHKSLVAHRVPLKPYAAPVPRSQSLQDQPTRNLA--AFPASHDPDPAA 633

Query: 186 EATETIVPQELNSDNASSVD 205
             T T  P    +    + D
Sbjct: 634 VPTPTATPSARGAVIRQNSD 653


>gi|160873562|ref|YP_001552878.1| hypothetical protein Sbal195_0437 [Shewanella baltica OS195]
 gi|160859084|gb|ABX47618.1| conserved hypothetical protein [Shewanella baltica OS195]
 gi|315265792|gb|ADT92645.1| lipase class 3 [Shewanella baltica OS678]
          Length = 488

 Score = 37.6 bits (85), Expect = 1.2,   Method: Composition-based stats.
 Identities = 22/89 (24%), Positives = 36/89 (40%), Gaps = 8/89 (8%)

Query: 108 QKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRR 167
           + E A +   E      P++     P  + S  P+V +   + P++S+E+D S       
Sbjct: 398 ESEAATSTQGEAPVPQEPVMIVEPLPEEQGSPTPEV-NAPLQEPNVSQEQDKSAVTEAPP 456

Query: 168 RP-------LRPRVFPNAKSGNQPVEATE 189
            P       L+P   PN  +  QP   TE
Sbjct: 457 APIKAPELELKPEAKPNDGAEPQPKVETE 485


>gi|73986906|ref|XP_853900.1| PREDICTED: similar to Dedicator of cytokinesis protein 6 [Canis
           familiaris]
          Length = 2995

 Score = 37.6 bits (85), Expect = 1.2,   Method: Composition-based stats.
 Identities = 25/131 (19%), Positives = 46/131 (35%), Gaps = 9/131 (6%)

Query: 66  DYVVAENHLQH-AEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPC 124
           D+++A    QH +  Y+ I +  Q + Q+ L R   +  +  +++   +++     +S  
Sbjct: 144 DWIIAHRRYQHLSAAYSPITTETQRERQKGLTRQIFEQDVSGDERSGPEDSDDPRHSSGS 203

Query: 125 P---LIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSG 181
           P       G   IF+          A        E+       RR   LR +  P A   
Sbjct: 204 PDDTPRSSGASGIFDLR-----NLAADSLLPSLLERTAPEDGDRRNEALRRQHRPRALLA 258

Query: 182 NQPVEATETIV 192
             P    +  V
Sbjct: 259 LYPAPDEDDAV 269


>gi|302499915|ref|XP_003011952.1| WD domain, G-beta repeat protein [Arthroderma benhamiae CBS 112371]
 gi|291175507|gb|EFE31312.1| WD domain, G-beta repeat protein [Arthroderma benhamiae CBS 112371]
          Length = 1566

 Score = 37.6 bits (85), Expect = 1.2,   Method: Composition-based stats.
 Identities = 36/226 (15%), Positives = 69/226 (30%), Gaps = 39/226 (17%)

Query: 1    MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
            +R   +  R   R  +   G+ +R +     R  D    D  +R     +          
Sbjct: 1061 VRPPSRNGRMSSRMRSNSPGARSRVSGRSTSRRRDF---DRSIRSPTSPVP------MSP 1111

Query: 61   AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQK----------- 109
            A S+GD           +H  R+++  + Q  +  +R                       
Sbjct: 1112 AESSGD----------IDHRFRLLNAERKQRYKSRERSANRRHNRSRSAPRYSSSEQRNG 1161

Query: 110  -ERAQNALSEFEASPCPL------IEEGKEPIFENSIQPKVE-DVAFKTPDISREKDVSY 161
             E+  +   E      P+       +E  +P    + Q   + D   +    + E +   
Sbjct: 1162 TEKDSDTSGETGNRSDPVYPAYNSNDEQPQPQLPGNNQIDNQLDEHGRKRSAAAELEARR 1221

Query: 162  KKVRRRRPLRPRVFPNAKSGNQPVEATETIVP-QELNSDNASSVDQ 206
            + + RR    P   P   S NQ +    +  P  + +  + SS  Q
Sbjct: 1222 QSLARRPSAPPIPLPGEASLNQILSGRPSPSPGPQTHGRSNSSFSQ 1267


>gi|301778943|ref|XP_002924893.1| PREDICTED: proteoglycan 4-like [Ailuropoda melanoleuca]
          Length = 1073

 Score = 37.6 bits (85), Expect = 1.2,   Method: Composition-based stats.
 Identities = 16/81 (19%), Positives = 25/81 (30%), Gaps = 11/81 (13%)

Query: 122 SPCPLIEEGKEPIFENSIQP----KVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVF-- 175
            P P I +  EP      +P    + E    K P  +  K  +    +   P  P+    
Sbjct: 462 EPEPTISKEPEPTTPKEPEPTTPKEPEPTTSKEPAPTTPKKPAPTTTKEPAPTAPKKLAP 521

Query: 176 -----PNAKSGNQPVEATETI 191
                P  K   +P  A+   
Sbjct: 522 TAPKEPTPKLPKKPAPASLET 542



 Score = 35.3 bits (79), Expect = 5.8,   Method: Composition-based stats.
 Identities = 13/81 (16%), Positives = 24/81 (29%), Gaps = 5/81 (6%)

Query: 120 EASPCPLIEEGKEPIFENSIQP----KVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVF 175
           E  P P   +   P      +P    + E    K P+ +  K+      +   P  P+  
Sbjct: 444 EPEPEPTTPKEPIPTISKEPEPTISKEPEPTTPKEPEPTTPKEPEPTTSKEPAPTTPK-K 502

Query: 176 PNAKSGNQPVEATETIVPQEL 196
           P   +  +P       +    
Sbjct: 503 PAPTTTKEPAPTAPKKLAPTA 523


>gi|21673303|ref|NP_661368.1| hypothetical protein CT0467 [Chlorobium tepidum TLS]
 gi|21646394|gb|AAM71710.1| conserved hypothetical protein [Chlorobium tepidum TLS]
          Length = 426

 Score = 37.6 bits (85), Expect = 1.2,   Method: Composition-based stats.
 Identities = 18/77 (23%), Positives = 25/77 (32%), Gaps = 1/77 (1%)

Query: 115 ALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRV 174
           A +     P P+  +  EP  E S QP  E     T +  +   +S        P  P +
Sbjct: 254 ATAPVSVVPEPVAVKPVEPQAEESQQPASEPALKSTSEP-QVVQLSSPGPESVAPEVPAL 312

Query: 175 FPNAKSGNQPVEATETI 191
            P       PV  T   
Sbjct: 313 KPVEPETPMPVTETAES 329


>gi|327309514|ref|XP_003239448.1| hypothetical protein TERG_01433 [Trichophyton rubrum CBS 118892]
 gi|326459704|gb|EGD85157.1| hypothetical protein TERG_01433 [Trichophyton rubrum CBS 118892]
          Length = 1499

 Score = 37.6 bits (85), Expect = 1.2,   Method: Composition-based stats.
 Identities = 36/225 (16%), Positives = 64/225 (28%), Gaps = 44/225 (19%)

Query: 3    SVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSN--GYDVKVRGTAQHIAERYSVLARD 60
            S    K SR R ++ G  S          R++D +       V  +              
Sbjct: 999  SRNGRKSSRMRSNSPGVRSRVSGRSTSRRRDFDRSIRSPTSPVPMSP------------- 1045

Query: 61   AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKER--------- 111
            A S+GD           +H  R+++  + Q  +  +R             R         
Sbjct: 1046 AESSGD----------IDHRFRLLNAERKQRYKSRERSANRRHDRSRSAPRYSSSEQRNG 1095

Query: 112  --------AQNALSEFEASPCPLIEEGKEPIFENSIQPKVE-DVAFKTPDISREKDVSYK 162
                     +         P    +E  +P      Q   + D   +    + E +   +
Sbjct: 1096 TGKDSDTSGETGNRSDPVYPAYNSDEQSQPQLPGHNQTDNQLDEHGRKRSAAAELEARRQ 1155

Query: 163  KVRRRRPLRPRVFPNAKSGNQPVEATETIVP-QELNSDNASSVDQ 206
             + RR    P   P   S NQ +    +  P  + +  + SS  Q
Sbjct: 1156 SLARRPSAPPIPLPGEASLNQILSGRPSPSPGLQTHGRSNSSFSQ 1200


>gi|167379394|ref|XP_001735121.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165903027|gb|EDR28695.1| hypothetical protein EDI_118720 [Entamoeba dispar SAW760]
          Length = 588

 Score = 37.6 bits (85), Expect = 1.2,   Method: Composition-based stats.
 Identities = 18/124 (14%), Positives = 47/124 (37%), Gaps = 2/124 (1%)

Query: 80  YNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSI 139
           Y+R  S  + +  ++  RD  D    + +  R  +   +   +  P  +       +   
Sbjct: 45  YDRSPSNKRNEFDKRYNRD-YDKRHEETKPRRPDSNRPQRPTNKRPTQDRRPSQKDKPIN 103

Query: 140 QPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSD 199
           +P+ +         S +K     +  +R+P+RP   P +K  ++     + I+ +++   
Sbjct: 104 RPENKRPVQDRRPDSIKKPRHPSQPEQRKPIRPTQKP-SKINDKYDPDLDKIINKQIKEI 162

Query: 200 NASS 203
              +
Sbjct: 163 EDKT 166


>gi|300176767|emb|CBK25336.2| unnamed protein product [Blastocystis hominis]
          Length = 977

 Score = 37.6 bits (85), Expect = 1.2,   Method: Composition-based stats.
 Identities = 18/91 (19%), Positives = 28/91 (30%), Gaps = 7/91 (7%)

Query: 123 PCPLIEEGKEPIFENSIQPKVEDVAFKTP----DISREKDVSYKKVRRRRPLRPRVFPN- 177
           P P  +   +P+   + QP  + V  +         +    +   V+   P  P   P  
Sbjct: 784 PQPAPQAVSQPVIRGAPQPVYQPVPQEAEYRRSYPQQAPSYAQPYVQGPPPTAPYSTPQP 843

Query: 178 --AKSGNQPVEATETIVPQELNSDNASSVDQ 206
             A S  QP        P    S    SV +
Sbjct: 844 APAYSTPQPAPTYSQPYPPVPASVQQYSVPR 874


>gi|302661572|ref|XP_003022452.1| WD domain, G-beta repeat protein [Trichophyton verrucosum HKI 0517]
 gi|291186398|gb|EFE41834.1| WD domain, G-beta repeat protein [Trichophyton verrucosum HKI 0517]
          Length = 1580

 Score = 37.6 bits (85), Expect = 1.2,   Method: Composition-based stats.
 Identities = 36/226 (15%), Positives = 68/226 (30%), Gaps = 39/226 (17%)

Query: 1    MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
            +R   +  R   R  +   G+ +R +     R  D    D  +R     +          
Sbjct: 1061 VRPPSRNGRMSSRMRSNSPGARSRVSGRSTSRRRDF---DRSIRSPTSPVP------MSP 1111

Query: 61   AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQK----------- 109
            A S+GD           +H  R+++  + Q  +  +R                       
Sbjct: 1112 AESSGD----------IDHRFRLLNAERKQRYKSRERSANRRHDRSRSAPRYSSSEQRNG 1161

Query: 110  -ERAQNALSEFEASPCPL------IEEGKEPIFENSIQPKVE-DVAFKTPDISREKDVSY 161
             E+  +   E      P+       +E  +P      Q   + D   +    + E +   
Sbjct: 1162 TEKDSDTSGETGNRSDPVYPAYNSNDEQPQPQLSGHNQIDNQLDEHGRKRSAAAELEARR 1221

Query: 162  KKVRRRRPLRPRVFPNAKSGNQPVEATETIVP-QELNSDNASSVDQ 206
            + + RR    P   P   S NQ +    +  P  + +  + SS  Q
Sbjct: 1222 QSLARRPSAPPIPLPGEASLNQILSGRPSPSPGPQTHGRSNSSFTQ 1267


>gi|242279645|ref|YP_002991774.1| PSP1 domain protein [Desulfovibrio salexigens DSM 2638]
 gi|242122539|gb|ACS80235.1| PSP1 domain protein [Desulfovibrio salexigens DSM 2638]
          Length = 433

 Score = 37.6 bits (85), Expect = 1.2,   Method: Composition-based stats.
 Identities = 25/114 (21%), Positives = 41/114 (35%), Gaps = 11/114 (9%)

Query: 92  QEKLQRDEQDDLLVKEQKERAQNALSEF-EASPCPLIEEGKEPIFENSIQPKVEDVAFKT 150
             + QR   D       +    N+     E  P  +  E      E + QPKV   +   
Sbjct: 299 SSRPQRSRSDRSRPDRSRSDRSNSDRPRPERKPGRVNPER-----EKTDQPKV---SVDK 350

Query: 151 PDISRE--KDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
           P++  E  KD S ++ RR+RP+R           +P +  +   P      + S
Sbjct: 351 PEVKEERRKDDSQQQDRRKRPVRKDRPQQKPEQQKPEQDKQPATPAPSGEKDDS 404


>gi|152965612|ref|YP_001361396.1| hypothetical protein Krad_1646 [Kineococcus radiotolerans SRS30216]
 gi|151360129|gb|ABS03132.1| hypothetical protein Krad_1646 [Kineococcus radiotolerans SRS30216]
          Length = 717

 Score = 37.6 bits (85), Expect = 1.2,   Method: Composition-based stats.
 Identities = 24/103 (23%), Positives = 38/103 (36%), Gaps = 4/103 (3%)

Query: 99  EQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKD 158
           +Q   +      +   A    E  P P  E  + P+   +  P+V+      P+   E  
Sbjct: 611 QQRHQVPAAAPAQHAPAQHAPERRPQPAPE--RRPVRPEARAPQVQPRPEARPEPRPETR 668

Query: 159 VSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNA 201
           V   +  R RP+RP   P   +  QP E    + P+ L    A
Sbjct: 669 VELPREER-RPVRP-AEPELHADFQPEEQFVAVAPRTLQGLAA 709


>gi|119615838|gb|EAW95432.1| hCG1645603, isoform CRA_b [Homo sapiens]
          Length = 484

 Score = 37.6 bits (85), Expect = 1.3,   Method: Composition-based stats.
 Identities = 20/114 (17%), Positives = 40/114 (35%)

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
           AQ +  L+ DE+ +  ++  +E   +   + EA P    ++G EP    + + +    A 
Sbjct: 224 AQAEPPLRGDEEAEPSLRGDEEAEPSLRGDEEAEPSLRRDQGAEPSLRGTEEAEPSLRAD 283

Query: 149 KTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
           +  + S   D   +   R            +    P+   E   P     + A 
Sbjct: 284 EEAEPSLRGDEEAEPPLRGDEEAEPPLRGDEEAEPPLRGDEEAEPPLRGDEEAE 337


>gi|158132192|gb|ABW17263.1| choriogenin H alpha [Oncorhynchus masou]
          Length = 547

 Score = 37.2 bits (84), Expect = 1.3,   Method: Composition-based stats.
 Identities = 16/90 (17%), Positives = 31/90 (34%), Gaps = 6/90 (6%)

Query: 112 AQNALSEFEASP-CPLIEEGKEPIFENSIQPKVEDVAFKTP-DISREKDVSYKKVRRRRP 169
            QN       +P  PL ++  +P+ +  +QP     A   P   ++       +   +RP
Sbjct: 31  PQNPAQPLPQNPAQPLPQKPAQPLPQGPVQPLPPRPAEPLPQRPAQPLPQWPAQPLPQRP 90

Query: 170 LRP----RVFPNAKSGNQPVEATETIVPQE 195
            +P       P  +   QP+         +
Sbjct: 91  AQPLPQWPAQPLPQRPAQPLPQRPAQPLPQ 120


>gi|73945437|ref|XP_857291.1| PREDICTED: similar to vacuolar protein sorting factor 4B isoform 6
           [Canis familiaris]
          Length = 453

 Score = 37.2 bits (84), Expect = 1.3,   Method: Composition-based stats.
 Identities = 29/116 (25%), Positives = 42/116 (36%), Gaps = 12/116 (10%)

Query: 51  AERYSVLARDAMS---AGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKE 107
            ++   LA  A     AG+Y  A    QHA  Y   V   +AQ  +  Q          +
Sbjct: 8   FQKAVDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLD 67

Query: 108 QKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKK 163
           + E+ +  L + E +P   ++EG         QP   D      D   E D   KK
Sbjct: 68  RAEKLKEYLKKKEKTPQKPVKEG---------QPSPADEKGNDSDGEGETDDPEKK 114


>gi|73945435|ref|XP_857249.1| PREDICTED: similar to vacuolar protein sorting factor 4B isoform 5
           [Canis familiaris]
          Length = 457

 Score = 37.2 bits (84), Expect = 1.3,   Method: Composition-based stats.
 Identities = 29/116 (25%), Positives = 42/116 (36%), Gaps = 12/116 (10%)

Query: 51  AERYSVLARDAMS---AGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKE 107
            ++   LA  A     AG+Y  A    QHA  Y   V   +AQ  +  Q          +
Sbjct: 8   FQKAVDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLD 67

Query: 108 QKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKK 163
           + E+ +  L + E +P   ++EG         QP   D      D   E D   KK
Sbjct: 68  RAEKLKEYLKKKEKTPQKPVKEG---------QPSPADEKGNDSDGEGETDDPEKK 114


>gi|195398135|ref|XP_002057680.1| GJ18264 [Drosophila virilis]
 gi|194141334|gb|EDW57753.1| GJ18264 [Drosophila virilis]
          Length = 680

 Score = 37.2 bits (84), Expect = 1.3,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 54/151 (35%), Gaps = 19/151 (12%)

Query: 66  DYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQ-----------DDLLVKEQKERAQN 114
           + V  EN  Q       I      ++Q+++QR+E+           +D+   +++   + 
Sbjct: 423 EEVDEENFDQV------ISKALSPKLQKQVQRNEKVRSSINNAWVVEDVDANDEESNPKT 476

Query: 115 ALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRV 174
           +  E E       E+ +EP  ++  QPK +       +  ++     K+  + +    R 
Sbjct: 477 SKQETEKVKQQSKEKAEEPKQKSKHQPKQQTKEQPKDETDQQLKAQSKQPIKEQTKAAR- 535

Query: 175 FPNAKSGNQPVEATETIVPQELNSDNASSVD 205
            P  +S            P+  N  N    D
Sbjct: 536 -PEQESTTLTETEPAESTPKPSNGWNEPLQD 565


>gi|10048483|ref|NP_064483.1| protein piccolo isoform 1 [Rattus norvegicus]
 gi|24212076|sp|Q9JKS6|PCLO_RAT RecName: Full=Protein piccolo; AltName: Full=Aczonin; AltName:
           Full=Multidomain presynaptic cytomatrix protein
 gi|7528227|gb|AAF63196.1| multidomain presynaptic cytomatrix protein Piccolo [Rattus
           norvegicus]
          Length = 5085

 Score = 37.2 bits (84), Expect = 1.3,   Method: Composition-based stats.
 Identities = 12/76 (15%), Positives = 24/76 (31%), Gaps = 1/76 (1%)

Query: 115 ALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRV 174
                +  P   +    +P      +P+ +  A   P   +       + +   P +P+ 
Sbjct: 399 QPIPAKPQPQQPVATKTQPQQSAPAKPQPQQPAPAKPQPQQPTPAKP-QPQPPTPAKPQP 457

Query: 175 FPNAKSGNQPVEATET 190
            P   +  QP   T T
Sbjct: 458 QPPTATKPQPQPPTAT 473


>gi|325954515|ref|YP_004238175.1| PSP1 domain protein [Weeksella virosa DSM 16922]
 gi|323437133|gb|ADX67597.1| PSP1 domain protein [Weeksella virosa DSM 16922]
          Length = 487

 Score = 37.2 bits (84), Expect = 1.3,   Method: Composition-based stats.
 Identities = 15/106 (14%), Positives = 37/106 (34%), Gaps = 1/106 (0%)

Query: 84  VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPC-PLIEEGKEPIFENSIQPK 142
           +     + + + +R+ Q+     ++    Q+  S  +  P       GK+ +     +P+
Sbjct: 356 LERFDRKNKSQNKRNRQNRQRNSKESNPKQSTQSTRQRKPQNRTATSGKQQVPSTPSKPE 415

Query: 143 VEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEAT 188
            E+         +   V  K  +R  P++ +     K      + T
Sbjct: 416 EENKTLHKQRRRKPVPVKNKTEQRTNPIKKQDVQPTKKNTHQGQNT 461


>gi|114588047|ref|XP_001137270.1| PREDICTED: ADP-ribosylation factor-like 2-like 1 isoform 2 [Pan
           troglodytes]
 gi|114588049|ref|XP_001137759.1| PREDICTED: ADP-ribosylation factor-like 13B isoform 6 [Pan
           troglodytes]
          Length = 428

 Score = 37.2 bits (84), Expect = 1.3,   Method: Composition-based stats.
 Identities = 29/149 (19%), Positives = 58/149 (38%), Gaps = 11/149 (7%)

Query: 57  LARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNAL 116
           +ARD  +  + +  E   Q      R +   + Q + +  R  +++    EQ++   +  
Sbjct: 190 IARDFDALNERIQKETTEQ------RALEEQEKQERAERVRKLREERKQNEQEQAELDGT 243

Query: 117 SE-FEASPCPLIEEGK--EPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPR 173
           S   E  P P          I EN  + + E    K    S    + +K    +   + +
Sbjct: 244 SGLAELDPEPTNPFQPIASVIIENEGKLEREKKKQKMEKDSDGCHLKHKMEHEQIETQGQ 303

Query: 174 VFPNAKSGN--QPVEATETIVPQELNSDN 200
           V  N +  N  + VE  +  + Q+LN+++
Sbjct: 304 VNHNGQKNNEFRLVENYKEALTQQLNNED 332


>gi|332685843|ref|YP_004455617.1| secreted antigen GbpB/SagA/PcsB [Melissococcus plutonius ATCC
           35311]
 gi|332369852|dbj|BAK20808.1| secreted antigen GbpB/SagA/PcsB, putative peptidoglycan hydrolase
           [Melissococcus plutonius ATCC 35311]
          Length = 544

 Score = 37.2 bits (84), Expect = 1.3,   Method: Composition-based stats.
 Identities = 23/115 (20%), Positives = 39/115 (33%), Gaps = 5/115 (4%)

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
           A+  +      +      +Q +  Q      E    P   +  E   E   QP       
Sbjct: 293 AENNQASGTSVEQPKETPKQPDAGQQPEQPKETPKQPDAGQQPEQPKETPKQPDAG---- 348

Query: 149 KTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASS 203
           + P+  +E      +V + +P +P+  P      QPV+      P   NS N S+
Sbjct: 349 QQPEQPKETP-KQPEVEQVQPEQPKETPKPVQPEQPVQHPVAHTPTHNNSGNGSA 402


>gi|328949958|ref|YP_004367293.1| Chaperone protein dnaK [Marinithermus hydrothermalis DSM 14884]
 gi|328450282|gb|AEB11183.1| Chaperone protein dnaK [Marinithermus hydrothermalis DSM 14884]
          Length = 623

 Score = 37.2 bits (84), Expect = 1.4,   Method: Composition-based stats.
 Identities = 28/162 (17%), Positives = 54/162 (33%), Gaps = 17/162 (10%)

Query: 2   RSVQQYKRSRGRGSNGGNGSFNRKNLNP-LVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           R + Q  +S GR    G            +  + D+NG          H+  +     ++
Sbjct: 439 RPMAQDNKSLGRFRLEGIPPMPAGVPQIEVTFDIDANGI--------LHVTAKEKSTGKE 490

Query: 61  AMS--AGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSE 118
           A         ++E  +Q      R++  AQ   +E  +R E  +L       R Q     
Sbjct: 491 ASIRIENTTTLSEEEIQ------RMIEEAQKHAEEDRRRKEHIELKNNLDTARIQAERIM 544

Query: 119 FEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVS 160
            E    P ++   E   + + +   +D        + E+ +S
Sbjct: 545 QEKEASPEVKSRLEAAVQKAKELVEKDAEDAELRQATEELLS 586


>gi|326780290|ref|ZP_08239555.1| hypothetical protein SACT1_6165 [Streptomyces cf. griseus
           XylebKG-1]
 gi|326660623|gb|EGE45469.1| hypothetical protein SACT1_6165 [Streptomyces cf. griseus
           XylebKG-1]
          Length = 804

 Score = 37.2 bits (84), Expect = 1.4,   Method: Composition-based stats.
 Identities = 17/93 (18%), Positives = 34/93 (36%), Gaps = 4/93 (4%)

Query: 101 DDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE----DVAFKTPDISRE 156
           D    ++      +A S+   +P  +  EG +   E++  P  E    D        + E
Sbjct: 68  DVSDAEDGAPGDGDAASDTGEAPAEVSAEGPDADAESAGSPDAEAAPTDGPDSEAAPAPE 127

Query: 157 KDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATE 189
              +  ++  +R LR R+     +   P+ A  
Sbjct: 128 LSEAQAELAAQRELRERIEQRKAAKVAPIAAGT 160


>gi|73982676|ref|XP_851317.1| PREDICTED: similar to cortactin isoform a isoform 1 [Canis
           familiaris]
          Length = 541

 Score = 37.2 bits (84), Expect = 1.4,   Method: Composition-based stats.
 Identities = 20/110 (18%), Positives = 48/110 (43%), Gaps = 4/110 (3%)

Query: 58  ARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKE---RAQN 114
           A ++ ++      EN  +  E  +R  + A+   +   +R EQ++   +  ++   +AQ 
Sbjct: 342 AVNSRTSNIRANFENLAKEKEQEDRRKAEAEKAQRMAKERQEQEEARRQLHEQAQAQAQK 401

Query: 115 ALSEFEASPCPLIEE-GKEPIFENSIQPKVEDVAFKTPDISREKDVSYKK 163
                  +P P  E+    P++E++   K E     + + +  +D S ++
Sbjct: 402 PTPPASPTPQPAQEKPPPSPVYEDAASFKAEPEPVYSMEAADYQDASSQQ 451


>gi|224613530|gb|ACN60344.1| Tax1-binding protein 1 homolog [Salmo salar]
          Length = 563

 Score = 37.2 bits (84), Expect = 1.4,   Method: Composition-based stats.
 Identities = 26/112 (23%), Positives = 49/112 (43%), Gaps = 9/112 (8%)

Query: 59  RDAMSAGDYVVAENHLQHAEHYNRIVSMA--QAQIQEKLQRDEQDDLLVKEQKERAQNAL 116
           RDA SA D  +A+ +        R+ + A  Q + +   Q    + L+ + + +  Q A 
Sbjct: 80  RDASSARDRTMADLYR------MRLETDALQQGKQEALAQCSRLERLVKQMKDDAQQEAE 133

Query: 117 SEFEASPCPLIEE-GKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRR 167
            + ++  C + +E G +P     +Q +VED A   P    E     + ++ R
Sbjct: 134 QQAKSEVCRVEDEAGADPATVAELQREVEDEAAADPATVAELQREVEDLKLR 185


>gi|123470605|ref|XP_001318507.1| hypothetical protein [Trichomonas vaginalis G3]
 gi|121901268|gb|EAY06284.1| hypothetical protein TVAG_475180 [Trichomonas vaginalis G3]
          Length = 568

 Score = 37.2 bits (84), Expect = 1.4,   Method: Composition-based stats.
 Identities = 17/84 (20%), Positives = 34/84 (40%), Gaps = 5/84 (5%)

Query: 88  QAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKE---PIFENSIQPKVE 144
           Q   ++  +  E++     E+KE +    ++   SP P   E  E   P      +PK E
Sbjct: 481 QPNSEQNQETKEEEHNNDNEKKEDSNEKENQNSESPKPENSENSEVQKPEDTKIEEPKPE 540

Query: 145 DVAFKT--PDISREKDVSYKKVRR 166
           +   +    D   E+++  K  ++
Sbjct: 541 EQKSEESNADSKAEENIENKAEQQ 564


>gi|322510755|gb|ADX06069.1| hypothetical protein 162290237 [Organic Lake phycodnavirus 1]
          Length = 636

 Score = 37.2 bits (84), Expect = 1.4,   Method: Composition-based stats.
 Identities = 13/78 (16%), Positives = 28/78 (35%), Gaps = 4/78 (5%)

Query: 115 ALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRV 174
              +  ++  P+  +  +P+     QP V       P ++ + D         +P+ P  
Sbjct: 556 QPDQSRSNQQPVAPQPDQPVTPQPDQP-VAPQPVSQP-VAPQPDQPVAPQPVSQPVAP-- 611

Query: 175 FPNAKSGNQPVEATETIV 192
            P ++   QP   + T  
Sbjct: 612 KPASQPEPQPGPTSSTTT 629


>gi|198475350|ref|XP_002132888.1| GA25376 [Drosophila pseudoobscura pseudoobscura]
 gi|198138782|gb|EDY70290.1| GA25376 [Drosophila pseudoobscura pseudoobscura]
          Length = 394

 Score = 37.2 bits (84), Expect = 1.4,   Method: Composition-based stats.
 Identities = 21/105 (20%), Positives = 37/105 (35%), Gaps = 7/105 (6%)

Query: 92  QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTP 151
           +E+ Q+ + +    + + ER +      EA P   +E   EP  EN   P   D      
Sbjct: 294 EEQPQKKQPEPERKEAKPERKEAEPERKEAEPERKVEAKPEPRDENDSGPGAVDAGDPNK 353

Query: 152 DISREKDVSYKKVRRRRPLRP-RVFPNAKSGNQPVEATETIVPQE 195
                ++    +   RR L+P R   + ++       T    P  
Sbjct: 354 AGGGGRNWDRVRNSVRRSLKPLRRKSSLRT------ETTEEKPPA 392


>gi|148992707|ref|ZP_01822350.1| pneumococcal surface protein A [Streptococcus pneumoniae SP9-BS68]
 gi|147928433|gb|EDK79448.1| pneumococcal surface protein A [Streptococcus pneumoniae SP9-BS68]
          Length = 746

 Score = 37.2 bits (84), Expect = 1.4,   Method: Composition-based stats.
 Identities = 19/93 (20%), Positives = 31/93 (33%), Gaps = 9/93 (9%)

Query: 105 VKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKV 164
             +++E    AL   + +P P   E   P      QP       + P  + + +      
Sbjct: 433 DGDEEELPARALQPEQPAPAP-KPEQPTPA-PKPEQPTPAPKP-EQPAPAPKPEQPAPAP 489

Query: 165 RRRRPLRPRVFPNAKSGNQPVEATETIVPQELN 197
           +  +P  P   P      QP  A +T   QE  
Sbjct: 490 KPEQP-APAPKP-----EQPTPAPKTGWKQENG 516


>gi|194217566|ref|XP_001918402.1| PREDICTED: misshapen-like kinase 1 (zebrafish) isoform 3 [Equus
           caballus]
          Length = 1300

 Score = 37.2 bits (84), Expect = 1.4,   Method: Composition-based stats.
 Identities = 25/139 (17%), Positives = 49/139 (35%), Gaps = 14/139 (10%)

Query: 79  HYNRIVSMAQ-----AQIQEKLQRDEQDDLLVKEQKERAQNALSEF-EASPCPLIEEGKE 132
           HY R ++ A       +++E+ + ++Q +  + + K  +        +ASP P     + 
Sbjct: 511 HYGRGINPADKPAWAREVEERTRMNKQQNSPLAKTKPSSTGPEPPVPQASPGPPGPLSQT 570

Query: 133 PIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRR------RPLRPRVFPNAKSGNQPVE 186
           P  +  ++P  ++   K+    R     Y     R      +P R      A     P  
Sbjct: 571 PPMQRPVEP--QEGPHKSLVAHRVPLKPYAAPVPRSQSLQDQPTRNLAAFPASHDPDPAV 628

Query: 187 ATETIVPQELNSDNASSVD 205
            T T  P    +    + D
Sbjct: 629 PTPTATPSARGAVIRQNSD 647


>gi|194217564|ref|XP_001918401.1| PREDICTED: misshapen-like kinase 1 (zebrafish) isoform 2 [Equus
           caballus]
          Length = 1308

 Score = 37.2 bits (84), Expect = 1.4,   Method: Composition-based stats.
 Identities = 25/139 (17%), Positives = 49/139 (35%), Gaps = 14/139 (10%)

Query: 79  HYNRIVSMAQ-----AQIQEKLQRDEQDDLLVKEQKERAQNALSEF-EASPCPLIEEGKE 132
           HY R ++ A       +++E+ + ++Q +  + + K  +        +ASP P     + 
Sbjct: 511 HYGRGINPADKPAWAREVEERTRMNKQQNSPLAKTKPSSTGPEPPVPQASPGPPGPLSQT 570

Query: 133 PIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRR------RPLRPRVFPNAKSGNQPVE 186
           P  +  ++P  ++   K+    R     Y     R      +P R      A     P  
Sbjct: 571 PPMQRPVEP--QEGPHKSLVAHRVPLKPYAAPVPRSQSLQDQPTRNLAAFPASHDPDPAV 628

Query: 187 ATETIVPQELNSDNASSVD 205
            T T  P    +    + D
Sbjct: 629 PTPTATPSARGAVIRQNSD 647


>gi|328852754|gb|EGG01897.1| hypothetical protein MELLADRAFT_49933 [Melampsora larici-populina
           98AG31]
          Length = 1303

 Score = 37.2 bits (84), Expect = 1.4,   Method: Composition-based stats.
 Identities = 24/101 (23%), Positives = 39/101 (38%), Gaps = 4/101 (3%)

Query: 42  KVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDE-- 99
           K++   +   ERY  L  DA  AG     +   + A HY  I++  +   ++K  R+E  
Sbjct: 234 KIKANIEKKEERYDDL--DAQIAGLAEDNKKFYEQAVHYKEILNEYETLSRQKDNREEMV 291

Query: 100 QDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQ 140
           QD L   E+       L          +E   E + +   Q
Sbjct: 292 QDLLEGMEEIAATDEDLRNSREESRAKLENHAERLQDTKDQ 332


>gi|269960028|ref|ZP_06174405.1| hypothetical protein VME_07890 [Vibrio harveyi 1DA3]
 gi|269835327|gb|EEZ89409.1| hypothetical protein VME_07890 [Vibrio harveyi 1DA3]
          Length = 741

 Score = 37.2 bits (84), Expect = 1.4,   Method: Composition-based stats.
 Identities = 12/66 (18%), Positives = 25/66 (37%)

Query: 98  DEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREK 157
           ++  D    +Q ++ QN  ++  A   P   + K+P      QP          D  ++ 
Sbjct: 83  EKHPDQNQDKQPDQNQNKQTDENAKQQPDQNQDKQPDEVTKPQPDQNQNKQTDEDTKQQP 142

Query: 158 DVSYKK 163
           + +  K
Sbjct: 143 EQNQDK 148



 Score = 34.9 bits (78), Expect = 6.4,   Method: Composition-based stats.
 Identities = 13/78 (16%), Positives = 29/78 (37%)

Query: 86  MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVED 145
                 Q    +++Q D   K+Q ++ Q+   +    P P   + K+   +   QP+   
Sbjct: 87  DQNQDKQPDQNQNKQTDENAKQQPDQNQDKQPDEVTKPQPDQNQNKQTDEDTKQQPEQNQ 146

Query: 146 VAFKTPDISREKDVSYKK 163
                 +  ++ D +  K
Sbjct: 147 DKQLDENTKQQPDQNQDK 164


>gi|73982668|ref|XP_863413.1| PREDICTED: similar to cortactin isoform b isoform 3 [Canis
           familiaris]
          Length = 504

 Score = 37.2 bits (84), Expect = 1.4,   Method: Composition-based stats.
 Identities = 20/110 (18%), Positives = 48/110 (43%), Gaps = 4/110 (3%)

Query: 58  ARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKE---RAQN 114
           A ++ ++      EN  +  E  +R  + A+   +   +R EQ++   +  ++   +AQ 
Sbjct: 305 AVNSRTSNIRANFENLAKEKEQEDRRKAEAEKAQRMAKERQEQEEARRQLHEQAQAQAQK 364

Query: 115 ALSEFEASPCPLIEE-GKEPIFENSIQPKVEDVAFKTPDISREKDVSYKK 163
                  +P P  E+    P++E++   K E     + + +  +D S ++
Sbjct: 365 PTPPASPTPQPAQEKPPPSPVYEDAASFKAEPEPVYSMEAADYQDASSQQ 414


>gi|312216433|emb|CBX96384.1| hypothetical protein [Leptosphaeria maculans]
          Length = 642

 Score = 37.2 bits (84), Expect = 1.4,   Method: Composition-based stats.
 Identities = 21/114 (18%), Positives = 38/114 (33%), Gaps = 3/114 (2%)

Query: 88  QAQIQEKLQRDEQDDLLVKEQKERAQNALSEF--EASPCPLIEEGKEPIFENSIQ-PKVE 144
           Q + +EK +R +Q ++  + ++ R Q          SP P  +   EP+  +  Q P+ +
Sbjct: 489 QKEQEEKERRRKQAEIDKETERLRKQFGDQSNLLRPSPQPQHQRRSEPLIPSRWQEPQRQ 548

Query: 145 DVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
                 P  +        +        PRV         P   +    P    S
Sbjct: 549 PTLRPAPLPAHPPRHQNTRPAPVPAQPPRVQFQLPFAQAPYLKSNGHRPAASQS 602


>gi|158285351|ref|XP_308260.4| AGAP007611-PA [Anopheles gambiae str. PEST]
 gi|157019950|gb|EAA03938.5| AGAP007611-PA [Anopheles gambiae str. PEST]
          Length = 1314

 Score = 37.2 bits (84), Expect = 1.4,   Method: Composition-based stats.
 Identities = 20/109 (18%), Positives = 32/109 (29%), Gaps = 18/109 (16%)

Query: 112 AQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPD-----------------IS 154
           ++   SE E    P  E G EP  E   +P+        P                   S
Sbjct: 355 SEEPNSEPEPGAEPGAEPGAEPGAEPGAEPEPGAEPGAEPGKFPTRVMIIKTLYSLLFSS 414

Query: 155 REKDVSYKKVRRRRPLRPRVFPNAKSGNQP-VEATETIVPQELNSDNAS 202
             +  S  +        P   P  KS ++P  E T     +  +  ++ 
Sbjct: 415 VVEPKSEPEPASEPGAEPNAEPEPKSESEPGAEPTSEPASEPASEPSSE 463


>gi|73945429|ref|XP_848812.1| PREDICTED: similar to vacuolar protein sorting factor 4B isoform 2
           [Canis familiaris]
          Length = 444

 Score = 37.2 bits (84), Expect = 1.4,   Method: Composition-based stats.
 Identities = 29/116 (25%), Positives = 42/116 (36%), Gaps = 12/116 (10%)

Query: 51  AERYSVLARDAMS---AGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKE 107
            ++   LA  A     AG+Y  A    QHA  Y   V   +AQ  +  Q          +
Sbjct: 8   FQKAVDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLD 67

Query: 108 QKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKK 163
           + E+ +  L + E +P   ++EG         QP   D      D   E D   KK
Sbjct: 68  RAEKLKEYLKKKEKTPQKPVKEG---------QPSPADEKGNDSDGEGETDDPEKK 114


>gi|329116854|ref|ZP_08245571.1| translation initiation factor IF-2 [Streptococcus parauberis NCFD
           2020]
 gi|326907259|gb|EGE54173.1| translation initiation factor IF-2 [Streptococcus parauberis NCFD
           2020]
          Length = 970

 Score = 37.2 bits (84), Expect = 1.5,   Method: Composition-based stats.
 Identities = 34/173 (19%), Positives = 60/173 (34%), Gaps = 5/173 (2%)

Query: 2   RSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDA 61
           R  +   R +G  SN  N   N +  N    N  S     + R       + Y+   R  
Sbjct: 152 RQGESRSRQQGGFSNRDNQLGNTRQGNQSRDNRQSFRDGNQSRDNKPGFKKDYNNRDRFQ 211

Query: 62  MSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEA 121
            +      ++      +   R  +  +A+   +  R  +DD   ++ KE  + A    E 
Sbjct: 212 GNHNQNTASKPAAGKIDFKAR-AAALKAEQNAEYTRKREDDF--RQAKEAQRLAEKAQEE 268

Query: 122 SPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKV--RRRRPLRP 172
           +    ++E  E        PKV+  A  +  +      S  K   +RR+  RP
Sbjct: 269 AKRLAVKEAAEKARLEKETPKVKPTAKVSQGVPEVAKTSTAKPVDKRRKKSRP 321


>gi|195437777|ref|XP_002066816.1| GK24351 [Drosophila willistoni]
 gi|194162901|gb|EDW77802.1| GK24351 [Drosophila willistoni]
          Length = 1001

 Score = 37.2 bits (84), Expect = 1.5,   Method: Composition-based stats.
 Identities = 25/131 (19%), Positives = 44/131 (33%), Gaps = 5/131 (3%)

Query: 80  YNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSI 139
           Y  + + A   + E  +    +   V++       A       P   +    +PI +   
Sbjct: 835 YFYVPANAVRSVDEASRPTSVE--TVEDSGGPVVVAAPVVSVPPAATMTPPPQPIVQEEP 892

Query: 140 QPKVEDVAFKTPDISREKDVSYKKVRRRR--PLRPRVFPNAKSGNQPVEATETIVPQELN 197
            P VE V   TP  +       +KV  R+  P +PR+     + ++P       V  E  
Sbjct: 893 LP-VEAVDQDTPVATITTPSPKRKVSPRKTSPRKPRIGRPKTANSKPAVEISCCVCSESG 951

Query: 198 SDNASSVDQDC 208
             N      +C
Sbjct: 952 KTNQVVTCDEC 962


>gi|198414399|ref|XP_002121959.1| PREDICTED: similar to predicted protein [Ciona intestinalis]
          Length = 414

 Score = 37.2 bits (84), Expect = 1.5,   Method: Composition-based stats.
 Identities = 14/87 (16%), Positives = 28/87 (32%), Gaps = 1/87 (1%)

Query: 116 LSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVF 175
            +  +    P  +   +P  +   QPK +  A        +     K   + +P + +  
Sbjct: 130 FNFAQPKTQPKAQLKAQPKNQPKTQPKTQPKAQLKAQPKAQPKTQPKNQLKVQP-KAQPK 188

Query: 176 PNAKSGNQPVEATETIVPQELNSDNAS 202
           PN KS   P +       Q    ++  
Sbjct: 189 PNPKSTQGPTQGPTQGPTQNSTQNSTQ 215


>gi|167381060|ref|XP_001735555.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165902394|gb|EDR28239.1| hypothetical protein EDI_054670 [Entamoeba dispar SAW760]
          Length = 589

 Score = 37.2 bits (84), Expect = 1.5,   Method: Composition-based stats.
 Identities = 23/113 (20%), Positives = 42/113 (37%), Gaps = 4/113 (3%)

Query: 80  YNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSI 139
           Y+R  S  + +  ++  RD  D    + +  R  +   +   +  P  +       + S 
Sbjct: 45  YDRSPSDKRNEFDKRYNRD-YDKRHEETKPRRPDSNRPQRPTNKRPTQDRRPSQKDKPSN 103

Query: 140 QPKVE-DVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETI 191
           +P+ +  V  + P  S  + V  KK   R+P RP         N P +    I
Sbjct: 104 RPENKRPVQDRKPTNSNRQPVDQKK--PRQPTRPEQRKPTNPNNNPAQKPSKI 154


>gi|312864341|ref|ZP_07724574.1| dextranase [Streptococcus downei F0415]
 gi|311100062|gb|EFQ58273.1| dextranase [Streptococcus downei F0415]
          Length = 1282

 Score = 37.2 bits (84), Expect = 1.5,   Method: Composition-based stats.
 Identities = 18/114 (15%), Positives = 27/114 (23%), Gaps = 5/114 (4%)

Query: 99   EQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDIS---- 154
            EQD    +    R Q           P  +    P                +P+ +    
Sbjct: 971  EQDKAQAETGVPRPQAEAVAPTKQAQPEAQVSPAPSESTKTPEASAPSQPASPEQASGQS 1030

Query: 155  -REKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQD 207
             +    S        P  P    +A  G       +     E    NA + D D
Sbjct: 1031 DQTPANSKPSPEPSTPANPEQEGDADKGQASAPEADQPTTPENTGQNAEASDAD 1084


>gi|257086389|ref|ZP_05580750.1| amidase [Enterococcus faecalis D6]
 gi|256994419|gb|EEU81721.1| amidase [Enterococcus faecalis D6]
          Length = 717

 Score = 37.2 bits (84), Expect = 1.5,   Method: Composition-based stats.
 Identities = 14/109 (12%), Positives = 34/109 (31%)

Query: 90  QIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFK 149
           +   K+ +   ++    ++ + +       + +     ++ KEP          +  A  
Sbjct: 491 ENNHKINQPHVEEPDKDKEPDASGEPEKGKDPAASGEPDKDKEPDASGEADKDKDPNASG 550

Query: 150 TPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
            PD  +E D S +  + + P         K  +   E  +   P     
Sbjct: 551 EPDKDKEPDASGEADKDKEPNASGEPDKDKEPDASGEPEKDKEPDASGE 599



 Score = 36.4 bits (82), Expect = 2.4,   Method: Composition-based stats.
 Identities = 17/120 (14%), Positives = 36/120 (30%), Gaps = 3/120 (2%)

Query: 86  MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVED 145
            A  +  +  + D   +    +    +     + E       ++ KEP          E 
Sbjct: 523 AASGEPDKDKEPDASGEADKDKDPNASGEPDKDKEPDASGEADKDKEPNASGEPDKDKEP 582

Query: 146 VAFKTPDISREKDVSYKKVRRRRPL---RPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
            A   P+  +E D S +  + +      +P      K+   P+E  +     +      S
Sbjct: 583 DASGEPEKDKEPDASGEPEKDKDSDASGKPDKDKETKTSEGPIEGKDQNQNPDKAGKTTS 642


>gi|194217562|ref|XP_001918400.1| PREDICTED: misshapen-like kinase 1 (zebrafish) isoform 1 [Equus
           caballus]
          Length = 1337

 Score = 37.2 bits (84), Expect = 1.5,   Method: Composition-based stats.
 Identities = 25/139 (17%), Positives = 49/139 (35%), Gaps = 14/139 (10%)

Query: 79  HYNRIVSMAQ-----AQIQEKLQRDEQDDLLVKEQKERAQNALSEF-EASPCPLIEEGKE 132
           HY R ++ A       +++E+ + ++Q +  + + K  +        +ASP P     + 
Sbjct: 511 HYGRGINPADKPAWAREVEERTRMNKQQNSPLAKTKPSSTGPEPPVPQASPGPPGPLSQT 570

Query: 133 PIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRR------RPLRPRVFPNAKSGNQPVE 186
           P  +  ++P  ++   K+    R     Y     R      +P R      A     P  
Sbjct: 571 PPMQRPVEP--QEGPHKSLVAHRVPLKPYAAPVPRSQSLQDQPTRNLAAFPASHDPDPAV 628

Query: 187 ATETIVPQELNSDNASSVD 205
            T T  P    +    + D
Sbjct: 629 PTPTATPSARGAVIRQNSD 647


>gi|149053205|gb|EDM05022.1| rCG32861, isoform CRA_c [Rattus norvegicus]
          Length = 1310

 Score = 37.2 bits (84), Expect = 1.5,   Method: Composition-based stats.
 Identities = 22/140 (15%), Positives = 48/140 (34%), Gaps = 15/140 (10%)

Query: 79  HYNRIVSMAQ-----AQIQEKLQRDEQDDLLVKEQKERAQNALSEF-EASPCPLIEEGKE 132
           HY R ++ A       +++E+ + ++Q +  + + K  +        +ASP P     + 
Sbjct: 518 HYGRGINPADKPAWAREVEERARMNKQQNSPLAKTKPSSAGPEPPIPQASPSPPGPLSQT 577

Query: 133 PIFENSIQPKVED-------VAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPV 185
           P  +  ++P+               P  +        + +  R L    FP +   +   
Sbjct: 578 PPMQRPVEPQEGPHKSLVAHRVPLKPYAAPVPRSQSLQDQPTRNLA--AFPASHDPDPAA 635

Query: 186 EATETIVPQELNSDNASSVD 205
             T T  P    +    + D
Sbjct: 636 VPTPTATPSARGAVIRQNSD 655


>gi|149053204|gb|EDM05021.1| rCG32861, isoform CRA_b [Rattus norvegicus]
          Length = 1318

 Score = 37.2 bits (84), Expect = 1.5,   Method: Composition-based stats.
 Identities = 22/140 (15%), Positives = 48/140 (34%), Gaps = 15/140 (10%)

Query: 79  HYNRIVSMAQ-----AQIQEKLQRDEQDDLLVKEQKERAQNALSEF-EASPCPLIEEGKE 132
           HY R ++ A       +++E+ + ++Q +  + + K  +        +ASP P     + 
Sbjct: 518 HYGRGINPADKPAWAREVEERARMNKQQNSPLAKTKPSSAGPEPPIPQASPSPPGPLSQT 577

Query: 133 PIFENSIQPKVED-------VAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPV 185
           P  +  ++P+               P  +        + +  R L    FP +   +   
Sbjct: 578 PPMQRPVEPQEGPHKSLVAHRVPLKPYAAPVPRSQSLQDQPTRNLA--AFPASHDPDPAA 635

Query: 186 EATETIVPQELNSDNASSVD 205
             T T  P    +    + D
Sbjct: 636 VPTPTATPSARGAVIRQNSD 655


>gi|119193799|ref|XP_001247503.1| hypothetical protein CIMG_01274 [Coccidioides immitis RS]
          Length = 653

 Score = 37.2 bits (84), Expect = 1.5,   Method: Composition-based stats.
 Identities = 22/132 (16%), Positives = 40/132 (30%), Gaps = 19/132 (14%)

Query: 84  VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPI-------FE 136
           V+  Q  I  K  +    +    + +   Q A S    +  P+  E   P         +
Sbjct: 111 VTAEQNSIDRKGSQVRDAETSKDDHQNSTQGAASPIGKTEKPVTAERASPDGAHSDKKRK 170

Query: 137 NSIQPKVEDVAFKTPDISREKDV------------SYKKVRRRRPLRPRVFPNAKSGNQP 184
            + +P       K    ++ K +            +      RR   PR+ P+A+    P
Sbjct: 171 LTDEPAENPALDKDQHRTKRKRLQERLQKNRRRGKTPPSAYSRRDDGPRIQPDARPPRSP 230

Query: 185 VEATETIVPQEL 196
              T +  P   
Sbjct: 231 SPITRSPSPSAA 242


>gi|242039029|ref|XP_002466909.1| hypothetical protein SORBIDRAFT_01g016455 [Sorghum bicolor]
 gi|241920763|gb|EER93907.1| hypothetical protein SORBIDRAFT_01g016455 [Sorghum bicolor]
          Length = 1034

 Score = 37.2 bits (84), Expect = 1.5,   Method: Composition-based stats.
 Identities = 25/116 (21%), Positives = 38/116 (32%), Gaps = 9/116 (7%)

Query: 92  QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTP 151
           QE+  +++  +    E  E +            P      EP  + +      D   K  
Sbjct: 336 QEESGKEQGGEAGRGETDEGSSKDDDSTSGYESPEDPHPCEPRRKPTT-----DELDKDF 390

Query: 152 DISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATET----IVPQELNSDNASS 203
           D + E      K  RRRP R      A+        TET      PQ   + +AS+
Sbjct: 391 DPNEEVPPKPPKRLRRRPARFAGHDGARERRAEATGTETTIVASAPQPEGTTSAST 446


>gi|85110037|ref|XP_963206.1| hypothetical protein NCU09482 [Neurospora crassa OR74A]
 gi|28924875|gb|EAA33970.1| hypothetical protein NCU09482 [Neurospora crassa OR74A]
 gi|38524271|emb|CAE75735.1| hypothetical protein [Neurospora crassa]
          Length = 1395

 Score = 37.2 bits (84), Expect = 1.5,   Method: Composition-based stats.
 Identities = 15/99 (15%), Positives = 34/99 (34%), Gaps = 2/99 (2%)

Query: 75  QHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPI 134
           Q+  HY+R+ +  +   Q   + +EQ+          AQ+          P +     P+
Sbjct: 223 QYERHYDRLQTEVRVLEQAVARDEEQERRQKIPDGLPAQDG--PVAHKQSPALGSVPSPV 280

Query: 135 FENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPR 173
                  ++ + A   P       ++  ++   +   PR
Sbjct: 281 AVQGPGARLPNGASHGPSPVASPRIASPRLPPPQSQSPR 319


>gi|46139389|ref|XP_391385.1| hypothetical protein FG11209.1 [Gibberella zeae PH-1]
          Length = 897

 Score = 37.2 bits (84), Expect = 1.6,   Method: Composition-based stats.
 Identities = 20/127 (15%), Positives = 39/127 (30%), Gaps = 8/127 (6%)

Query: 88  QAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVA 147
           + +  E        +    E +       S++E++P P  +E   P+ +   +P+ E   
Sbjct: 456 EPEYSESASAPAVTEAAAGESEADCDEG-SDYESAPVPKEQETSTPVADCDEEPEAESKP 514

Query: 148 FKTPDISREKDVS------YKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNA 201
                       +      Y      R + PR   NA++        +T  P       +
Sbjct: 515 EAPKQEQTTVPEADCDESDYDSQYEARSVAPRAVENAQADCDEGSDYDTK-PVAPKEQES 573

Query: 202 SSVDQDC 208
                DC
Sbjct: 574 PVAQADC 580


>gi|311694519|gb|ADP97392.1| peptidoglycan-binding domain 1 protein-like protein [marine
           bacterium HP15]
          Length = 373

 Score = 37.2 bits (84), Expect = 1.6,   Method: Composition-based stats.
 Identities = 25/122 (20%), Positives = 44/122 (36%), Gaps = 10/122 (8%)

Query: 86  MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVED 145
             +    + +         VK Q++ A+ A +     P P+  E   P    +  P+   
Sbjct: 161 DGEPDENQIVTEGTSKSTEVKPQEKVAEAAPTP----PEPVASERPAPTSAPAPTPEPAV 216

Query: 146 VAFKTPDISREKD----VSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNA 201
               TP+ ++E D        +     P  P+V    K+  QP+E   T       +DN+
Sbjct: 217 AEETTPEATKEPDPVLAQLPAEPTSAGPAEPKVTETKKA--QPIEGENTASTNSAVADNS 274

Query: 202 SS 203
            S
Sbjct: 275 QS 276


>gi|95981808|gb|ABF57895.1| ballchen [Drosophila simulans]
          Length = 603

 Score = 37.2 bits (84), Expect = 1.6,   Method: Composition-based stats.
 Identities = 16/68 (23%), Positives = 22/68 (32%), Gaps = 2/68 (2%)

Query: 120 EASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK-KVRRRRPLRPRVF-PN 177
              P P  E           +PK       TP  S +   + K   + + P   R+  PN
Sbjct: 422 RVPPAPAAESSPPGRKRVKTEPKSTPKERATPKTSPKPKGTPKASPKPQTPTAARLKTPN 481

Query: 178 AKSGNQPV 185
           AK    P 
Sbjct: 482 AKINFSPS 489


>gi|331220133|ref|XP_003322742.1| hypothetical protein PGTG_04279 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|309301732|gb|EFP78323.1| hypothetical protein PGTG_04279 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 1082

 Score = 37.2 bits (84), Expect = 1.6,   Method: Composition-based stats.
 Identities = 12/94 (12%), Positives = 29/94 (30%)

Query: 111 RAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPL 170
           +++ ++   E+ P        EP    + Q + +       ++             R   
Sbjct: 425 KSRPSIPPIESEPQVASTTQSEPQVAPTTQSEPQVAPTTQSELQVALPTESTSRIMRPSQ 484

Query: 171 RPRVFPNAKSGNQPVEATETIVPQELNSDNASSV 204
            P+  P   + + P   T       +   +A S+
Sbjct: 485 NPKKHPREAASSHPSTTTTESSLHTVPRSSAPSI 518


>gi|260785792|ref|XP_002587944.1| hypothetical protein BRAFLDRAFT_87332 [Branchiostoma floridae]
 gi|229273099|gb|EEN43955.1| hypothetical protein BRAFLDRAFT_87332 [Branchiostoma floridae]
          Length = 854

 Score = 37.2 bits (84), Expect = 1.6,   Method: Composition-based stats.
 Identities = 22/132 (16%), Positives = 46/132 (34%), Gaps = 11/132 (8%)

Query: 83  IVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPK 142
           ++     + Q   +   ++  L +  +E  +NA  +      P   E + P  E    P+
Sbjct: 93  LIRDVLRRFQPPDREIPENPELQQHDREIPENAEFQPPDREIPENLELQPPDREIPENPE 152

Query: 143 VEDVAFKTPD------ISREKDVSY--KKVRRRRPLRPRVFPNA---KSGNQPVEATETI 191
           ++    + P         RE   +   +   R  P  P + P     +  NQ  + +++ 
Sbjct: 153 LQPPDREDPQNPEFQPPDREIPENPEFQPPDREIPENPELQPENPELRPENQDPQPSQSN 212

Query: 192 VPQELNSDNASS 203
                   NA+S
Sbjct: 213 TEGANEEGNATS 224


>gi|303323925|ref|XP_003071950.1| kinase domain containing protein [Coccidioides posadasii C735 delta
           SOWgp]
 gi|240111660|gb|EER29805.1| kinase domain containing protein [Coccidioides posadasii C735 delta
           SOWgp]
          Length = 1184

 Score = 37.2 bits (84), Expect = 1.6,   Method: Composition-based stats.
 Identities = 16/91 (17%), Positives = 30/91 (32%)

Query: 115 ALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRV 174
           ++ +      P+ +   EP    +I+ + ED   +T  + R             P     
Sbjct: 575 SILKRSPRQQPIDDLRPEPSELPAIEIEAEDSVSETVPVERSVTPRPATPFNEDPGAAET 634

Query: 175 FPNAKSGNQPVEATETIVPQELNSDNASSVD 205
             +  S  QP       + +  N D+   VD
Sbjct: 635 VDDNPSLLQPQGTPRVRIVENSNEDDVDEVD 665


>gi|149187036|ref|ZP_01865343.1| hypothetical protein ED21_31284 [Erythrobacter sp. SD-21]
 gi|148829325|gb|EDL47769.1| hypothetical protein ED21_31284 [Erythrobacter sp. SD-21]
          Length = 666

 Score = 37.2 bits (84), Expect = 1.6,   Method: Composition-based stats.
 Identities = 21/125 (16%), Positives = 37/125 (29%), Gaps = 12/125 (9%)

Query: 82  RIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPC---------PLIEEGKE 132
           R +   Q + +    RD        EQ +    + S +   P          P  +   +
Sbjct: 16  RQMEAEQPEGRSNSLRDRIRRSAEGEQAQAGAVSRSGYVHRPQVEPQPEAPQPQPDAEAQ 75

Query: 133 PIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRP--LRPR-VFPNAKSGNQPVEATE 189
           P F+   +P    V  + P    E           RP  L P+          + V A++
Sbjct: 76  PGFQPDPEPAQPQVEAEAPLAQPEPSALKLGEAPPRPSDLAPKAAPEPESEPEEDVPASD 135

Query: 190 TIVPQ 194
             +  
Sbjct: 136 NALQP 140


>gi|119172617|ref|XP_001238894.1| conserved hypothetical protein [Coccidioides immitis RS]
          Length = 1184

 Score = 37.2 bits (84), Expect = 1.6,   Method: Composition-based stats.
 Identities = 16/91 (17%), Positives = 30/91 (32%)

Query: 115 ALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRV 174
           ++ +      P+ +   EP    +I+ + ED   +T  + R             P     
Sbjct: 575 SILKRSPRQQPIDDLRPEPSELPAIEIEAEDSVSETVPVERSVTPRPATPFNEDPGAAET 634

Query: 175 FPNAKSGNQPVEATETIVPQELNSDNASSVD 205
             +  S  QP       + +  N D+   VD
Sbjct: 635 VDDNPSLLQPQGTPRVRIVENSNEDDVDEVD 665


>gi|116251507|ref|YP_767345.1| ribonuclease [Rhizobium leguminosarum bv. viciae 3841]
 gi|115256155|emb|CAK07236.1| putative ribonuclease [Rhizobium leguminosarum bv. viciae 3841]
          Length = 957

 Score = 37.2 bits (84), Expect = 1.6,   Method: Composition-based stats.
 Identities = 26/133 (19%), Positives = 47/133 (35%), Gaps = 5/133 (3%)

Query: 79  HYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEP--IFE 136
           H     +       +    D Q  L  + ++ R    +   E +P   + +  +P     
Sbjct: 66  HGFLAFAEIHPDYYQIPLADRQALLRAEAEEHRRDEDVEHVETAPMVDLSKQDQPDVGIV 125

Query: 137 NSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVE--ATETIVPQ 194
            +  P+   V  +T  +         +    +  RPR     K      E  ATE  VP 
Sbjct: 126 PAEAPETAAVTEETAAVEAAASPEATEEAPAKKARPRR-SRKKVVEPVAETTATEDAVPT 184

Query: 195 ELNSDNASSVDQD 207
           ++ ++ ASSVD +
Sbjct: 185 DVEAEGASSVDNE 197


>gi|87301562|ref|ZP_01084402.1| signal recognition particle-docking protein FtsY [Synechococcus sp.
           WH 5701]
 gi|87283779|gb|EAQ75733.1| signal recognition particle-docking protein FtsY [Synechococcus sp.
           WH 5701]
          Length = 532

 Score = 37.2 bits (84), Expect = 1.6,   Method: Composition-based stats.
 Identities = 21/132 (15%), Positives = 41/132 (31%), Gaps = 20/132 (15%)

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEAS-PCPLIEEGKEPIFENSIQ-PKVEDV 146
           A+      + EQ+      + +  +      EA+ P P      EP   +    P+V+  
Sbjct: 73  ARQAYARLKAEQERSQPVAEAQVPEPTPEPVEAAAPQPEPVAAAEPEKSSEATPPEVQAT 132

Query: 147 AFKTPDISREKD----------------VSYKKVRRRRPLRPRVFPNAKSGNQPVEATET 190
             ++   S                     + +  R++  L P   P  K   +P   +  
Sbjct: 133 PAESASTSERPPALESPSPAGPSLLELAAASRAERQQTVLAPSTDPPPK--GEPTAPSSE 190

Query: 191 IVPQELNSDNAS 202
               +L S +A 
Sbjct: 191 EASPQLGSFDAD 202


>gi|194097996|ref|YP_002001044.1| IgA-specific metalloendopeptidase [Neisseria gonorrhoeae NCCP11945]
 gi|193933286|gb|ACF29110.1| IgA-specific metalloendopeptidase [Neisseria gonorrhoeae NCCP11945]
          Length = 1593

 Score = 37.2 bits (84), Expect = 1.6,   Method: Composition-based stats.
 Identities = 32/196 (16%), Positives = 55/196 (28%), Gaps = 16/196 (8%)

Query: 10   SRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVV 69
            S+ R    G+ S  + N+       +      + R  A+ +A++ +   R+A +      
Sbjct: 1087 SQDRPKRRGHRSVQQNNVEIAQAQAELARRQQEERKAAELLAKQRAEAEREAQALAARRK 1146

Query: 70   AENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEE 129
            AE               A+ Q  E   R E      +  K +A+       A   P  + 
Sbjct: 1147 AEA------------EEAKHQAAELAHRQEAKRKAAESAKRKAEEEEHRQTAQSQP--QR 1192

Query: 130  GKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATE 189
             K            +D   +    S                 PR   N        E   
Sbjct: 1193 RKRRAAPQDYMAVSQDRPKRRGRRSTLPAPPSPSFDSSAYAAPRALHNPDWYENDYEEIP 1252

Query: 190  TIVPQELNSDNASSVD 205
                ++   D + SVD
Sbjct: 1253 LDALED--EDVSESVD 1266


>gi|256761790|ref|ZP_05502370.1| amidase [Enterococcus faecalis T3]
 gi|256683041|gb|EEU22736.1| amidase [Enterococcus faecalis T3]
          Length = 667

 Score = 37.2 bits (84), Expect = 1.6,   Method: Composition-based stats.
 Identities = 16/120 (13%), Positives = 39/120 (32%), Gaps = 3/120 (2%)

Query: 86  MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVED 145
            A  + ++    D   +    ++ + +     + + +     ++ KEP          E 
Sbjct: 473 DASGEPEKDKDPDASGEPDKDKEPDASGEPEKDKDPNASGEPDKDKEPDASGEPDKDKEP 532

Query: 146 VAFKTPDISREKDVSYKKVRRRRPL---RPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
            A   P+  +E D S +  + +      +P      K+   P+E  +     +      S
Sbjct: 533 DASGEPEKDKEPDASGEPEKDKDSDASGKPDKDKETKTSEGPIEGKDQNQNPDKAGKTTS 592


>gi|307150414|ref|YP_003885798.1| hypothetical protein Cyan7822_0480 [Cyanothece sp. PCC 7822]
 gi|306980642|gb|ADN12523.1| hypothetical protein Cyan7822_0480 [Cyanothece sp. PCC 7822]
          Length = 492

 Score = 37.2 bits (84), Expect = 1.6,   Method: Composition-based stats.
 Identities = 27/122 (22%), Positives = 52/122 (42%), Gaps = 10/122 (8%)

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
            + Q+K + +   +L ++EQ+ER ++  +E    P P+ ++ +        QPK   +  
Sbjct: 112 PENQDKEKSELLSELALREQQERLKDLEAEKVKQPQPIKQDPR----TGQPQPKTVTLPQ 167

Query: 149 KTPDISREKDVSYKKVRRRRPL--RPRVFP---NAKSGNQPVEAT-ETIVPQELNSDNAS 202
           K P  S     +  +    RP+  +PR  P         +P+ A   T+ P   N  + +
Sbjct: 168 KRPVQSVPIRQTPIRQTPVRPVVYQPRPQPVPVRYGQPVRPIPAVRATVSPSRSNLVDPT 227

Query: 203 SV 204
            V
Sbjct: 228 QV 229


>gi|114588051|ref|XP_516604.2| PREDICTED: ADP-ribosylation factor-like 2-like 1 isoform 7 [Pan
           troglodytes]
          Length = 382

 Score = 36.8 bits (83), Expect = 1.7,   Method: Composition-based stats.
 Identities = 29/149 (19%), Positives = 58/149 (38%), Gaps = 11/149 (7%)

Query: 57  LARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNAL 116
           +ARD  +  + +  E   Q      R +   + Q + +  R  +++    EQ++   +  
Sbjct: 190 IARDFDALNERIQKETTEQ------RALEEQEKQERAERVRKLREERKQNEQEQAELDGT 243

Query: 117 SE-FEASPCPLIEEGK--EPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPR 173
           S   E  P P          I EN  + + E    K    S    + +K    +   + +
Sbjct: 244 SGLAELDPEPTNPFQPIASVIIENEGKLEREKKKQKMEKDSDGCHLKHKMEHEQIETQGQ 303

Query: 174 VFPNAKSGN--QPVEATETIVPQELNSDN 200
           V  N +  N  + VE  +  + Q+LN+++
Sbjct: 304 VNHNGQKNNEFRLVENYKEALTQQLNNED 332


>gi|160707980|ref|NP_001104267.1| protein piccolo isoform 2 [Rattus norvegicus]
 gi|7493836|gb|AAF07822.2|AF138789_1 multidomain presynaptic cytomatrix protein Piccolo [Rattus
           norvegicus]
          Length = 4880

 Score = 36.8 bits (83), Expect = 1.7,   Method: Composition-based stats.
 Identities = 12/76 (15%), Positives = 24/76 (31%), Gaps = 1/76 (1%)

Query: 115 ALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRV 174
                +  P   +    +P      +P+ +  A   P   +       + +   P +P+ 
Sbjct: 399 QPIPAKPQPQQPVATKTQPQQSAPAKPQPQQPAPAKPQPQQPTPAKP-QPQPPTPAKPQP 457

Query: 175 FPNAKSGNQPVEATET 190
            P   +  QP   T T
Sbjct: 458 QPPTATKPQPQPPTAT 473


>gi|299470937|emb|CBN79921.1| TTK-like [Ectocarpus siliculosus]
          Length = 967

 Score = 36.8 bits (83), Expect = 1.7,   Method: Composition-based stats.
 Identities = 16/82 (19%), Positives = 32/82 (39%), Gaps = 2/82 (2%)

Query: 81  NRIVSMAQAQIQEKLQRDEQDDLLVKEQK-ERAQNALSEFEASPCPLIEEGKEPIFENSI 139
            R+ S    Q + + +R EQ+    +  + ERA+   +E E +      E +    E + 
Sbjct: 27  TRLQSKLADQKRAEQERAEQERAEQERSEQERAEQERAEQERAEQ-ERAEQERAEQERAE 85

Query: 140 QPKVEDVAFKTPDISREKDVSY 161
           Q + E    +     +E+    
Sbjct: 86  QERAEQERAEQERAEQERAEQE 107


>gi|268316851|ref|YP_003290570.1| 30S ribosomal protein S1 [Rhodothermus marinus DSM 4252]
 gi|262334385|gb|ACY48182.1| ribosomal protein S1 [Rhodothermus marinus DSM 4252]
          Length = 720

 Score = 36.8 bits (83), Expect = 1.7,   Method: Composition-based stats.
 Identities = 17/103 (16%), Positives = 28/103 (27%), Gaps = 1/103 (0%)

Query: 98  DEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREK 157
           DEQ      +  E  +      E +P P  E    P        +    A   P    E 
Sbjct: 3   DEQKQEQATQVSEMPETPEKPQEEAPQPEAETATTPEAAQPEAAET-PEATGAPVAEAEA 61

Query: 158 DVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDN 200
           +         +  RP +    +     V+  +    QE    +
Sbjct: 62  EPEPVAEAPAQKTRPVLGFKGEITGPVVKLEDLEKQQEAREVD 104


>gi|187925165|ref|YP_001896807.1| hypothetical protein Bphyt_3191 [Burkholderia phytofirmans PsJN]
 gi|187716359|gb|ACD17583.1| protein of unknown function DUF88 [Burkholderia phytofirmans PsJN]
          Length = 478

 Score = 36.8 bits (83), Expect = 1.7,   Method: Composition-based stats.
 Identities = 27/135 (20%), Positives = 45/135 (33%), Gaps = 15/135 (11%)

Query: 45  GTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLL 104
           G    I E    L  +A  A + V+AE+  +H        S  + +   K  R +Q+ + 
Sbjct: 288 GEPAEIVESAEQL-YEAQVA-ETVIAESGGKHE-------SRRRGRGNRKAGRGQQETVH 338

Query: 105 VKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPD------ISREKD 158
            +        +             E  + IFE    P  E       +         E+D
Sbjct: 339 EERTAVEQSGSAQPGTDEAHAQTPENAQFIFELPEAPWSEPETVTAEELDTSESPPDERD 398

Query: 159 VSYKKVRRRRPLRPR 173
            S ++ +RR    PR
Sbjct: 399 TSARQPKRRNERAPR 413


>gi|317163744|gb|ADV07285.1| IgA-specific metalloendopeptidase [Neisseria gonorrhoeae
            TCDC-NG08107]
          Length = 1593

 Score = 36.8 bits (83), Expect = 1.7,   Method: Composition-based stats.
 Identities = 32/196 (16%), Positives = 55/196 (28%), Gaps = 16/196 (8%)

Query: 10   SRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVV 69
            S+ R    G+ S  + N+       +      + R  A+ +A++ +   R+A +      
Sbjct: 1087 SQDRPKRRGHRSVQQNNVEIAQAQAELARRQQEERKAAELLAKQRAEAEREAQALAARRK 1146

Query: 70   AENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEE 129
            AE               A+ Q  E   R E      +  K +A+       A   P  + 
Sbjct: 1147 AEA------------EEAKHQAAELAHRQEAKRKAAESAKRKAEEEEHRQTAQSQP--QR 1192

Query: 130  GKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATE 189
             K            +D   +    S                 PR   N        E   
Sbjct: 1193 RKRRAAPQDYMAVSQDRPKRRGRRSTLPAPPSPSFDSSAYAAPRALHNPDWYENDYEEIP 1252

Query: 190  TIVPQELNSDNASSVD 205
                ++   D + SVD
Sbjct: 1253 LDALED--EDVSESVD 1266


>gi|239998462|ref|ZP_04718386.1| IgA-specific metalloendopeptidase [Neisseria gonorrhoeae 35/02]
 gi|268594323|ref|ZP_06128490.1| protease Ig A [Neisseria gonorrhoeae 35/02]
 gi|268547712|gb|EEZ43130.1| protease Ig A [Neisseria gonorrhoeae 35/02]
          Length = 1593

 Score = 36.8 bits (83), Expect = 1.7,   Method: Composition-based stats.
 Identities = 32/196 (16%), Positives = 55/196 (28%), Gaps = 16/196 (8%)

Query: 10   SRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVV 69
            S+ R    G+ S  + N+       +      + R  A+ +A++ +   R+A +      
Sbjct: 1087 SQDRPKRRGHRSVQQNNVEIAQAQAELARRQQEERKAAELLAKQRAEAEREAQALAARRK 1146

Query: 70   AENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEE 129
            AE               A+ Q  E   R E      +  K +A+       A   P  + 
Sbjct: 1147 AEA------------EEAKHQAAELAHRQEAKRKAAESAKRKAEEEEHRQTAQSQP--QR 1192

Query: 130  GKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATE 189
             K            +D   +    S                 PR   N        E   
Sbjct: 1193 RKRRAAPQDYMAVSQDRPKRRGRRSTLPAPPSPSFDSSAYAAPRALHNPDWYENDYEEIP 1252

Query: 190  TIVPQELNSDNASSVD 205
                ++   D + SVD
Sbjct: 1253 LDALED--EDVSESVD 1266


>gi|323464506|gb|ADX76659.1| LPXTG-motif cell wall anchor domain protein [Staphylococcus
            pseudintermedius ED99]
          Length = 1031

 Score = 36.8 bits (83), Expect = 1.7,   Method: Composition-based stats.
 Identities = 21/117 (17%), Positives = 40/117 (34%), Gaps = 1/117 (0%)

Query: 88   QAQIQEKLQRDEQDDLL-VKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDV 146
            Q  + +   ++  D      EQ +  Q      +    P  E+   P  E       E  
Sbjct: 887  QPDVPQPEPKNPDDREKPAPEQPDVPQPEPKNPDDKEKPAPEQPDVPQPEPKNPDDKEKP 946

Query: 147  AFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASS 203
            A + PD  + K +   +  + +P  P         ++    T+  +P+   S + SS
Sbjct: 947  APEQPDAPQPKPMLPGEKVKPKPTHPGEAMQTTPQDKSTSQTDEALPKTGESSSQSS 1003


>gi|293340613|ref|XP_001081798.2| PREDICTED: solute carrier family 38, member 10 isoform 1 [Rattus
           norvegicus]
 gi|293352005|ref|XP_002727892.1| PREDICTED: solute carrier family 38, member 10 isoform 1 [Rattus
           norvegicus]
          Length = 1106

 Score = 36.8 bits (83), Expect = 1.7,   Method: Composition-based stats.
 Identities = 23/133 (17%), Positives = 44/133 (33%), Gaps = 11/133 (8%)

Query: 78  EHYNRIVSMAQAQIQEKLQRDEQDDLLV---KEQKERAQNALSEFEASPCPLIEEGKEPI 134
           +H   +  + + Q+Q+K   D+Q+ LL    ++ KE  Q      E  P P ++      
Sbjct: 693 DHAVLLQVIKEQQVQQKRLLDQQEKLLAVIEEQHKEIRQQRQEGEEDKPKPDMQPEPGAA 752

Query: 135 FENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVF--PNAKSGNQPVEAT---- 188
                + + E             + +  +  +     PR    P+   G  P+E      
Sbjct: 753 VLRGQEEEAEHAGAPDEHAGETLEDNPSQPLQPVLGAPRGHPAPSQDKGQHPLEEVKVLA 812

Query: 189 --ETIVPQELNSD 199
             +        SD
Sbjct: 813 GRDLADLPAGGSD 825


>gi|115963910|ref|XP_001190555.1| PREDICTED: hypothetical protein, partial [Strongylocentrotus
           purpuratus]
          Length = 391

 Score = 36.8 bits (83), Expect = 1.7,   Method: Composition-based stats.
 Identities = 18/117 (15%), Positives = 37/117 (31%), Gaps = 6/117 (5%)

Query: 93  EKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPK--VEDVAFKT 150
           E+ + +E      +E  +    +      +  P  +   +P  E + +P     +   +T
Sbjct: 268 EETKTEEVKSDEKEEGAKEEPKSEEPAADTGAPAEKTEDKPADEAAEKPAETPAEAPAET 327

Query: 151 P-DISREKDVSYKKVRRRR-PLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVD 205
           P +  +E             P         K+   P E TE   P     ++  + D
Sbjct: 328 PAEAPKETPAETPAETPAETPAETPAEDTEKAKEAPAEKTEDAEPVA--EESKETAD 382


>gi|325270080|ref|ZP_08136687.1| penicillin-binding protein 2 [Prevotella multiformis DSM 16608]
 gi|324987381|gb|EGC19357.1| penicillin-binding protein 2 [Prevotella multiformis DSM 16608]
          Length = 744

 Score = 36.8 bits (83), Expect = 1.7,   Method: Composition-based stats.
 Identities = 18/93 (19%), Positives = 34/93 (36%)

Query: 83  IVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPK 142
           I+  +   ++EK  R+E D     + K+ A+      +    P I    E +     + K
Sbjct: 632 IIRDSLKMVREKQDREEADRAKEAQAKKEAEEKEKNKQPQNDPAIRVEPEELVRPEKKDK 691

Query: 143 VEDVAFKTPDISREKDVSYKKVRRRRPLRPRVF 175
             D      +  +EKD    +  R+   + R  
Sbjct: 692 DRDREGDRKEKEKEKDSRDSRKERKDKSKDRSK 724


>gi|121698162|ref|XP_001267734.1| C6 finger domain protein, putative [Aspergillus clavatus NRRL 1]
 gi|119395876|gb|EAW06308.1| C6 finger domain protein, putative [Aspergillus clavatus NRRL 1]
          Length = 1139

 Score = 36.8 bits (83), Expect = 1.7,   Method: Composition-based stats.
 Identities = 14/88 (15%), Positives = 24/88 (27%), Gaps = 3/88 (3%)

Query: 110 ERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDV-AFKTPDISREKDVSYKKVRRRR 168
           +          A+P P +     P+  N   P++     +  P+       +  +     
Sbjct: 83  DHHHAEQRRTSAAPQPPLPSHPYPVIPNRELPQLPPEGPYGRPNGLPGPSHTPTEAHPPP 142

Query: 169 PLRPRVFPNAKSGNQPVEATETIVPQEL 196
           P RP     A     P  A     P   
Sbjct: 143 PFRP--MNGASHDANPHSAPPHSAPPHS 168


>gi|160896944|ref|YP_001562526.1| Zinc finger-domain-containing protein [Delftia acidovorans SPH-1]
 gi|160362528|gb|ABX34141.1| MJ0042 family finger-like protein [Delftia acidovorans SPH-1]
          Length = 475

 Score = 36.8 bits (83), Expect = 1.7,   Method: Composition-based stats.
 Identities = 19/92 (20%), Positives = 36/92 (39%), Gaps = 5/92 (5%)

Query: 113 QNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRP 172
              L+   A+P        E   +  + P+  D A   P  + +++ +       RP +P
Sbjct: 192 DEILAASRAAPKSPPAAQAEQAIDGLLGPEP-DKAAPVPAPAEDEEGAPFT----RPHKP 246

Query: 173 RVFPNAKSGNQPVEATETIVPQELNSDNASSV 204
              P+ KS + P  +  T + +E      +SV
Sbjct: 247 SDKPSDKSSDAPAPSVPTGLLRESEPQVQASV 278


>gi|19920466|ref|NP_608526.1| CG4133 [Drosophila melanogaster]
 gi|7296200|gb|AAF51492.1| CG4133 [Drosophila melanogaster]
 gi|18447493|gb|AAL68309.1| RE51073p [Drosophila melanogaster]
 gi|220948886|gb|ACL86986.1| CG4133-PA [synthetic construct]
          Length = 667

 Score = 36.8 bits (83), Expect = 1.8,   Method: Composition-based stats.
 Identities = 19/124 (15%), Positives = 42/124 (33%), Gaps = 10/124 (8%)

Query: 86  MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVED 145
             +  +Q+K  +  + +     ++   Q+     + +                + P  ED
Sbjct: 192 QNRQLLQDKPSQASKQNQSPAGERTHPQSHHHPRDRASTTANP--------LRLDPSPED 243

Query: 146 VAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATET--IVPQELNSDNASS 203
            +   P  + EK ++  K   +  L+P   P A   N+  E  +       E +  +A  
Sbjct: 244 GSAARPRSAGEKLLNKLKELGKAHLKPAADPEASRQNETGEEEDEKGSGQPEGSGQSADE 303

Query: 204 VDQD 207
           V  +
Sbjct: 304 VKTE 307


>gi|320162843|gb|EFW39742.1| leucine rich repeat containing protein 16A [Capsaspora owczarzaki
            ATCC 30864]
          Length = 1963

 Score = 36.8 bits (83), Expect = 1.8,   Method: Composition-based stats.
 Identities = 14/74 (18%), Positives = 22/74 (29%), Gaps = 3/74 (4%)

Query: 123  PCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREK-DVSYKKVRRRRPLRPRVFPNAKSG 181
            P P   E  +P      QP  + V    P  + +    +      + PL P   P+   G
Sbjct: 1741 PRPAPAEKPQP--AEKPQPADKPVPANKPVPADKPQPAAKPLPAPKVPLLPVKAPSKDGG 1798

Query: 182  NQPVEATETIVPQE 195
                 +  T     
Sbjct: 1799 ESGSASPTTPTSPA 1812


>gi|293340615|ref|XP_001081800.2| PREDICTED: solute carrier family 38, member 10 isoform 2 [Rattus
           norvegicus]
 gi|293352007|ref|XP_221195.4| PREDICTED: solute carrier family 38, member 10 isoform 3 [Rattus
           norvegicus]
          Length = 1098

 Score = 36.8 bits (83), Expect = 1.8,   Method: Composition-based stats.
 Identities = 23/133 (17%), Positives = 44/133 (33%), Gaps = 11/133 (8%)

Query: 78  EHYNRIVSMAQAQIQEKLQRDEQDDLLV---KEQKERAQNALSEFEASPCPLIEEGKEPI 134
           +H   +  + + Q+Q+K   D+Q+ LL    ++ KE  Q      E  P P ++      
Sbjct: 685 DHAVLLQVIKEQQVQQKRLLDQQEKLLAVIEEQHKEIRQQRQEGEEDKPKPDMQPEPGAA 744

Query: 135 FENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVF--PNAKSGNQPVEAT---- 188
                + + E             + +  +  +     PR    P+   G  P+E      
Sbjct: 745 VLRGQEEEAEHAGAPDEHAGETLEDNPSQPLQPVLGAPRGHPAPSQDKGQHPLEEVKVLA 804

Query: 189 --ETIVPQELNSD 199
             +        SD
Sbjct: 805 GRDLADLPAGGSD 817


>gi|294893826|ref|XP_002774666.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gi|239880059|gb|EER06482.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
          Length = 730

 Score = 36.8 bits (83), Expect = 1.8,   Method: Composition-based stats.
 Identities = 19/92 (20%), Positives = 36/92 (39%), Gaps = 5/92 (5%)

Query: 115 ALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRR-----P 169
             S  E +P P +E   EP  E +++P +E  A  + + + E  V              P
Sbjct: 229 GESPVETTPEPPVETTAEPAVETTVEPPIETTAEPSFETTVEPLVDTAAEPPVETTAEPP 288

Query: 170 LRPRVFPNAKSGNQPVEATETIVPQELNSDNA 201
           +     P+ ++  +P   T    P E  ++ +
Sbjct: 289 VETTAEPSVETTAEPPVETTAEPPVETTAEPS 320


>gi|59800725|ref|YP_207437.1| IgA-specific metalloendopeptidase [Neisseria gonorrhoeae FA 1090]
 gi|59717620|gb|AAW89025.1| IgA-specific metalloendopeptidase [Neisseria gonorrhoeae FA 1090]
          Length = 1593

 Score = 36.8 bits (83), Expect = 1.8,   Method: Composition-based stats.
 Identities = 32/196 (16%), Positives = 55/196 (28%), Gaps = 16/196 (8%)

Query: 10   SRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVV 69
            S+ R    G+ S  + N+       +      + R  A+ +A++ +   R+A +      
Sbjct: 1087 SQDRPKRRGHRSVQQNNVEIAQAQAELARRQQEERKAAELLAKQRAEAEREAQALAARRK 1146

Query: 70   AENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEE 129
            AE               A+ Q  E   R E      +  K +A+       A   P  + 
Sbjct: 1147 AEA------------EEAKHQAAELAHRQEAKRKAAESAKRKAEEEEHRQTAQSQP--QR 1192

Query: 130  GKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATE 189
             K            +D   +    S                 PR   N        E   
Sbjct: 1193 RKRRAAPQDYMAVSQDRPKRRGRRSTLPAPPSPSFDSSAYAAPRALHNPDWYENDYEEIP 1252

Query: 190  TIVPQELNSDNASSVD 205
                ++   D + SVD
Sbjct: 1253 LDALED--EDVSESVD 1266


>gi|289616807|emb|CBI56470.1| unnamed protein product [Sordaria macrospora]
          Length = 2426

 Score = 36.8 bits (83), Expect = 1.8,   Method: Composition-based stats.
 Identities = 27/128 (21%), Positives = 47/128 (36%), Gaps = 9/128 (7%)

Query: 85   SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE---ASPCPLIEEGKEPIFENSIQP 141
            + +Q  + E   +D  D+ L +   ER+     E       P P   +  EP+  +   P
Sbjct: 1391 TESQEALPEDALQDALDNQLGQSSAERSSVKEQEAPGEAVKPQPQDVQYPEPVLSSQTTP 1450

Query: 142  KVEDVAF---KTPDISREKDVSYKKVRRRR--PLRPRVFPNAKSGNQPVEA-TETIVPQE 195
            + +       K PD    +DVS             P   P+  +   P  A T+   P +
Sbjct: 1451 EQDPTPVLQSKQPDNVASEDVSQPAAESSTGPEAAPEAAPSHATDATPTVAPTDPPFPTQ 1510

Query: 196  LNSDNASS 203
              S++A +
Sbjct: 1511 ETSNHADT 1518


>gi|194853511|ref|XP_001968176.1| GG24723 [Drosophila erecta]
 gi|190660043|gb|EDV57235.1| GG24723 [Drosophila erecta]
          Length = 669

 Score = 36.8 bits (83), Expect = 1.8,   Method: Composition-based stats.
 Identities = 19/124 (15%), Positives = 42/124 (33%), Gaps = 10/124 (8%)

Query: 86  MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVED 145
             +  +Q+K  +  + +     ++   Q+     + +                + P  ED
Sbjct: 192 QNRQLLQDKPSQASKQNQSPAGERTHPQSHHHPRDRASTTANP--------LRLDPSPED 243

Query: 146 VAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATET--IVPQELNSDNASS 203
            +   P  + EK ++  K   +  L+P   P A   N+  E  +       E +  +A  
Sbjct: 244 GSAARPRSAGEKLLNKLKELGKAHLKPAADPEASRQNETGEEEDEQGSGQPEGSGQSADE 303

Query: 204 VDQD 207
           V  +
Sbjct: 304 VKTE 307


>gi|73945439|ref|XP_857328.1| PREDICTED: similar to vacuolar protein sorting factor 4B isoform 7
           [Canis familiaris]
          Length = 452

 Score = 36.8 bits (83), Expect = 1.8,   Method: Composition-based stats.
 Identities = 29/116 (25%), Positives = 42/116 (36%), Gaps = 12/116 (10%)

Query: 51  AERYSVLARDAMS---AGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKE 107
            ++   LA  A     AG+Y  A    QHA  Y   V   +AQ  +  Q          +
Sbjct: 8   FQKAVDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLD 67

Query: 108 QKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKK 163
           + E+ +  L + E +P   ++EG         QP   D      D   E D   KK
Sbjct: 68  RAEKLKEYLKKKEKTPQKPVKEG---------QPSPADEKGNDSDGEGETDDPEKK 114


>gi|327190276|gb|EGE57376.1| putative ribonuclease protein [Rhizobium etli CNPAF512]
          Length = 958

 Score = 36.8 bits (83), Expect = 1.8,   Method: Composition-based stats.
 Identities = 23/131 (17%), Positives = 39/131 (29%), Gaps = 2/131 (1%)

Query: 79  HYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENS 138
           H     +       +    D Q  L  + ++ R    +   E +P   +    +P     
Sbjct: 66  HGFLAFAEIHPDYYQIPLADRQALLRAEAEEHRRDEDVEHVETAPMVDLSTQDQPDVGIV 125

Query: 139 IQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVE--ATETIVPQEL 196
                E VA         +                     K     VE  ATE  VP ++
Sbjct: 126 PAEAPEPVAVADEPAPAAEAAPAAAEEAPAKKARPRRSRKKVTEAAVETTATEDAVPTDV 185

Query: 197 NSDNASSVDQD 207
            ++ ASS+D +
Sbjct: 186 EAEGASSIDNE 196


>gi|240125212|ref|ZP_04738098.1| IgA-specific metalloendopeptidase [Neisseria gonorrhoeae SK-92-679]
 gi|268683810|ref|ZP_06150672.1| IgA-specific serine endopeptidase [Neisseria gonorrhoeae SK-92-679]
 gi|268624094|gb|EEZ56494.1| IgA-specific serine endopeptidase [Neisseria gonorrhoeae SK-92-679]
          Length = 1593

 Score = 36.8 bits (83), Expect = 1.8,   Method: Composition-based stats.
 Identities = 32/196 (16%), Positives = 55/196 (28%), Gaps = 16/196 (8%)

Query: 10   SRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVV 69
            S+ R    G+ S  + N+       +      + R  A+ +A++ +   R+A +      
Sbjct: 1087 SQDRPKRRGHRSVQQNNVEIAQAQAELARRQQEERKAAELLAKQRAEAEREAQALAARRK 1146

Query: 70   AENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEE 129
            AE               A+ Q  E   R E      +  K +A+       A   P  + 
Sbjct: 1147 AEA------------EEAKHQAAELAHRQEAKRKAAESAKRKAEEEEHRQTAQSQP--QR 1192

Query: 130  GKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATE 189
             K            +D   +    S                 PR   N        E   
Sbjct: 1193 RKRRAAPQDYMAVSQDRPKRRGRRSTLPAPPSPSFDSSAYAAPRALHNPDWYENDYEEIP 1252

Query: 190  TIVPQELNSDNASSVD 205
                ++   D + SVD
Sbjct: 1253 LDALED--EDVSESVD 1266


>gi|84996755|ref|XP_953099.1| Theileria parva microneme-rhoptry antigen [Theileria annulata
           strain Ankara]
 gi|74950752|sp|Q4U9M9|104K_THEAN RecName: Full=104 kDa microneme/rhoptry antigen; AltName:
           Full=p104; Flags: Precursor
 gi|65304095|emb|CAI76474.1| Theileria parva microneme-rhoptry antigen, putative [Theileria
           annulata]
          Length = 893

 Score = 36.8 bits (83), Expect = 1.8,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 29/78 (37%)

Query: 117 SEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFP 176
           S  E+      +E KEP    S +   E    K P  ++E   S   V  +RP  P+   
Sbjct: 523 SSSESKEHEDSKESKEPKEHGSPKETKEGEVTKKPGPAKEHKPSKIPVYTKRPEFPKKSK 582

Query: 177 NAKSGNQPVEATETIVPQ 194
           + K    P      + PQ
Sbjct: 583 SPKRPESPKSPKRPVSPQ 600


>gi|293340205|ref|XP_002724558.1| PREDICTED: similar to Map4k6-pending protein [Rattus norvegicus]
 gi|293351626|ref|XP_001079459.2| PREDICTED: similar to Map4k6-pending protein [Rattus norvegicus]
 gi|149053203|gb|EDM05020.1| rCG32861, isoform CRA_a [Rattus norvegicus]
          Length = 1355

 Score = 36.8 bits (83), Expect = 1.9,   Method: Composition-based stats.
 Identities = 22/140 (15%), Positives = 48/140 (34%), Gaps = 15/140 (10%)

Query: 79  HYNRIVSMAQ-----AQIQEKLQRDEQDDLLVKEQKERAQNALSEF-EASPCPLIEEGKE 132
           HY R ++ A       +++E+ + ++Q +  + + K  +        +ASP P     + 
Sbjct: 518 HYGRGINPADKPAWAREVEERARMNKQQNSPLAKTKPSSAGPEPPIPQASPSPPGPLSQT 577

Query: 133 PIFENSIQPKVED-------VAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPV 185
           P  +  ++P+               P  +        + +  R L    FP +   +   
Sbjct: 578 PPMQRPVEPQEGPHKSLVAHRVPLKPYAAPVPRSQSLQDQPTRNLA--AFPASHDPDPAA 635

Query: 186 EATETIVPQELNSDNASSVD 205
             T T  P    +    + D
Sbjct: 636 VPTPTATPSARGAVIRQNSD 655


>gi|73945431|ref|XP_857162.1| PREDICTED: similar to vacuolar protein sorting factor 4B isoform 3
           [Canis familiaris]
          Length = 399

 Score = 36.8 bits (83), Expect = 1.9,   Method: Composition-based stats.
 Identities = 29/116 (25%), Positives = 42/116 (36%), Gaps = 12/116 (10%)

Query: 51  AERYSVLARDAMS---AGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKE 107
            ++   LA  A     AG+Y  A    QHA  Y   V   +AQ  +  Q          +
Sbjct: 8   FQKAVDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLD 67

Query: 108 QKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKK 163
           + E+ +  L + E +P   ++EG         QP   D      D   E D   KK
Sbjct: 68  RAEKLKEYLKKKEKTPQKPVKEG---------QPSPADEKGNDSDGEGETDDPEKK 114


>gi|300744267|ref|ZP_07073286.1| putative membrane protein [Rothia dentocariosa M567]
 gi|300379992|gb|EFJ76556.1| putative membrane protein [Rothia dentocariosa M567]
          Length = 873

 Score = 36.8 bits (83), Expect = 1.9,   Method: Composition-based stats.
 Identities = 17/104 (16%), Positives = 21/104 (20%), Gaps = 24/104 (23%)

Query: 112 AQNALSEFEASPCPLIEEGKEPIFEN--SIQPKVEDV----------------------A 147
            Q    E  A P P   +  +P  E     QP  E                         
Sbjct: 226 KQAPAPEKPADPTPEPSQPAQPAPEPTQPEQPAPEPSKPADPAPEPAQPAPEQSKPAETP 285

Query: 148 FKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETI 191
              P  S E            P      P+    +QP       
Sbjct: 286 APQPSQSSEAPAPQPSQTSEAPASNPSKPSEAPSSQPAPQPSQS 329


>gi|302306341|ref|NP_982610.2| AAR069Wp [Ashbya gossypii ATCC 10895]
 gi|299788470|gb|AAS50434.2| AAR069Wp [Ashbya gossypii ATCC 10895]
          Length = 756

 Score = 36.8 bits (83), Expect = 1.9,   Method: Composition-based stats.
 Identities = 20/116 (17%), Positives = 32/116 (27%), Gaps = 5/116 (4%)

Query: 93  EKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPD 152
           +  Q  E+ DL   E  E+  N      A   P   E  +P  ++   P+  +     P 
Sbjct: 262 QPDQPVERPDLDRPE-PEKPGNDEPSEGAPEFPTNPEEPQPPSDSPETPEPSNPPESDP- 319

Query: 153 ISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQDC 208
                    +      P +P   P       P     T  P   +  +      D 
Sbjct: 320 ---IVPSDPETPSDPEPEQPVDVPVPAPVTPPGPEEPTSTPDPDSPPDKEQRPDDF 372


>gi|260441062|ref|ZP_05794878.1| IgA-specific metalloendopeptidase [Neisseria gonorrhoeae DGI2]
 gi|291044395|ref|ZP_06570104.1| IgA-specific metalloendopeptidase [Neisseria gonorrhoeae DGI2]
 gi|291011289|gb|EFE03285.1| IgA-specific metalloendopeptidase [Neisseria gonorrhoeae DGI2]
          Length = 1593

 Score = 36.8 bits (83), Expect = 1.9,   Method: Composition-based stats.
 Identities = 32/196 (16%), Positives = 55/196 (28%), Gaps = 16/196 (8%)

Query: 10   SRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVV 69
            S+ R    G+ S  + N+       +      + R  A+ +A++ +   R+A +      
Sbjct: 1087 SQDRPKRRGHRSVQQNNVEIAQAQAELARRQQEERKAAELLAKQRAEAEREAQALAARRK 1146

Query: 70   AENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEE 129
            AE               A+ Q  E   R E      +  K +A+       A   P  + 
Sbjct: 1147 AEA------------EEAKHQAAELAHRQEAKRKAAESAKRKAEEEEHRQTAQSQP--QR 1192

Query: 130  GKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATE 189
             K            +D   +    S                 PR   N        E   
Sbjct: 1193 RKRRAAPQDYMAVSQDRPKRRGRRSTLPAPPSPSFDSSAYAAPRALHNPDWYENDYEEIP 1252

Query: 190  TIVPQELNSDNASSVD 205
                ++   D + SVD
Sbjct: 1253 LDALED--EDVSESVD 1266


>gi|194767157|ref|XP_001965685.1| GF22627 [Drosophila ananassae]
 gi|190619676|gb|EDV35200.1| GF22627 [Drosophila ananassae]
          Length = 1385

 Score = 36.8 bits (83), Expect = 1.9,   Method: Composition-based stats.
 Identities = 18/77 (23%), Positives = 29/77 (37%)

Query: 60  DAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEF 119
           DA    D       LQ AE  NR     Q Q++E+ + ++Q  L +   K   +  L + 
Sbjct: 679 DAQRERDRQEKMRQLQEAEELNRRQQELQRQLKEQQELEKQRRLELARIKAEKEEQLRQE 738

Query: 120 EASPCPLIEEGKEPIFE 136
                    E ++   E
Sbjct: 739 RLRQEREQREKEQREKE 755


>gi|158285443|ref|XP_001687892.1| AGAP007563-PA [Anopheles gambiae str. PEST]
 gi|157019994|gb|EDO64541.1| AGAP007563-PA [Anopheles gambiae str. PEST]
          Length = 15844

 Score = 36.8 bits (83), Expect = 1.9,   Method: Composition-based stats.
 Identities = 22/110 (20%), Positives = 34/110 (30%), Gaps = 10/110 (9%)

Query: 88   QAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEAS----PCPLIEEGKEPIFENSIQPKV 143
            + Q + K Q +  ++      K R      + E      P P  E       E +I+PK 
Sbjct: 5809 RRQQKPKPQEEVPEEKQWPTGKRRPLPEEPKEEVVLKPIPKPTKEVEPTESKEPTIKPKP 5868

Query: 144  EDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVP 193
                   P+   E        +   P      P  + G +PV   E   P
Sbjct: 5869 MPELDDKPEPELEL------EQPAVPEEDTSLPPWRRGKKPVPKREIPAP 5912



 Score = 35.3 bits (79), Expect = 4.9,   Method: Composition-based stats.
 Identities = 20/119 (16%), Positives = 38/119 (31%), Gaps = 8/119 (6%)

Query: 86   MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVED 145
              + + QE++  ++Q     +             +  P P  E   +   E +I+PK   
Sbjct: 5595 QQKPKPQEEVPEEKQWPTGKRRPLPEEPKEEIVLKPIPKPTKENEPKETKEQTIKPKPIS 5654

Query: 146  VAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSV 204
                 P+   E        +   P      P  + G +PVE  +  +P     +    V
Sbjct: 5655 ELDDKPEPELEL------EKPAVPEEDTSLPPWRRGKKPVE--KKPLPPPAEPEKVEQV 5705



 Score = 35.3 bits (79), Expect = 5.8,   Method: Composition-based stats.
 Identities = 22/121 (18%), Positives = 37/121 (30%), Gaps = 10/121 (8%)

Query: 88   QAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEAS----PCPLIEEGKEPIFENSIQPKV 143
            + Q + K Q +  ++      K R      + E      P P  E   +   E +I+PK 
Sbjct: 5377 RRQQKLKPQEEVPEEKQWPTGKRRPLPEEPKEEVVLKPIPKPTKENEPKETKEQTIKPKP 5436

Query: 144  EDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASS 203
                   P+   E        +   P      P  + G + VE      P E       +
Sbjct: 5437 MPELDDKPEPELEL------EKPAVPEEDTSLPPWRRGKKSVEKKPLPTPAEPEKVEQVT 5490

Query: 204  V 204
            +
Sbjct: 5491 L 5491


>gi|262200446|ref|YP_003271654.1| DNA polymerase III subunits gamma/tau [Gordonia bronchialis DSM
           43247]
 gi|262083793|gb|ACY19761.1| DNA polymerase III, subunits gamma and tau [Gordonia bronchialis
           DSM 43247]
          Length = 774

 Score = 36.8 bits (83), Expect = 1.9,   Method: Composition-based stats.
 Identities = 16/91 (17%), Positives = 28/91 (30%), Gaps = 9/91 (9%)

Query: 119 FEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNA 178
            +  P P      EP       P+ E +  +   +  E    Y       P  PR  P+ 
Sbjct: 517 RDPEPQPGAPREPEPRSVAEPAPETESIVAEDIPLPDEPFDEYDAP-PDEPSSPRRAPD- 574

Query: 179 KSGNQPVEATETIVPQELNSDNASSVDQDCK 209
               +P       VP      +A ++ +  +
Sbjct: 575 ---PEPEPEAAPTVP----GLDADTLRKRFQ 598


>gi|71001644|ref|XP_755503.1| Mob1 family protein [Aspergillus fumigatus Af293]
 gi|66853141|gb|EAL93465.1| Mob1 family protein [Aspergillus fumigatus Af293]
 gi|159129571|gb|EDP54685.1| Mob1 family protein [Aspergillus fumigatus A1163]
          Length = 485

 Score = 36.8 bits (83), Expect = 1.9,   Method: Composition-based stats.
 Identities = 18/98 (18%), Positives = 35/98 (35%)

Query: 92  QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTP 151
           +E+ +  +       E ++  +    + E  P     E        ++QP  E  A K  
Sbjct: 383 EEQKEAADAPVQDPAESQDTVEEVQEDEEGKPSNTNTETAAKDEPEAVQPPEEPEATKAE 442

Query: 152 DISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATE 189
           +   +   S +        + +  P A+S  +P  ATE
Sbjct: 443 ESRADTQASAEDSPEASEEKTQQEPGAQSTTEPEPATE 480


>gi|327301363|ref|XP_003235374.1| hypothetical protein TERG_04429 [Trichophyton rubrum CBS 118892]
 gi|326462726|gb|EGD88179.1| hypothetical protein TERG_04429 [Trichophyton rubrum CBS 118892]
          Length = 1451

 Score = 36.8 bits (83), Expect = 1.9,   Method: Composition-based stats.
 Identities = 16/79 (20%), Positives = 28/79 (35%), Gaps = 1/79 (1%)

Query: 124  CPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQ 183
             PL+E  ++P     IQP  +D   +  D S E+  +     R  P  P       +   
Sbjct: 964  QPLVENEEQPQPAQEIQPSSQDEDVEMNDASPEEAPTQPNQNRDEPEHP-SEHIPSAPEL 1022

Query: 184  PVEATETIVPQELNSDNAS 202
            P        P++  ++   
Sbjct: 1023 PEHEMSDNAPEQPGTNGIE 1041


>gi|170042390|ref|XP_001848911.1| titin [Culex quinquefasciatus]
 gi|167865871|gb|EDS29254.1| titin [Culex quinquefasciatus]
          Length = 9108

 Score = 36.8 bits (83), Expect = 1.9,   Method: Composition-based stats.
 Identities = 23/129 (17%), Positives = 47/129 (36%), Gaps = 17/129 (13%)

Query: 89   AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPK------ 142
             ++ E   R+E + L + + +E  +  + +  + P   +EE   PI     QP       
Sbjct: 5352 KKMAELSPREELEQLELVKLEETPK-VMDQELSKPVAAVEEQPAPIAPQPEQPSWRRGRK 5410

Query: 143  ---VEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAK-------SGNQPVEATETIV 192
               VE+   +    + ++     + +    L+P   P  +       S  +P E  E+ +
Sbjct: 5411 EKPVEEAPEEKQWPTGKRRPLPTEPKEEVVLKPIPKPQKEEPVQEEISEEKPTEEDESHL 5470

Query: 193  PQELNSDNA 201
            P       A
Sbjct: 5471 PPWRRGKKA 5479


>gi|296080746|ref|NP_001171669.1| src substrate cortactin isoform c [Homo sapiens]
 gi|21707902|gb|AAH33889.1| CTTN protein [Homo sapiens]
 gi|119595172|gb|EAW74766.1| cortactin, isoform CRA_a [Homo sapiens]
          Length = 634

 Score = 36.8 bits (83), Expect = 1.9,   Method: Composition-based stats.
 Identities = 27/129 (20%), Positives = 49/129 (37%), Gaps = 6/129 (4%)

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
           + ++      EN  +  E  +R  + A+   +   +R EQ++   ++ +E+A+       
Sbjct: 308 SKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEE-ARRKLEEQARAKTQTPP 366

Query: 121 ASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKS 180
            SP P   E + P       P  ED A    ++S    VS  +      +    +  A S
Sbjct: 367 VSPAPQPTEERLPS-----SPVYEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREASS 421

Query: 181 GNQPVEATE 189
                 ATE
Sbjct: 422 QQGLAYATE 430


>gi|241888770|ref|ZP_04776076.1| S-layer protein [Gemella haemolysans ATCC 10379]
 gi|241864446|gb|EER68822.1| S-layer protein [Gemella haemolysans ATCC 10379]
          Length = 373

 Score = 36.8 bits (83), Expect = 1.9,   Method: Composition-based stats.
 Identities = 14/76 (18%), Positives = 30/76 (39%), Gaps = 5/76 (6%)

Query: 122 SPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRP-----LRPRVFP 176
           +P P  +  ++P+ E+S +P  +      P  + +      K    +P     ++P   P
Sbjct: 88  APKPTEKPVEKPLKESSEKPIEKPSVKPAPKPTEKPVEKPLKESSEKPIEKLSVKPTEKP 147

Query: 177 NAKSGNQPVEATETIV 192
             +    P+E + T  
Sbjct: 148 TEQPPGNPIEKSTTNT 163


>gi|123427329|ref|XP_001307228.1| hypothetical protein [Trichomonas vaginalis G3]
 gi|121888845|gb|EAX94298.1| conserved hypothetical protein [Trichomonas vaginalis G3]
          Length = 579

 Score = 36.8 bits (83), Expect = 1.9,   Method: Composition-based stats.
 Identities = 13/91 (14%), Positives = 26/91 (28%), Gaps = 2/91 (2%)

Query: 102 DLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSY 161
           D      +   +           P  +E ++P  +   QPK ++      D   +     
Sbjct: 402 DDDGFRSENDLELDFLVEAPKEQPKEDEKEQPKEDEKEQPKEDEKEQPKEDGKEQPKEDE 461

Query: 162 KKVRRRRPLRPR--VFPNAKSGNQPVEATET 190
           KK   +           N K   +P  +  +
Sbjct: 462 KKENDKDISEESDDNKENDKIAKRPSRSKNS 492


>gi|170723831|ref|YP_001751519.1| ribonuclease R [Pseudomonas putida W619]
 gi|169761834|gb|ACA75150.1| ribonuclease R [Pseudomonas putida W619]
          Length = 859

 Score = 36.8 bits (83), Expect = 1.9,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 39/100 (39%), Gaps = 3/100 (3%)

Query: 98  DEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREK 157
           + + D  V EQ+  A        A+P     E ++P  E    PK      +T +    K
Sbjct: 738 ERKIDFEVSEQQLAAPIGRKGRGAAPAAEKAE-QQPAVEAKATPKPRSRKSETAEAYFPK 796

Query: 158 DVSYK--KVRRRRPLRPRVFPNAKSGNQPVEATETIVPQE 195
           D   +  +VR+ R ++  +  +A++G      ++      
Sbjct: 797 DAVQRNAEVRKSREMKKALMTDARTGGNAGSKSDKGGKPS 836


>gi|52353533|gb|AAU44099.1| putative polyprotein [Oryza sativa Japonica Group]
          Length = 1645

 Score = 36.8 bits (83), Expect = 1.9,   Method: Composition-based stats.
 Identities = 22/101 (21%), Positives = 32/101 (31%), Gaps = 2/101 (1%)

Query: 75  QHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPI 134
           Q  EH  RI+       +   +R        K     AQ       A P PL+    +P 
Sbjct: 469 QTLEHLFRIIDEFARGEENSKRRQAIQAEYDKASVAAAQAQQQVQVAEPPPLVVRQPQPA 528

Query: 135 FENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVF 175
            +   QP  +  A  T    R        +    P+R +V 
Sbjct: 529 IQA--QPPRQGQAPMTWRKFRIDRAGKAVMAVEEPVRKKVR 567


>gi|90020462|ref|YP_526289.1| N-acetylglucosaminyltransferase, MurG [Saccharophagus degradans
           2-40]
 gi|89950062|gb|ABD80077.1| hypothetical protein Sde_0815 [Saccharophagus degradans 2-40]
          Length = 252

 Score = 36.8 bits (83), Expect = 1.9,   Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 41/82 (50%), Gaps = 4/82 (4%)

Query: 40  DVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNR----IVSMAQAQIQEKL 95
           +   R   Q I   Y+  AR+A+++GDY  A+ +L  A+ Y      ++ + Q   + K 
Sbjct: 96  NSSARAGVQAILISYAEWARNAIASGDYAGAQGYLNQAQLYFPANPLLMELQQTIAKAKQ 155

Query: 96  QRDEQDDLLVKEQKERAQNALS 117
           QR +Q+ +++ ++    +   S
Sbjct: 156 QRKQQEQVVLAQEPPAERTEFS 177


>gi|50556110|ref|XP_505463.1| YALI0F15653p [Yarrowia lipolytica]
 gi|49651333|emb|CAG78272.1| YALI0F15653p [Yarrowia lipolytica]
          Length = 1051

 Score = 36.8 bits (83), Expect = 1.9,   Method: Composition-based stats.
 Identities = 22/112 (19%), Positives = 38/112 (33%), Gaps = 22/112 (19%)

Query: 112  AQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYK--------- 162
                +      P P  E    P+     QP+V  VA + P+  +E     +         
Sbjct: 925  PAEPVEPTPEQPKPTPEVPAIPVQPTPEQPEV-PVATEDPEEPKEPQTPNEPVPEVPVEN 983

Query: 163  ----------KVRRRRPLRP--RVFPNAKSGNQPVEATETIVPQELNSDNAS 202
                            P++P   V P  +   QPVE+     P++ NS +++
Sbjct: 984  IPEVPSRPEVPEFPSEPVKPIESVVPTPEVPQQPVESAPQHTPEQANSASST 1035


>gi|228476602|ref|ZP_04061284.1| translation initiation factor IF-2 [Streptococcus salivarius SK126]
 gi|228251797|gb|EEK10862.1| translation initiation factor IF-2 [Streptococcus salivarius SK126]
          Length = 944

 Score = 36.8 bits (83), Expect = 2.0,   Method: Composition-based stats.
 Identities = 30/183 (16%), Positives = 57/183 (31%), Gaps = 42/183 (22%)

Query: 2   RSVQQYKRS-RGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           R+ Q  +R+ +GR         N+               D K R  A             
Sbjct: 179 RNFQGKQRNDQGRNKRNDAARNNQAGP----------RIDFKARAAA------------- 215

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
                  + AE   Q+AE Y+R       Q + + + ++  +    +++E+A+    + E
Sbjct: 216 -------LKAE---QNAE-YSR-------QSETRFREEKAAEQRRAKEQEKARKEKQQAE 257

Query: 121 ASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKS 180
            +    + E K                 +     + +    +  RR     P+   N K 
Sbjct: 258 VAAQKAVVEAKPAPKPAPAAQPAPAAQAQDTRRKKARPDKSRDNRRENEDGPKQTRNNKW 317

Query: 181 GNQ 183
            NQ
Sbjct: 318 NNQ 320


>gi|229097770|ref|ZP_04228725.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus
           Rock3-29]
 gi|228685715|gb|EEL39638.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus
           Rock3-29]
          Length = 600

 Score = 36.8 bits (83), Expect = 2.0,   Method: Composition-based stats.
 Identities = 12/95 (12%), Positives = 28/95 (29%), Gaps = 3/95 (3%)

Query: 113 QNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRP 172
           +   ++      P   +  +P  E   +PK +D   + P+   E      K       + 
Sbjct: 164 EEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTDDPKQEKPE---EPKTDDPKQENPDGTKT 220

Query: 173 RVFPNAKSGNQPVEATETIVPQELNSDNASSVDQD 207
              P  ++   P       + +         ++ D
Sbjct: 221 PEKPKQENIQVPAAQVNEAISKTSEKMLQDGIESD 255


>gi|213410591|ref|XP_002176065.1| DNA replication regulator sld2 [Schizosaccharomyces japonicus
           yFS275]
 gi|212004112|gb|EEB09772.1| DNA replication regulator sld2 [Schizosaccharomyces japonicus
           yFS275]
          Length = 370

 Score = 36.8 bits (83), Expect = 2.0,   Method: Composition-based stats.
 Identities = 25/104 (24%), Positives = 42/104 (40%), Gaps = 2/104 (1%)

Query: 101 DDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVS 160
           +D   K++++      S+ +++     +E     F    +    D        S+E  V 
Sbjct: 202 EDEYGKDEEDVLHELESDEKSANADNYDEDPLNPFLLLARDTETDETTSKEQGSQEPQVR 261

Query: 161 YKKVRR--RRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
             KV+R  RR   P   PNAKS  QP+EA +       + D+  
Sbjct: 262 KLKVKRQHRRVKLPPSVPNAKSHLQPLEAIDEEEEIGTDEDDEE 305


>gi|256823983|ref|YP_003147943.1| esterase/lipase [Kytococcus sedentarius DSM 20547]
 gi|256687376|gb|ACV05178.1| esterase/lipase [Kytococcus sedentarius DSM 20547]
          Length = 454

 Score = 36.8 bits (83), Expect = 2.0,   Method: Composition-based stats.
 Identities = 16/101 (15%), Positives = 29/101 (28%), Gaps = 5/101 (4%)

Query: 98  DEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREK 157
           D+ D+    E     +++      +P   +    EP      +P         PD ++  
Sbjct: 70  DDADEPGESEGPGSGEDSNDAGTTAPGGTLSGDGEPSGPGPTEPTGPTAPAPVPDPTQTA 129

Query: 158 DVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
                      P      P+A S      ++E  VP     
Sbjct: 130 PTQPAPTTPGDPS-----PSATSTPPGDPSSEPTVPPSSPG 165


>gi|320039831|gb|EFW21765.1| mRNA cap methyltransferase [Coccidioides posadasii str. Silveira]
          Length = 594

 Score = 36.8 bits (83), Expect = 2.1,   Method: Composition-based stats.
 Identities = 21/132 (15%), Positives = 43/132 (32%), Gaps = 19/132 (14%)

Query: 84  VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPK- 142
           V+  Q  I  K  +    +    + +   Q + S    +  P+  E   P   +S + + 
Sbjct: 42  VTAEQNSIDRKGSQVHDAETSKDDHQNSTQGSASPIGKTEKPVTAERASPGGAHSDKKRK 101

Query: 143 VEDVAFKTPDISREKD------------------VSYKKVRRRRPLRPRVFPNAKSGNQP 184
           + D   + P + +++                    +      RR   PR+ P+A+    P
Sbjct: 102 LADEPAENPALDKDQPRTKRKRLQERLQKNRRRGKTPPSAYSRRDDGPRIQPDARPPRSP 161

Query: 185 VEATETIVPQEL 196
              T +  P   
Sbjct: 162 SPITRSPSPSAA 173


>gi|148544482|ref|YP_001271852.1| cell wall anchor domain-containing protein [Lactobacillus reuteri
           DSM 20016]
 gi|184153847|ref|YP_001842188.1| hypothetical protein LAR_1192 [Lactobacillus reuteri JCM 1112]
 gi|325682803|ref|ZP_08162319.1| cell wall anchor domain protein [Lactobacillus reuteri MM4-1A]
 gi|148531516|gb|ABQ83515.1| LPXTG-motif cell wall anchor domain [Lactobacillus reuteri DSM
           20016]
 gi|183225191|dbj|BAG25708.1| hypothetical protein [Lactobacillus reuteri JCM 1112]
 gi|324977153|gb|EGC14104.1| cell wall anchor domain protein [Lactobacillus reuteri MM4-1A]
          Length = 745

 Score = 36.8 bits (83), Expect = 2.1,   Method: Composition-based stats.
 Identities = 17/110 (15%), Positives = 32/110 (29%), Gaps = 15/110 (13%)

Query: 110 ERAQNALSEFEASPCPLIEEGK--EPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRR 167
           +  Q+        P   I      +P  + + QP  +  A  T   + E +      ++ 
Sbjct: 613 DYGQSGPELNYDLPKAEIPSQPTSQPTVQPTEQPTSQPTAQPTEQPAIESNTQLPGEQKN 672

Query: 168 RPLRPR-------------VFPNAKSGNQPVEATETIVPQELNSDNASSV 204
              +P              V P   S  QP          +  +  +SS+
Sbjct: 673 EEPQPMTTQVNTKKGETSIVEPTNSSSTQPTTKQGAQQLPQTGNQKSSSL 722


>gi|291415781|ref|XP_002724128.1| PREDICTED: myosin IXB, partial [Oryctolagus cuniculus]
          Length = 1585

 Score = 36.8 bits (83), Expect = 2.1,   Method: Composition-based stats.
 Identities = 19/121 (15%), Positives = 35/121 (28%), Gaps = 9/121 (7%)

Query: 90   QIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEE-------GKEPIFENSIQPK 142
            ++Q +  +  +D+  ++E   RA     +      P+  +       G E       QP 
Sbjct: 1151 ELQNRHSQACRDERGLREPSGRAAREPGQSPPRSTPVQGDDETPAGTGPETQAAAPEQPA 1210

Query: 143  --VEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDN 200
               +  A        EK       R  R  RP           P   +    P+  +   
Sbjct: 1211 ETPQAEAGTRVSGETEKAPPGGSPRPSRAERPTSLALDSRICPPAPRSTPEAPKAQDKLE 1270

Query: 201  A 201
            +
Sbjct: 1271 S 1271


>gi|301776436|ref|XP_002923633.1| PREDICTED: transcription termination factor 2-like [Ailuropoda
           melanoleuca]
 gi|281337997|gb|EFB13581.1| hypothetical protein PANDA_012813 [Ailuropoda melanoleuca]
          Length = 1157

 Score = 36.8 bits (83), Expect = 2.1,   Method: Composition-based stats.
 Identities = 17/130 (13%), Positives = 35/130 (26%), Gaps = 26/130 (20%)

Query: 93  EKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGK--------------------- 131
           ++ QR+E+ +   + ++    +     EA P     E +                     
Sbjct: 195 QEQQREEKTECQWEARETEGTHTRDPSEAKPEQRRGEEQRKPSGPLQEKSDVESHRVQKK 254

Query: 132 -EPIFENSIQPKVED----VAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVE 186
            EP+ E   +P                       + K R  R  + R  P++++  Q   
Sbjct: 255 SEPLREKETKPLPGSIHSQNPISKAQKGEHVSKEHPKSREARETKARDDPSSQTNRQSEP 314

Query: 187 ATETIVPQEL 196
                     
Sbjct: 315 GDGPAPGPAS 324


>gi|73982670|ref|XP_863432.1| PREDICTED: similar to cortactin isoform b isoform 4 [Canis
           familiaris]
          Length = 467

 Score = 36.8 bits (83), Expect = 2.1,   Method: Composition-based stats.
 Identities = 20/110 (18%), Positives = 48/110 (43%), Gaps = 4/110 (3%)

Query: 58  ARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKE---RAQN 114
           A ++ ++      EN  +  E  +R  + A+   +   +R EQ++   +  ++   +AQ 
Sbjct: 268 AVNSRTSNIRANFENLAKEKEQEDRRKAEAEKAQRMAKERQEQEEARRQLHEQAQAQAQK 327

Query: 115 ALSEFEASPCPLIEE-GKEPIFENSIQPKVEDVAFKTPDISREKDVSYKK 163
                  +P P  E+    P++E++   K E     + + +  +D S ++
Sbjct: 328 PTPPASPTPQPAQEKPPPSPVYEDAASFKAEPEPVYSMEAADYQDASSQQ 377


>gi|158333779|ref|YP_001514951.1| surface antigen variable number [Acaryochloris marina MBIC11017]
 gi|158304020|gb|ABW25637.1| surface antigen variable number [Acaryochloris marina MBIC11017]
          Length = 815

 Score = 36.8 bits (83), Expect = 2.1,   Method: Composition-based stats.
 Identities = 27/141 (19%), Positives = 38/141 (26%), Gaps = 20/141 (14%)

Query: 84  VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPK- 142
           ++ AQA+ Q    RD + + +                  P         P+F    QP  
Sbjct: 31  IAPAQAKDQPSSDRDNRQEQIRVSS---PPAPSIHLGQLPTDDAPSQTAPVFPLPAQPDQ 87

Query: 143 VEDVAFKTPDISREK-DVSYKKVRRRRPLRPRV-------------FPNAKSGNQPVEAT 188
               A +TP  S EK D          P  P                 +A      V AT
Sbjct: 88  PSTPAVETPSTSEEKTDPDEATPNTGAPGDPPAADEIAPAPGAPSAADDAAPAPGDVPAT 147

Query: 189 ETIVPQ--ELNSDNASSVDQD 207
           +   P         A +   D
Sbjct: 148 DEAAPDTGAPGDVPAETPSAD 168


>gi|315222738|ref|ZP_07864626.1| conserved domain protein [Streptococcus anginosus F0211]
 gi|315188151|gb|EFU21878.1| conserved domain protein [Streptococcus anginosus F0211]
          Length = 168

 Score = 36.8 bits (83), Expect = 2.1,   Method: Composition-based stats.
 Identities = 15/89 (16%), Positives = 35/89 (39%), Gaps = 7/89 (7%)

Query: 120 EASPCPLIEEGKEPIFENSI-----QPKVEDVAFKTPDISREKDVSYKKV--RRRRPLRP 172
           E  P   I E  +P+ E ++     +P+ E      P  + +  V  +K   +    ++P
Sbjct: 78  EKQPSEDISEEVQPVAEEAVVDVKTEPEPEPAPIVQPAPTADTKVKQQKPIVKPAPVVKP 137

Query: 173 RVFPNAKSGNQPVEATETIVPQELNSDNA 201
           R    ++   Q  + T+  +     + ++
Sbjct: 138 RPMTKSERQQQKKDYTKESIKIINATIDS 166


>gi|307318588|ref|ZP_07598022.1| OmpA/MotB domain protein [Sinorhizobium meliloti AK83]
 gi|306895928|gb|EFN26680.1| OmpA/MotB domain protein [Sinorhizobium meliloti AK83]
          Length = 489

 Score = 36.8 bits (83), Expect = 2.1,   Method: Composition-based stats.
 Identities = 15/110 (13%), Positives = 24/110 (21%), Gaps = 2/110 (1%)

Query: 101 DDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVS 160
                +   E+             P  E   E   E   QP        T +   E+   
Sbjct: 1   QQTDEQRAAEQPGAEPEGGTTVEQPATEAPAEQTGEGEQQPVPGAEPPATAEQQGEQPAG 60

Query: 161 YKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQDCKV 210
                             K    P  + +T+V            D+D  +
Sbjct: 61  QPAPEVVDERS--TEERQKIAEDPAASDDTVVLPVERGAAVLDSDKDADI 108


>gi|115749179|ref|XP_001198939.1| PREDICTED: hypothetical protein, partial [Strongylocentrotus
           purpuratus]
          Length = 380

 Score = 36.8 bits (83), Expect = 2.1,   Method: Composition-based stats.
 Identities = 18/110 (16%), Positives = 34/110 (30%), Gaps = 4/110 (3%)

Query: 93  EKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPK--VEDVAFKT 150
           E+ + +E      +E  +    +      +  P  +   +P  E + +P     +   +T
Sbjct: 268 EETKTEEVKSDEKEEGAKEEPKSEEPAADTGAPAEKTEDKPADEAAEKPAETPAEAPAET 327

Query: 151 P-DISREKDVSYKKVRRRR-PLRPRVFPNAKSGNQPVEATETIVPQELNS 198
           P +  +E             P         K+   P E TE   P    S
Sbjct: 328 PAEAPKETPAETPAETPAETPAETPAEDTEKAKEAPAEKTEDAEPVAEES 377


>gi|255068111|ref|ZP_05319966.1| putative cell division protein FtsK [Neisseria sicca ATCC 29256]
 gi|255047626|gb|EET43090.1| putative cell division protein FtsK [Neisseria sicca ATCC 29256]
          Length = 1050

 Score = 36.8 bits (83), Expect = 2.1,   Method: Composition-based stats.
 Identities = 21/119 (17%), Positives = 40/119 (33%), Gaps = 9/119 (7%)

Query: 82  RIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQP 141
           R+ +        + Q  + D++L        +  +   EA+   L  + +      + Q 
Sbjct: 310 RLAAAVAPVRDFQPQIIQNDEILANLIPASRRRTVRHAEAAAEKLARKQQ----SAAAQV 365

Query: 142 KVEDVAFKTPDISRE-----KDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQE 195
           K+ + A   P+ + E     K +   K  R  P+ P          QP      + P E
Sbjct: 366 KLSEEADLRPEQTVERSVTRKPLFPPKTLRTEPVAPPKEKAVYISRQPAPTATVVEPPE 424


>gi|123480039|ref|XP_001323175.1| hypothetical protein [Trichomonas vaginalis G3]
 gi|121906034|gb|EAY10952.1| hypothetical protein TVAG_260380 [Trichomonas vaginalis G3]
          Length = 1859

 Score = 36.8 bits (83), Expect = 2.1,   Method: Composition-based stats.
 Identities = 23/126 (18%), Positives = 54/126 (42%), Gaps = 12/126 (9%)

Query: 66  DYVVAENHLQHAEHYNRIVSMAQAQ-IQEKLQRDEQDDLLVKEQKERAQNALSEFEASPC 124
           D ++ +  ++  +  +RI    Q + I+++ +R+E+   + KE++ER +    E E    
Sbjct: 697 DPILPDYFMKQQQDADRIKEEDQKRKIEKQKEREEKLRQMQKEKEERQRQLQKEREEKQR 756

Query: 125 PLIEEGKEPIFE----------NSIQPKVEDVAFKTPDISREKDV-SYKKVRRRRPLRPR 173
            + +E  E + +           S   +V+    +T     E+ + S  K + +R  + +
Sbjct: 757 QIQKEKDEKLKQLLKEKEEKQRQSFDSEVDIPDLETSSPLEEESLHSSPKEKIKRSEKSQ 816

Query: 174 VFPNAK 179
                K
Sbjct: 817 KPSKLK 822


>gi|114799825|ref|YP_760545.1| ribosomal large subunit pseudouridine synthase F [Hyphomonas
           neptunium ATCC 15444]
 gi|114739999|gb|ABI78124.1| Ribosomal large subunit pseudouridine synthase F [Hyphomonas
           neptunium ATCC 15444]
          Length = 372

 Score = 36.8 bits (83), Expect = 2.1,   Method: Composition-based stats.
 Identities = 15/108 (13%), Positives = 31/108 (28%), Gaps = 12/108 (11%)

Query: 92  QEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTP 151
               +R+++       ++ER++    +         + G +P      +P+      +  
Sbjct: 261 SSPARREDRLRTSDGPRRERSETGRDQPRTDRDRSGQFGTKPGQGRPDKPRTGPKPDR-- 318

Query: 152 DISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSD 199
                        +  RP      P AK    P     +  P  L  D
Sbjct: 319 ----------AGAKPARPGAKPARPGAKPTAAPAPEGPSNRPSVLKGD 356


>gi|291408427|ref|XP_002720509.1| PREDICTED: tubulin tyrosine ligase-like family, member 11
           [Oryctolagus cuniculus]
          Length = 766

 Score = 36.4 bits (82), Expect = 2.2,   Method: Composition-based stats.
 Identities = 15/118 (12%), Positives = 35/118 (29%)

Query: 88  QAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVA 147
             +   + +  E+ +L  K +    +  +    A         ++P      QP+  +  
Sbjct: 89  MRRGSAERELAERWELEAKAKAAAERVGVDAGAAGEPERKAAEEQPKAPAPEQPRAAEEG 148

Query: 148 FKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVD 205
                      +   K R      P      +S  +  + +   +P E  +    +VD
Sbjct: 149 DAGVSPQPPPALPQDKPRPALARGPCQHGKPRSKGRSCKRSSGRLPDECGALRPVTVD 206


>gi|194865307|ref|XP_001971364.1| GG14917 [Drosophila erecta]
 gi|190653147|gb|EDV50390.1| GG14917 [Drosophila erecta]
          Length = 879

 Score = 36.4 bits (82), Expect = 2.2,   Method: Composition-based stats.
 Identities = 18/113 (15%), Positives = 32/113 (28%), Gaps = 2/113 (1%)

Query: 84  VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV 143
           ++          Q +E+D    K +++  Q           P     ++P      +P  
Sbjct: 442 ITATTQAPSNSAQDEEEDYPEEKVEEDYEQPPARNTPRRRTPASRAEQKPTRTTLRKPVT 501

Query: 144 EDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQEL 196
           +           E        +R+RPL PR    A   +   E  E       
Sbjct: 502 DKKPADDE--YDEPAEPEPLRKRKRPLAPRSRAPAADVDFEDEEYEESPAPVS 552


>gi|321455885|gb|EFX67006.1| hypothetical protein DAPPUDRAFT_218819 [Daphnia pulex]
          Length = 2351

 Score = 36.4 bits (82), Expect = 2.2,   Method: Composition-based stats.
 Identities = 22/104 (21%), Positives = 39/104 (37%), Gaps = 3/104 (2%)

Query: 71   ENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEG 130
            E + QH + YNR       +++E  +R E D+    E+    Q AL+   + P     + 
Sbjct: 2096 EAYDQHFDGYNR--PEDTYELKELKRRQEDDERQRAEELAAQQAALAALHSPPEGSHHDQ 2153

Query: 131  KEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRV 174
             +     S +P            + E   S K  +  +P+  R 
Sbjct: 2154 TDGDTSPS-EPISGSTDKDPTTEATEGRASPKAEQAIKPVPERR 2196


>gi|307328704|ref|ZP_07607876.1| cobalt transport protein [Streptomyces violaceusniger Tu 4113]
 gi|306885653|gb|EFN16667.1| cobalt transport protein [Streptomyces violaceusniger Tu 4113]
          Length = 583

 Score = 36.4 bits (82), Expect = 2.2,   Method: Composition-based stats.
 Identities = 21/126 (16%), Positives = 31/126 (24%), Gaps = 11/126 (8%)

Query: 86  MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASP--CPLIEEGKEPIFENSIQPKV 143
            A  +      R+            RA++        P   P  E   +P    +  P  
Sbjct: 447 DAATEPTPDTSREPTPPDDAPTNPARARDRTRPDLPGPHTQPAAERHPQPDDAATEPPPA 506

Query: 144 EDVAFKTPDISREKDVSYKKVRRRRPLRPRVFP-----NAKSGNQPVEAT----ETIVPQ 194
                  PD    K    +  RR +P  P   P     +A +   P            P 
Sbjct: 507 TSREPTPPDDVPTKPAQARDRRRPKPPYPGTEPYPGPGDATADPHPAPENHPTPTAQTPP 566

Query: 195 ELNSDN 200
               D 
Sbjct: 567 GEREDE 572


>gi|257884561|ref|ZP_05664214.1| cell wall surface adhesion protein [Enterococcus faecium 1,231,501]
 gi|257820399|gb|EEV47547.1| cell wall surface adhesion protein [Enterococcus faecium 1,231,501]
          Length = 390

 Score = 36.4 bits (82), Expect = 2.2,   Method: Composition-based stats.
 Identities = 21/108 (19%), Positives = 34/108 (31%), Gaps = 6/108 (5%)

Query: 88  QAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVA 147
           + + + K      ++   ++Q E       + E  P P  E   E   E       E   
Sbjct: 174 KPENENKPDIPPTENPDGEQQPEIESGEEPDTEMKPEPDNEAKPETTPEEKPGTDNETEN 233

Query: 148 FKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQE 195
            + PD++ E D       R     P   P+          T   VP+E
Sbjct: 234 PEKPDVTPEPDTDSSNEAR-----PEEKPDT-DNETENPETPNRVPEE 275


>gi|156097304|ref|XP_001614685.1| hypothetical protein [Plasmodium vivax SaI-1]
 gi|148803559|gb|EDL44958.1| hypothetical protein, conserved [Plasmodium vivax]
          Length = 1039

 Score = 36.4 bits (82), Expect = 2.2,   Method: Composition-based stats.
 Identities = 22/91 (24%), Positives = 35/91 (38%), Gaps = 17/91 (18%)

Query: 70  AENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEE 129
           AEN  QHAE Y                 DEQD+   +   E  +    E EA+   L E 
Sbjct: 693 AEN-NQHAEQY----------------DDEQDNHHAERCDEADEGGEKEKEAAHANLNEA 735

Query: 130 GKEPIFENSIQPKVEDVAFKTPDISREKDVS 160
             +   +  + P+ E      P+++ E  ++
Sbjct: 736 ETKEELDECVLPEQEVAPADDPNVAEELPLT 766


>gi|114320784|ref|YP_742467.1| sporulation domain-containing protein [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114227178|gb|ABI56977.1| Sporulation domain protein [Alkalilimnicola ehrlichii MLHE-1]
          Length = 525

 Score = 36.4 bits (82), Expect = 2.2,   Method: Composition-based stats.
 Identities = 19/73 (26%), Positives = 28/73 (38%), Gaps = 5/73 (6%)

Query: 100 QDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDV 159
           +DD L  EQ E    +  + E +P P      EP  +   QP+ E +A   P+ S     
Sbjct: 351 RDDPLAPEQGEAPTESDRQPEETPVPD----PEPQLQAEPQPEPE-IAAPEPEPSAPVPE 405

Query: 160 SYKKVRRRRPLRP 172
              +    R   P
Sbjct: 406 PEPEAADERTEEP 418


>gi|227358349|ref|ZP_03842690.1| cell division protein FtsY [Proteus mirabilis ATCC 29906]
 gi|227161685|gb|EEI46722.1| cell division protein FtsY [Proteus mirabilis ATCC 29906]
          Length = 401

 Score = 36.4 bits (82), Expect = 2.2,   Method: Composition-based stats.
 Identities = 21/100 (21%), Positives = 38/100 (38%), Gaps = 3/100 (3%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKE-QKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV 143
           +  QAQ++ +  R E      +    ERA+      E +      E ++   E   + ++
Sbjct: 7   AQRQAQLEAEQARQEAQRAEAERLAAERAEQTRLAEEEAQRQAQLEAEQARQEAEEKARI 66

Query: 144 EDVAFKTPD--ISREKDVSYKKVRRRRPLRPRVFPNAKSG 181
                +  D    RE+ +  K V + RP +   F   K G
Sbjct: 67  AQAQAEAEDIVALREEVLVDKPVEQERPKKEGFFSRLKKG 106


>gi|218888197|ref|YP_002437518.1| hypothetical protein DvMF_3114 [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218759151|gb|ACL10050.1| hypothetical protein DvMF_3114 [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 1082

 Score = 36.4 bits (82), Expect = 2.3,   Method: Composition-based stats.
 Identities = 16/84 (19%), Positives = 23/84 (27%), Gaps = 6/84 (7%)

Query: 115 ALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDIS----REKDVSYKKVRRRRPL 170
            L      P P +     P      QP    V    P  +    R      +      P+
Sbjct: 898 GLEPVGGEPAPSVPVAPTPAQMQESQPVPPAVPPSLPHDAGGEVRAPVTPPEIPALPEPV 957

Query: 171 RPRVFPNAKSGNQPVEATETIVPQ 194
            P  +P   +      ATE+  P 
Sbjct: 958 APPAYP--ATPEVTAPATESTAPP 979


>gi|195127533|ref|XP_002008223.1| GI11932 [Drosophila mojavensis]
 gi|193919832|gb|EDW18699.1| GI11932 [Drosophila mojavensis]
          Length = 684

 Score = 36.4 bits (82), Expect = 2.3,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 29/90 (32%), Gaps = 10/90 (11%)

Query: 88  QAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFE---------NS 138
           Q    E    DE++  +  E  E       E  A P P   E  +P  E         N+
Sbjct: 86  QGAADEPEAADEREAAVEPEADEPESVDELEVAAEPEPADNEE-QPAVEQEIADVVEANA 144

Query: 139 IQPKVEDVAFKTPDISREKDVSYKKVRRRR 168
            QP     A +  D     D      +R+R
Sbjct: 145 EQPTTSRRAEQQEDGIINLDSPSPPKKRKR 174


>gi|218782566|ref|YP_002433884.1| translation initiation factor IF-2 [Desulfatibacillum alkenivorans
           AK-01]
 gi|226707340|sp|B8FCY5|IF2_DESAA RecName: Full=Translation initiation factor IF-2
 gi|218763950|gb|ACL06416.1| translation initiation factor IF-2 [Desulfatibacillum alkenivorans
           AK-01]
          Length = 1040

 Score = 36.4 bits (82), Expect = 2.3,   Method: Composition-based stats.
 Identities = 21/97 (21%), Positives = 35/97 (36%), Gaps = 13/97 (13%)

Query: 118 EFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRP---RV 174
           E +A      +   EP  E   +P+++  A K  + + EK     K +  +   P   + 
Sbjct: 212 EKQAVSAKAADTPAEPQEEPEAKPEIKAEA-KAEEGAPEKPAEEPKAKEEQKAAPEDSKE 270

Query: 175 FPNAKSGNQPVE---------ATETIVPQELNSDNAS 202
            P A+   QP E         A E   P +     A+
Sbjct: 271 EPKAEEPAQPAEDEKAEEKAKAPEEKEPAKSQEPQAA 307


>gi|320355000|ref|YP_004196339.1| translation initiation factor 2 (bIF-2) [Desulfobulbus propionicus
           DSM 2032]
 gi|320123502|gb|ADW19048.1| bacterial translation initiation factor 2 (bIF-2) [Desulfobulbus
           propionicus DSM 2032]
          Length = 923

 Score = 36.4 bits (82), Expect = 2.3,   Method: Composition-based stats.
 Identities = 22/120 (18%), Positives = 44/120 (36%), Gaps = 9/120 (7%)

Query: 87  AQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDV 146
           A+  +++  ++  Q + + + +     +  ++ EA+P     +   P      Q K  D 
Sbjct: 148 AEMNVEQPSEQAPQSEPVAQAETPDETSEPAKVEATPFAPPVDEVVPPQVIQAQEKPADD 207

Query: 147 AFKTPD------ISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDN 200
             + P             V  K+ +     RP   P   +G+ P   TE  VP+E    +
Sbjct: 208 ESRKPRQLAKVVGRVVIPVPEKRTKPVAGKRPVRPPRPVAGDAP---TEIPVPKEDGRAD 264


>gi|218885615|ref|YP_002434936.1| LysR family transcriptional regulator [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218756569|gb|ACL07468.1| transcriptional regulator, LysR family [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 699

 Score = 36.4 bits (82), Expect = 2.3,   Method: Composition-based stats.
 Identities = 12/76 (15%), Positives = 25/76 (32%), Gaps = 4/76 (5%)

Query: 126 LIEEGKEPIFENSIQPKVEDVAFKTP----DISREKDVSYKKVRRRRPLRPRVFPNAKSG 181
              E ++P   +  +P V+      P      + + D S     + +P +P       + 
Sbjct: 615 TPPETRQPSLWDMPEPPVQPQPSAAPASGTAGAEQSDASPASPEQAKPDQPDATSQPSAR 674

Query: 182 NQPVEATETIVPQELN 197
             P E +    P+   
Sbjct: 675 PAPSERSPEAAPEAPQ 690


>gi|293399575|ref|ZP_06643728.1| IgA-specific serine endopeptidase [Neisseria gonorrhoeae F62]
 gi|291610144|gb|EFF39266.1| IgA-specific serine endopeptidase [Neisseria gonorrhoeae F62]
          Length = 1564

 Score = 36.4 bits (82), Expect = 2.3,   Method: Composition-based stats.
 Identities = 32/196 (16%), Positives = 55/196 (28%), Gaps = 16/196 (8%)

Query: 10   SRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVV 69
            S+ R    G+ S  + N+       +      + R  A+ +A++ +   R+A +      
Sbjct: 1058 SQDRPKRRGHRSVQQNNVEIAQAQAELARRQQEERKAAELLAKQRAEAEREAQALAARRK 1117

Query: 70   AENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEE 129
            AE               A+ Q  E   R E      +  K +A+       A   P  + 
Sbjct: 1118 AEA------------EEAKHQAAELAHRQEAKRKAAESAKRKAEEEEHRQTAQSQP--QR 1163

Query: 130  GKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATE 189
             K            +D   +    S                 PR   N        E   
Sbjct: 1164 RKRRAAPQDYMAVSQDRPKRRGRRSTLPAPPSPSFDSSAYAAPRALHNPDWYENDYEEIP 1223

Query: 190  TIVPQELNSDNASSVD 205
                ++   D + SVD
Sbjct: 1224 LDALED--EDVSESVD 1237


>gi|158520120|ref|YP_001527990.1| single-stranded nucleic acid binding R3H domain-containing protein
           [Desulfococcus oleovorans Hxd3]
 gi|158508946|gb|ABW65913.1| single-stranded nucleic acid binding R3H domain protein
           [Desulfococcus oleovorans Hxd3]
          Length = 341

 Score = 36.4 bits (82), Expect = 2.3,   Method: Composition-based stats.
 Identities = 15/103 (14%), Positives = 23/103 (22%)

Query: 101 DDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVS 160
           D L    Q+  +    +  E +P P      E       +P+ E                
Sbjct: 72  DVLDEDRQEILSMLDEAFAEPAPEPESRPRPEAKAAPRGEPRAESKKAPRAKPKSRPRTE 131

Query: 161 YKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASS 203
                     R    P A     P        P   + +   S
Sbjct: 132 KGAPAPAERSRAAGRPPANGAKPPAPEERPETPPAASEELPES 174


>gi|21222609|ref|NP_628388.1| hypothetical protein SCO4213 [Streptomyces coelicolor A3(2)]
 gi|9857170|emb|CAC04049.1| hypothetical protein [Streptomyces coelicolor A3(2)]
          Length = 544

 Score = 36.4 bits (82), Expect = 2.3,   Method: Composition-based stats.
 Identities = 19/123 (15%), Positives = 38/123 (30%), Gaps = 6/123 (4%)

Query: 80  YNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSI 139
           Y R     +   +++ ++ E++    +   +R +               + +    E+ +
Sbjct: 23  YQRHQQALRRAQEQRARQAERERKAAETASKRQERERKAAYQEQQAEQAQVRTIGVEHEV 82

Query: 140 QPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVF-PNAKSGNQPVEATETIVPQELNS 198
           +        +    +   D      RRRR   PR       S  +P    E  VP E   
Sbjct: 83  E-----QLGQLLRAALVGDPPTTFERRRRAHTPRALDERPWSRPEPSPRWEEFVPPEPGG 137

Query: 199 DNA 201
             A
Sbjct: 138 LAA 140


>gi|326787344|dbj|BAK08400.1| putative papain-like cysteine prorease [Plasmodium cynomolgi]
          Length = 1252

 Score = 36.4 bits (82), Expect = 2.4,   Method: Composition-based stats.
 Identities = 19/127 (14%), Positives = 39/127 (30%), Gaps = 7/127 (5%)

Query: 87  AQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEAS-----PCPLIEEGKEPIFENSIQP 141
           A     +   +           K   Q      + +       P  +  ++P  + + QP
Sbjct: 152 ADKPADKPADQPTDQPTDKPADKPADQPTDQPTDQALTQPADQPADQPTEQPTEQPTEQP 211

Query: 142 KVEDVAFKTPDISREKDVSYKKVRRRRPL-RPRVFPNAKSGNQPVEATETIVPQELNSDN 200
             +     T   + +           +P  +P   PN ++ ++   A     P E+ +  
Sbjct: 212 ADQPTDQPTEQPAEQPTEQPADQPTDQPTEQPLTQPNVEASDR-ATAAALKNPNEIEAQC 270

Query: 201 ASSVDQD 207
           A   DQD
Sbjct: 271 AQLKDQD 277


>gi|255718789|ref|XP_002555675.1| KLTH0G14784p [Lachancea thermotolerans]
 gi|238937059|emb|CAR25238.1| KLTH0G14784p [Lachancea thermotolerans]
          Length = 417

 Score = 36.4 bits (82), Expect = 2.4,   Method: Composition-based stats.
 Identities = 15/98 (15%), Positives = 33/98 (33%)

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
            + + K   + + + +   + E      +  +       EE K P  +   + K+ED   
Sbjct: 32  RKDRAKRANERRLEAIKNAESEDEDFEENAEDDGEQVEDEERKPPTPKAEKKAKIEDSEA 91

Query: 149 KTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVE 186
                 +    S  + +R    R    P A   ++P +
Sbjct: 92  TIQKAEKSAKKSASEPKRASRKRGAEKPEAGGDSEPAQ 129


>gi|195392200|ref|XP_002054747.1| GJ24619 [Drosophila virilis]
 gi|194152833|gb|EDW68267.1| GJ24619 [Drosophila virilis]
          Length = 1172

 Score = 36.4 bits (82), Expect = 2.4,   Method: Composition-based stats.
 Identities = 14/76 (18%), Positives = 25/76 (32%), Gaps = 4/76 (5%)

Query: 118 EFEASPCPLIEEGKEPIFENSIQPKVEDVAFKT----PDISREKDVSYKKVRRRRPLRPR 173
               +P       ++P  E   QP+  + A +       I+ E +   K +    P +P+
Sbjct: 810 PSADAPVAKPPTTEQPNLEAPPQPQPLETAAEAGKKLEHIAVEPECEKKALPPSSPPKPQ 869

Query: 174 VFPNAKSGNQPVEATE 189
             PN          T 
Sbjct: 870 DEPNNPQQKPTAAQTT 885


>gi|168705340|ref|ZP_02737617.1| hypothetical protein GobsU_37762 [Gemmata obscuriglobus UQM 2246]
          Length = 725

 Score = 36.4 bits (82), Expect = 2.4,   Method: Composition-based stats.
 Identities = 17/77 (22%), Positives = 29/77 (37%), Gaps = 3/77 (3%)

Query: 114 NALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKD---VSYKKVRRRRPL 170
           N   E +  P P +E    P  +  ++PKVE       +   + D       K   +   
Sbjct: 522 NPKVEPKTDPNPKVEPKTNPKIDPKMEPKVEPKPEPKIEPKPKTDPKAEPKPKTAPKAEP 581

Query: 171 RPRVFPNAKSGNQPVEA 187
           +P+  P+ K   +P E 
Sbjct: 582 KPKADPSPKGEPKPKEQ 598


>gi|119491661|ref|XP_001263325.1| ARID/BRIGHT domain protein (SWI1), putative [Neosartorya fischeri
           NRRL 181]
 gi|119411485|gb|EAW21428.1| ARID/BRIGHT domain protein (SWI1), putative [Neosartorya fischeri
           NRRL 181]
          Length = 981

 Score = 36.4 bits (82), Expect = 2.4,   Method: Composition-based stats.
 Identities = 20/142 (14%), Positives = 43/142 (30%), Gaps = 13/142 (9%)

Query: 78  EHYNRIVSM--------AQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEAS---PCPL 126
           EHY R ++          Q Q  +++Q++            + Q+   +       P P+
Sbjct: 364 EHYQRNLAAYEQAFLSTQQKQFADQMQQNSLPRQPSDPSAVQFQSPTVKQGQGFEVPQPV 423

Query: 127 IEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVE 186
                     N+ Q  + +       +         ++   R  +P   P   +G  P +
Sbjct: 424 GASPGSMSVANNAQQNIPNGFATPTQVKASNKQQQHRLSVSRQSQPPATPQDSTGQLPNQ 483

Query: 187 ATETIVPQELN--SDNASSVDQ 206
           +              +A S +Q
Sbjct: 484 SPAQSTKPLGGTPGKSAKSFEQ 505


>gi|330960239|gb|EGH60499.1| DNA polymerase III subunits gamma and tau [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 717

 Score = 36.4 bits (82), Expect = 2.4,   Method: Composition-based stats.
 Identities = 19/86 (22%), Positives = 34/86 (39%), Gaps = 8/86 (9%)

Query: 115 ALSEFEASPCPLIEEGKEPIFENSIQPKVED--VAFKTPDISREKDVSYKKVR-----RR 167
            ++   A+P P  E    P    +I+P+ E        P+   E D+ + + +     + 
Sbjct: 398 PVAPVMAAPDPAFEALP-PAQAAAIKPEPEPVSAPEAKPEPVEEVDLPWNEPKASAAEKA 456

Query: 168 RPLRPRVFPNAKSGNQPVEATETIVP 193
               P V P A+   +PV  T +  P
Sbjct: 457 PDAAPEVEPEAEPVAEPVLETVSEQP 482


>gi|257387736|ref|YP_003177509.1| hypothetical protein Hmuk_1688 [Halomicrobium mukohataei DSM 12286]
 gi|257170043|gb|ACV47802.1| hypothetical protein Hmuk_1688 [Halomicrobium mukohataei DSM 12286]
          Length = 550

 Score = 36.4 bits (82), Expect = 2.4,   Method: Composition-based stats.
 Identities = 17/105 (16%), Positives = 32/105 (30%), Gaps = 2/105 (1%)

Query: 65  GDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPC 124
           GD +  E +   AE   ++   A+A        + ++    +  +    +A  E  + P 
Sbjct: 199 GDRLQDERYQMSAETEGQVAQPAEAATATDGAGEAEEQSAAEPDETTPGDADGETPSGPT 258

Query: 125 PLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRP 169
           P   +G+ P          +      P      D     V    P
Sbjct: 259 PGDADGETP--SGPTPGDADGETPSGPTPGDAGDEPETAVTEAEP 301


>gi|296133630|ref|YP_003640877.1| cell wall hydrolase SleB [Thermincola sp. JR]
 gi|296032208|gb|ADG82976.1| cell wall hydrolase SleB [Thermincola potens JR]
          Length = 497

 Score = 36.4 bits (82), Expect = 2.5,   Method: Composition-based stats.
 Identities = 17/103 (16%), Positives = 32/103 (31%), Gaps = 5/103 (4%)

Query: 104 LVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE--DVAFKTPDISREKDVSY 161
             K+          + +A P P++E    P  E    P VE      +    +   +   
Sbjct: 61  DPKQTAADEAKQAPDEKAQPAPVVEAKPAPAEEVQPAPVVEAKPAPAEEVQPALVVEAKP 120

Query: 162 KKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSV 204
                 +P+ P V       N     ++   P+++  D    V
Sbjct: 121 APAEEVQPV-PVVEAKPAPANDSKPVSDK--PRQMPGDEVRPV 160


>gi|118588705|ref|ZP_01546113.1| hypothetical protein SIAM614_18404 [Stappia aggregata IAM 12614]
 gi|118438691|gb|EAV45324.1| hypothetical protein SIAM614_18404 [Stappia aggregata IAM 12614]
          Length = 1414

 Score = 36.4 bits (82), Expect = 2.5,   Method: Composition-based stats.
 Identities = 13/99 (13%), Positives = 23/99 (23%), Gaps = 14/99 (14%)

Query: 114 NALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPR 173
           +  ++   +P P   E   P      +P  E    + P  ++   V   K   +    P 
Sbjct: 348 DEGAQAPQAPQPTPGEVPGPSASLQAEPDPEAGRAEGPVQTQLAMVPRAKPLSQDDAPPG 407

Query: 174 VFPNAKSGNQ--------------PVEATETIVPQELNS 198
                K                  P       V    + 
Sbjct: 408 PGDGTKIAAAGVDDLPTASAVETLPAPELAAAVLPASSE 446


>gi|24653946|ref|NP_725497.1| CG30085 [Drosophila melanogaster]
 gi|4972770|gb|AAD34780.1| unknown [Drosophila melanogaster]
 gi|21645371|gb|AAM70965.1| CG30085 [Drosophila melanogaster]
 gi|220943718|gb|ACL84402.1| CG30085-PA [synthetic construct]
          Length = 1416

 Score = 36.4 bits (82), Expect = 2.5,   Method: Composition-based stats.
 Identities = 17/96 (17%), Positives = 26/96 (27%), Gaps = 6/96 (6%)

Query: 105 VKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVS---- 160
            ++ + RA    +E  A P P  E       +    P V+  A         K       
Sbjct: 819 KRQTRTRAAQKETEQVAQPQPAFEPQLRSPKKLPPSPVVQSTAAAVKQAKVAKPTPVVVI 878

Query: 161 --YKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQ 194
              + +       P   P       PV  T  + P 
Sbjct: 879 AQSEDLFPEVAAEPEPQPEPVKKPDPVPETTQLTPP 914


>gi|295395500|ref|ZP_06805695.1| DNA polymerase III, gamma/tau subunits [Brevibacterium mcbrellneri
           ATCC 49030]
 gi|294971671|gb|EFG47551.1| DNA polymerase III, gamma/tau subunits [Brevibacterium mcbrellneri
           ATCC 49030]
          Length = 894

 Score = 36.4 bits (82), Expect = 2.5,   Method: Composition-based stats.
 Identities = 15/78 (19%), Positives = 27/78 (34%)

Query: 84  VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV 143
           ++ A  Q + + Q + Q       Q++R      E +  P P  +       E  +Q + 
Sbjct: 463 LATADQQAESQSQPEAQPQPDSHVQRDREPQRQREVQQRPEPQRQREAPRREEPPMQRQP 522

Query: 144 EDVAFKTPDISREKDVSY 161
           E      P   +E   S 
Sbjct: 523 ESQRQPEPQSQQEPQASS 540


>gi|302915365|ref|XP_003051493.1| hypothetical protein NECHADRAFT_78625 [Nectria haematococca mpVI
           77-13-4]
 gi|256732432|gb|EEU45780.1| hypothetical protein NECHADRAFT_78625 [Nectria haematococca mpVI
           77-13-4]
          Length = 561

 Score = 36.4 bits (82), Expect = 2.5,   Method: Composition-based stats.
 Identities = 18/92 (19%), Positives = 35/92 (38%), Gaps = 5/92 (5%)

Query: 123 PCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGN 182
           P P  +E  +P  ++S   +VED   +      E +++     +  P + +  P  K  +
Sbjct: 415 PTPGKKESPKPAPKSSGDDEVEDEEIRKLTTEFEAELNSHGALKLDPAKEKR-PRLKDKS 473

Query: 183 QPVEATETIVPQ----ELNSDNASSVDQDCKV 210
                +    P     E + D+   VD D  +
Sbjct: 474 PKAGESSQSTPLPDVAEEDEDSEQDVDIDYNL 505


>gi|194467707|ref|ZP_03073694.1| LPXTG-motif cell wall anchor domain protein [Lactobacillus reuteri
           100-23]
 gi|194454743|gb|EDX43640.1| LPXTG-motif cell wall anchor domain protein [Lactobacillus reuteri
           100-23]
          Length = 920

 Score = 36.4 bits (82), Expect = 2.5,   Method: Composition-based stats.
 Identities = 19/119 (15%), Positives = 47/119 (39%), Gaps = 8/119 (6%)

Query: 84  VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV 143
           +++A+ ++  + +  EQ+     +  E+  +  SE   +  P ++  ++P  + + QP  
Sbjct: 741 LTVAKGRLVAEQKIAEQEAQKDNQPTEQPTSQPSEQPTA-QPTVQPSEQPTAQPTEQPTS 799

Query: 144 EDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
           +     T   + +              +P   P A+   QP   + T +P E  ++   
Sbjct: 800 QPSEQPTAQPTEQPTSQPTA-------QPTSQPTAQPTEQPAIESNTQLPGEQKNEEPQ 851


>gi|312862564|ref|ZP_07722806.1| translation initiation factor IF-2 [Streptococcus vestibularis
           F0396]
 gi|311101969|gb|EFQ60170.1| translation initiation factor IF-2 [Streptococcus vestibularis
           F0396]
          Length = 944

 Score = 36.4 bits (82), Expect = 2.5,   Method: Composition-based stats.
 Identities = 13/99 (13%), Positives = 33/99 (33%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
           +    Q + + + ++  +    +++E+A+    + E +    + E K             
Sbjct: 222 AEYSRQSETRFREEKAAEQRRAKEQEKARKEKQQAEVAAQKAVAEAKPAPKPAPAAQPAP 281

Query: 145 DVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQ 183
               +     + +    +  RR     P+   N K  NQ
Sbjct: 282 AAQVQDTRRKKARPDKSRDNRRENEDGPKQTRNNKWNNQ 320


>gi|66771637|gb|AAY55130.1| RE66338p [Drosophila melanogaster]
          Length = 1416

 Score = 36.4 bits (82), Expect = 2.5,   Method: Composition-based stats.
 Identities = 17/96 (17%), Positives = 26/96 (27%), Gaps = 6/96 (6%)

Query: 105 VKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVS---- 160
            ++ + RA    +E  A P P  E       +    P V+  A         K       
Sbjct: 819 KRQTRTRAAQKETEQVAQPQPAFEPQLRSPKKLPPSPVVQSTAAAVKQAKVAKPTPVVVI 878

Query: 161 --YKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQ 194
              + +       P   P       PV  T  + P 
Sbjct: 879 AQSEDLFPEVAAEPEPQPEPVKKPDPVPETTQLTPP 914


>gi|328873888|gb|EGG22254.1| mucin [Dictyostelium fasciculatum]
          Length = 859

 Score = 36.4 bits (82), Expect = 2.6,   Method: Composition-based stats.
 Identities = 23/129 (17%), Positives = 46/129 (35%), Gaps = 8/129 (6%)

Query: 73  HLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKE 132
           ++Q+ E+   I + +Q      +QR +Q++   KE+ +  Q    + ++    + +    
Sbjct: 177 YVQYDENNQIINAQSQLDKILNIQRQQQEE---KEKAQHQQQQKEKLKSKKQIVDDVKDN 233

Query: 133 PIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIV 192
           P    + +P        T   +        K      ++P   P  K   +P EA    V
Sbjct: 234 PTDAPTEKPTEAPTVKPTDAPTE---APTPKPTEAPTVKPTEKPTDKPTEKPTEAPT--V 288

Query: 193 PQELNSDNA 201
           P       A
Sbjct: 289 PPTEKPTEA 297



 Score = 34.5 bits (77), Expect = 8.2,   Method: Composition-based stats.
 Identities = 15/82 (18%), Positives = 28/82 (34%), Gaps = 3/82 (3%)

Query: 123 PCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSY-KKVRRRRPLRPRVFPNAKSG 181
             P ++   +P    +++P  +     T   +    V    K      ++P   P  K  
Sbjct: 344 EAPTVKPTPKPTEAPTVKPTPKPTEAPTVPPTEAPTVKPTPKPTEAPTVKPTEKPTDKPT 403

Query: 182 NQPVEATETIVPQELNSDNASS 203
            +P EA    VP  +    A +
Sbjct: 404 EKPTEAPT--VPPTVKPTEAPT 423


>gi|302868810|ref|YP_003837447.1| Lytic transglycosylase catalytic [Micromonospora aurantiaca ATCC
           27029]
 gi|315504720|ref|YP_004083607.1| lytic transglycosylase catalytic [Micromonospora sp. L5]
 gi|302571669|gb|ADL47871.1| Lytic transglycosylase catalytic [Micromonospora aurantiaca ATCC
           27029]
 gi|315411339|gb|ADU09456.1| Lytic transglycosylase catalytic [Micromonospora sp. L5]
          Length = 289

 Score = 36.4 bits (82), Expect = 2.6,   Method: Composition-based stats.
 Identities = 23/98 (23%), Positives = 30/98 (30%), Gaps = 8/98 (8%)

Query: 112 AQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLR 171
            +       A+  P     ++P    +  P  E  A            S K   R +P R
Sbjct: 26  EEERPVREVAADLPTAAPAEQPQEAPADAPSEEPPAVAAMGGRPSPSASAKPKPRAKPSR 85

Query: 172 PRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQDCK 209
               P A+    P   TET VP          VD  CK
Sbjct: 86  TTTAPLAR----PKPPTETQVPPAP----PKPVDDGCK 115


>gi|189467234|ref|ZP_03016019.1| hypothetical protein BACINT_03619 [Bacteroides intestinalis DSM
           17393]
 gi|189435498|gb|EDV04483.1| hypothetical protein BACINT_03619 [Bacteroides intestinalis DSM
           17393]
          Length = 687

 Score = 36.4 bits (82), Expect = 2.6,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 31/93 (33%), Gaps = 1/93 (1%)

Query: 94  KLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDI 153
           K   D+           +A+   S   A   P+ E  K P+ E    P  E     T   
Sbjct: 76  KESTDKVFTANKNGDLTKAKAEASVAAAKVQPVAEAVKAPVTEAPKAPVTEKEVAVTATE 135

Query: 154 SREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVE 186
           + EK  +    +R+ P RPR     +    P  
Sbjct: 136 APEKAETPNSTKRK-PGRPRKAKVEEKAPIPAP 167


>gi|171683297|ref|XP_001906591.1| hypothetical protein [Podospora anserina S mat+]
 gi|170941608|emb|CAP67262.1| unnamed protein product [Podospora anserina S mat+]
          Length = 383

 Score = 36.4 bits (82), Expect = 2.6,   Method: Composition-based stats.
 Identities = 34/157 (21%), Positives = 57/157 (36%), Gaps = 28/157 (17%)

Query: 46  TAQHIAERYSVLARDAMSAGDYVVAENHLQHA-----EHYNRIVSMAQAQIQEKLQRDEQ 100
           T + I E    LA DA +AG  V     ++H      EH  R+   AQ Q Q++      
Sbjct: 14  TPEQIQEMQRRLAADAQAAGMTVPE--FIEHIKRQQYEHMMRMQQQAQQQQQQQGG---- 67

Query: 101 DDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIF--------ENSIQPKVEDVAFKTPD 152
                ++Q +          A   P++     P+            ++P+   +  +  D
Sbjct: 68  --GGPQQQHQHQHQHQHGPPAQAQPIVPGPPNPLALVLAKFLRSQELKPRTVILNGERKD 125

Query: 153 ISREKDV-------SYKKVRRRRPLRPRVFPNAKSGN 182
           + R K         +YKK+R + P  P +   A   N
Sbjct: 126 MFRVKRALRALQSDAYKKLRTKNPALPEITDRASLEN 162


>gi|167771054|ref|ZP_02443107.1| hypothetical protein ANACOL_02408 [Anaerotruncus colihominis DSM
           17241]
 gi|167666724|gb|EDS10854.1| hypothetical protein ANACOL_02408 [Anaerotruncus colihominis DSM
           17241]
          Length = 306

 Score = 36.4 bits (82), Expect = 2.6,   Method: Composition-based stats.
 Identities = 17/102 (16%), Positives = 30/102 (29%), Gaps = 2/102 (1%)

Query: 108 QKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRR 167
           Q E A +        P    +   EP+    + P V       P  S           + 
Sbjct: 46  QGEPAASQADASSQLPAASSQAASEPVVLEPVAPDVSSAVSSQPAASAPPQAVSAAPSQS 105

Query: 168 RPLRPRVFPNAKSG--NQPVEATETIVPQELNSDNASSVDQD 207
            P  P     +K+      +  T+   P   + + A + + D
Sbjct: 106 EPPAPSTASGSKTPYMENQIPNTDGTYPNPDDPNEAPAAEPD 147


>gi|323507725|emb|CBQ67596.1| conserved hypothetical protein [Sporisorium reilianum]
          Length = 1010

 Score = 36.4 bits (82), Expect = 2.6,   Method: Composition-based stats.
 Identities = 21/124 (16%), Positives = 39/124 (31%), Gaps = 6/124 (4%)

Query: 68  VVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLI 127
           V A    Q+AE Y  + +  Q Q     QR          +      + +  +A     +
Sbjct: 706 VGAVYSQQYAEPYAELYAQPQRQAYTPQQRPSISPTSGAVKVVSGGQSSAVTQARRSLAM 765

Query: 128 EEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEA 187
               +P       P     A +    + ++  S +++R            AK       A
Sbjct: 766 RRSDQPAV-----PWTNPGA-EDARAAHKRSASAERLRAMSVEELEARHRAKLAALQAPA 819

Query: 188 TETI 191
           T+T+
Sbjct: 820 TQTV 823


>gi|182439625|ref|YP_001827344.1| hypothetical protein SGR_5832 [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|178468141|dbj|BAG22661.1| conserved hypothetical protein [Streptomyces griseus subsp. griseus
           NBRC 13350]
          Length = 804

 Score = 36.4 bits (82), Expect = 2.6,   Method: Composition-based stats.
 Identities = 17/93 (18%), Positives = 33/93 (35%), Gaps = 4/93 (4%)

Query: 101 DDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE----DVAFKTPDISRE 156
           D    ++      +A S    +P  +  EG +   E++  P  E    D        + E
Sbjct: 68  DVSDTEDGAPGDGDAASATGEAPAEVSAEGPDADAESAGSPDSEAAPTDGPDSEAAPAPE 127

Query: 157 KDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATE 189
              +  ++  +R LR R+     +   P+ A  
Sbjct: 128 LSEAQAELAAQRELRERIEQRKAAKVAPIAAGT 160


>gi|169825049|ref|YP_001692660.1| hypothetical protein FMG_1352 [Finegoldia magna ATCC 29328]
 gi|167831854|dbj|BAG08770.1| hypothetical protein [Finegoldia magna ATCC 29328]
          Length = 1290

 Score = 36.4 bits (82), Expect = 2.7,   Method: Composition-based stats.
 Identities = 21/125 (16%), Positives = 45/125 (36%), Gaps = 8/125 (6%)

Query: 90   QIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKE--------PIFENSIQP 141
            Q QEK ++D      V ++ ++ QN   + E    P   +  E        P  E + + 
Sbjct: 967  QQQEKGKKDSPRISKVAQKSDKKQNPEKKPEDEKKPGDNKNPETKKPDVKKPETEKNPEG 1026

Query: 142  KVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNA 201
            + +    K P+ +++ +     V++     P   P  K+  +    +      E   +  
Sbjct: 1027 EKKPGDNKKPEDNKKPEAKKPDVKKPEKKAPEQKPEVKNPGKTTNPSNNKKQPEKTPEKT 1086

Query: 202  SSVDQ 206
              V +
Sbjct: 1087 PDVKK 1091


>gi|324994548|gb|EGC26461.1| hypothetical protein HMPREF9392_1364 [Streptococcus sanguinis
           SK678]
          Length = 642

 Score = 36.4 bits (82), Expect = 2.7,   Method: Composition-based stats.
 Identities = 16/113 (14%), Positives = 29/113 (25%), Gaps = 7/113 (6%)

Query: 100 QDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFK-TPD-ISREK 157
           +D                     P P   E ++P    + +P       +  P+  S + 
Sbjct: 212 KDSADNSTNPTTPSQPEEPKPEVPTPTPAEPEQPTPAPTDKPDEPTTPAEPKPEVPSVDL 271

Query: 158 DVSYK---KVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQD 207
             +           P  P   P   +  +P   T   VP+           +D
Sbjct: 272 PENPPINGAEGELDPFAP--KPEQPAEPKPETPTTPAVPETPGLVTTDKPSED 322


>gi|241589604|ref|YP_002979629.1| Relaxase [Ralstonia pickettii 12D]
 gi|240868316|gb|ACS65975.1| Relaxase [Ralstonia pickettii 12D]
          Length = 721

 Score = 36.4 bits (82), Expect = 2.7,   Method: Composition-based stats.
 Identities = 19/111 (17%), Positives = 37/111 (33%), Gaps = 5/111 (4%)

Query: 84  VSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKV 143
           +   QAQ +  ++  E  +L  +   E A     +  +   P+ E+  E       + K 
Sbjct: 493 LMNQQAQAKSAMRTLEPTELDSRSADEAAAERAEKSGSQEQPVPEQESER-----RRNKS 547

Query: 144 EDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQ 194
           +     T + + E D   K  +            A++   P   +    PQ
Sbjct: 548 KSKKTATEEPAGESDAPAKNEKSNDSRAESRATEARAQRVPATPSHVSQPQ 598


>gi|115699004|ref|XP_780169.2| PREDICTED: similar to cortical granule protein with
           LDL-receptor-like repeats [Strongylocentrotus
           purpuratus]
 gi|115950522|ref|XP_001192861.1| PREDICTED: similar to cortical granule protein with
           LDL-receptor-like repeats [Strongylocentrotus
           purpuratus]
          Length = 1110

 Score = 36.4 bits (82), Expect = 2.7,   Method: Composition-based stats.
 Identities = 22/110 (20%), Positives = 40/110 (36%), Gaps = 11/110 (10%)

Query: 99  EQDDLLVKEQKERAQNALSEFEASP------CPLIEEGKEPIFENSIQP----KVEDVAF 148
            QD  ++K+Q        +  E  P       P   +  +P    ++QP    +V+    
Sbjct: 814 RQDVDILKQQANENNQPYAPQEVQPYEPEAVQPYAPQEVQPYEPEAVQPYAPQEVQPYEP 873

Query: 149 KTPDISREKDVSYKKVRRRRPLRPR-VFPNAKSGNQPVEATETIVPQELN 197
           +       +DV   + +  RP  P+ V P      +P E  +   P+  N
Sbjct: 874 EAVQPYEPQDVRPYEPQNVRPYEPQDVRPPEPQNVRPYEPQDVRPPEPQN 923


>gi|68536844|ref|YP_251549.1| hypothetical protein jk1754 [Corynebacterium jeikeium K411]
 gi|68264443|emb|CAI37931.1| hypothetical protein jk1754 [Corynebacterium jeikeium K411]
          Length = 427

 Score = 36.4 bits (82), Expect = 2.7,   Method: Composition-based stats.
 Identities = 9/69 (13%), Positives = 20/69 (28%)

Query: 109 KERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRR 168
                     F A   P  +   +P+ + + QP  ++ A      +       ++ + RR
Sbjct: 312 AHGDHREYFNFFAVTAPAPKSAPQPVPKPAPQPVPQNAAVAAVASTAGAPAISRRPKHRR 371

Query: 169 PLRPRVFPN 177
                    
Sbjct: 372 ARANAHKHR 380


>gi|221106935|ref|XP_002157698.1| PREDICTED: similar to drebrin-like [Hydra magnipapillata]
          Length = 673

 Score = 36.4 bits (82), Expect = 2.8,   Method: Composition-based stats.
 Identities = 24/133 (18%), Positives = 59/133 (44%), Gaps = 8/133 (6%)

Query: 66  DYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE---AS 122
           + +  +  L+ AEH + +    +   +E+ +R ++ + L++ ++E  + +  + E   + 
Sbjct: 247 ERIRYQKTLKEAEHDDEMFK--KRSEEERKKRLQEANKLIQSREESPKESFKKTEEPSSK 304

Query: 123 PCPLIEEGKE-PIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPN--AK 179
           P P I   K+ P      QPK  +   ++      K +  +  +R  P++  V      +
Sbjct: 305 PLPTISNVKKLPPAVQKKQPKPAESLLQSEVQDNLKKIKQEPEKRYEPVQEPVKSREPNQ 364

Query: 180 SGNQPVEATETIV 192
              +P+E ++  V
Sbjct: 365 EPVKPIEPSQEPV 377


>gi|159127498|gb|EDP52613.1| ARID/BRIGHT domain protein (SWI1), putative [Aspergillus fumigatus
           A1163]
          Length = 981

 Score = 36.4 bits (82), Expect = 2.8,   Method: Composition-based stats.
 Identities = 20/142 (14%), Positives = 43/142 (30%), Gaps = 13/142 (9%)

Query: 78  EHYNRIVSM--------AQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEAS---PCPL 126
           EHY R ++          Q Q  +++Q++            + Q+   +       P P+
Sbjct: 364 EHYQRNLAAYEQAFLSTQQKQFADQMQQNSLPRQPSDSSAVQFQSPTVKQAQGFEVPQPV 423

Query: 127 IEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVE 186
                     N+ Q  + +       +         ++   R  +P   P   +G  P +
Sbjct: 424 GASPGSMSVANNAQQSLPNGFATPTQVKASNKQQQHRLSVSRQSQPPATPQDSTGQLPNQ 483

Query: 187 ATETIVPQELN--SDNASSVDQ 206
           +              +A S +Q
Sbjct: 484 SPAQSTKPLGGTPGKSAKSFEQ 505


>gi|123423901|ref|XP_001306471.1| hypothetical protein [Trichomonas vaginalis G3]
 gi|121888047|gb|EAX93541.1| conserved hypothetical protein [Trichomonas vaginalis G3]
          Length = 502

 Score = 36.4 bits (82), Expect = 2.8,   Method: Composition-based stats.
 Identities = 14/109 (12%), Positives = 36/109 (33%), Gaps = 5/109 (4%)

Query: 81  NRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPI-FENSI 139
            ++++  + +  +  +          E K   Q           P+  +  +P   E  +
Sbjct: 364 TKLINSIKKEQPDPRREHPDSKKEDGETKNTHQRKEQPNPPKSQPVPPQKSQPKPSERKV 423

Query: 140 QPKVEDVAFKTPDI----SREKDVSYKKVRRRRPLRPRVFPNAKSGNQP 184
           QP   +   + P       +++    +K  R++  +P+  P       P
Sbjct: 424 QPNPPEKRERKPQPIPPEIKDRKGQPEKRERKQQPKPQPIPETNPNRGP 472


>gi|195483970|ref|XP_002090507.1| GE12772 [Drosophila yakuba]
 gi|194176608|gb|EDW90219.1| GE12772 [Drosophila yakuba]
          Length = 1141

 Score = 36.4 bits (82), Expect = 2.8,   Method: Composition-based stats.
 Identities = 18/97 (18%), Positives = 33/97 (34%), Gaps = 3/97 (3%)

Query: 98   DEQDDLLVKEQKERAQNALSEFEASPCP--LIEEGKEPIFENSIQPKVEDVAFK-TPDIS 154
            +E++        E+  +   +  A P P     E ++P  +  I+ + ED       +  
Sbjct: 1041 EEEEASTNNTSHEQEDDDPDQERAPPSPMSATSESEQPQMDVDIKTEPEDQKEDFDSESV 1100

Query: 155  REKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETI 191
              K  +   V+      P   P A     P  A  T+
Sbjct: 1101 SVKTPTKAAVKAVSEEPPPTEPVASVAATPTRARRTV 1137


>gi|195351153|ref|XP_002042101.1| GM25932 [Drosophila sechellia]
 gi|194123925|gb|EDW45968.1| GM25932 [Drosophila sechellia]
          Length = 1212

 Score = 36.4 bits (82), Expect = 2.8,   Method: Composition-based stats.
 Identities = 14/79 (17%), Positives = 33/79 (41%)

Query: 125 PLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQP 184
           P + +G+ P  E   QP  +    +T +     ++S +++R RR          ++   P
Sbjct: 31  PQLPQGEMPGQEQPEQPNPDVQPQQTAEAVVVTELSAEEMRARRLRTLAARGGIQNVLAP 90

Query: 185 VEATETIVPQELNSDNASS 203
           +  +    P++  + +  S
Sbjct: 91  LTTSPQKAPRKPTNVSGES 109


>gi|72022105|ref|XP_788766.1| PREDICTED: similar to amsh [Strongylocentrotus purpuratus]
 gi|115961211|ref|XP_001187546.1| PREDICTED: similar to amsh [Strongylocentrotus purpuratus]
          Length = 487

 Score = 36.4 bits (82), Expect = 2.8,   Method: Composition-based stats.
 Identities = 21/121 (17%), Positives = 43/121 (35%), Gaps = 7/121 (5%)

Query: 46  TAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLV 105
           T + + E+Y+   +      D   AE   Q A         A    +E  +R+++D    
Sbjct: 105 TKKKLREKYAEEHKIWQVQEDERRAEEARQEA-------MEALRLEEEHARREQEDTARF 157

Query: 106 KEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVR 165
            EQ+ + +             ++  K  + +   + +  D   K  D   E++   +  R
Sbjct: 158 DEQRRQLEELERHSIDQQQRELDGQKASLMQAKAKQEALDQERKKADALNEQEWQAEGNR 217

Query: 166 R 166
           R
Sbjct: 218 R 218


>gi|241889735|ref|ZP_04777033.1| putative cell surface protein [Gemella haemolysans ATCC 10379]
 gi|241863357|gb|EER67741.1| putative cell surface protein [Gemella haemolysans ATCC 10379]
          Length = 833

 Score = 36.1 bits (81), Expect = 2.8,   Method: Composition-based stats.
 Identities = 13/80 (16%), Positives = 23/80 (28%), Gaps = 1/80 (1%)

Query: 107 EQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRR 166
           E  E     +      P P  + G     + + +P   D     P  +   D      + 
Sbjct: 696 ENNEPKPKPIPGPGDKPKPDPKPGLGDKPKPNPEPAPGDGPIADPKPAP-GDGPKPDPKP 754

Query: 167 RRPLRPRVFPNAKSGNQPVE 186
               +P+  P    G+ P  
Sbjct: 755 APGDKPKPDPKPGLGDTPNP 774


>gi|227113316|ref|ZP_03826972.1| TonB-like protein [Pectobacterium carotovorum subsp. brasiliensis
           PBR1692]
          Length = 273

 Score = 36.1 bits (81), Expect = 2.8,   Method: Composition-based stats.
 Identities = 17/95 (17%), Positives = 33/95 (34%), Gaps = 4/95 (4%)

Query: 112 AQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKV----RRR 167
            Q   +  EA+  P     + P+   + +P +     + P   ++     +K       +
Sbjct: 75  QQTLSTPQEAATQPEKMTQEVPLLAPAPKPVIAAAQKEKPQPQKKVQKKMEKPVQETTPQ 134

Query: 168 RPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
             + P   P A   + P+  +   V    NSD A 
Sbjct: 135 EEIAPSEKPPAPVTSAPLPGSSQQVAAPYNSDAAQ 169


>gi|167523393|ref|XP_001746033.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163775304|gb|EDQ88928.1| predicted protein [Monosiga brevicollis MX1]
          Length = 1541

 Score = 36.1 bits (81), Expect = 2.8,   Method: Composition-based stats.
 Identities = 18/83 (21%), Positives = 25/83 (30%), Gaps = 11/83 (13%)

Query: 112  AQNALSEFEASPCPLIEEGKEPIFENSIQPK---VEDVAFKTPDISREKDVSYKKVRRRR 168
             +       A P P   + K    E  I P+        F TP       +      R  
Sbjct: 1215 EELGRGSLPARPAPAEPQAKRAAPEAPITPRPVLPRQGPFTTPQA-----LQPPVPHRNT 1269

Query: 169  PLRPRVFPNAKSGNQPVEATETI 191
            P+     P A S   P+ A  T+
Sbjct: 1270 PVHT---PRASSTASPMPAAATV 1289


>gi|171769783|sp|A2R7P5|NST1_ASPNC RecName: Full=Stress response protein nst1
 gi|134083288|emb|CAK46843.1| unnamed protein product [Aspergillus niger]
          Length = 1201

 Score = 36.1 bits (81), Expect = 2.9,   Method: Composition-based stats.
 Identities = 28/146 (19%), Positives = 49/146 (33%), Gaps = 25/146 (17%)

Query: 70  AENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSE----------- 118
           AE   + AE   R+    + Q + + ++ EQ +L  K ++E  QN L E           
Sbjct: 614 AERLRKEAEKQKRLREERERQAEIERKQREQKELEKKRREEARQNELREKKTKDERERKL 673

Query: 119 FEASP--------------CPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKV 164
            EA+P                +   G  PI  +    +      ++P       +  K  
Sbjct: 674 REAAPKTDYEGQEKRDPQAKRVSHTGPVPIPASLQHAQALPAYLQSPHYQIATPIVPKAP 733

Query: 165 RRRRPLRPRVFPNAKSGNQPVEATET 190
              RP +P    +  S  +   A+  
Sbjct: 734 TPARPRQPSQQGSHTSSPRSQPASTE 759


>gi|120404563|ref|YP_954392.1| YVTN beta-propeller repeat-containing protein [Mycobacterium
           vanbaalenii PYR-1]
 gi|119957381|gb|ABM14386.1| 40-residue YVTN family beta-propeller repeat protein [Mycobacterium
           vanbaalenii PYR-1]
          Length = 1056

 Score = 36.1 bits (81), Expect = 2.9,   Method: Composition-based stats.
 Identities = 17/121 (14%), Positives = 37/121 (30%), Gaps = 1/121 (0%)

Query: 85  SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVE 144
           + A  +     Q +   D   +  +E   +A+         +++   EP+  +   P+ E
Sbjct: 55  ADAPTETDVDEQDEAAVDEPEQPAEENDADAVETVRDRQDRIVDTDPEPVAASDDAPETE 114

Query: 145 DVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQ-PVEATETIVPQELNSDNASS 203
                  D +               + P   P A +  + P    E +      S   S+
Sbjct: 115 PEPEPAVDEAVTAPEDAPTGDPAPDVAPPTGPEADTVAEIPSPGAEPVEAPASTSVTLST 174

Query: 204 V 204
           +
Sbjct: 175 I 175


>gi|72255605|gb|AAZ66923.1| 117M18_4 [Brassica rapa]
          Length = 424

 Score = 36.1 bits (81), Expect = 2.9,   Method: Composition-based stats.
 Identities = 15/94 (15%), Positives = 37/94 (39%), Gaps = 8/94 (8%)

Query: 109 KERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKK----- 163
            + +QN     E+      EE ++P  E   +P++ D + +  ++        ++     
Sbjct: 20  ADESQNDEVVAESLEASTQEESQQPNAEAEAKPEITDSSNQVDEVKDASPSQQQEDVKAE 79

Query: 164 ---VRRRRPLRPRVFPNAKSGNQPVEATETIVPQ 194
                +++P RPR     ++  + V+  +   P 
Sbjct: 80  EVDEDKKKPGRPRGGKRKRATKKEVDVKDEKKPP 113


>gi|256378338|ref|YP_003101998.1| hypothetical protein Amir_4298 [Actinosynnema mirum DSM 43827]
 gi|255922641|gb|ACU38152.1| hypothetical protein Amir_4298 [Actinosynnema mirum DSM 43827]
          Length = 248

 Score = 36.1 bits (81), Expect = 2.9,   Method: Composition-based stats.
 Identities = 23/119 (19%), Positives = 42/119 (35%), Gaps = 1/119 (0%)

Query: 81  NRIVSMAQAQIQEKLQRDEQDDLLVKE-QKERAQNALSEFEASPCPLIEEGKEPIFENSI 139
            R++   +A+     +R +       + ++   Q   S  E +  P+ E   EP  E ++
Sbjct: 75  LRLLQAVRAKSDVVPERVKPSAQARADAERFSGQVLESAVETAREPVREPAAEPAREPAV 134

Query: 140 QPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNS 198
           +P  E      P+ S +        R    LRP   P      +PV+    + P     
Sbjct: 135 EPVREQAPDPAPEPSADPFGEGDHPRPAGHLRPADPPRTGGLLRPVDQPLPVEPARPGG 193


>gi|123507969|ref|XP_001329532.1| hypothetical protein [Trichomonas vaginalis G3]
 gi|121912488|gb|EAY17309.1| conserved hypothetical protein [Trichomonas vaginalis G3]
          Length = 395

 Score = 36.1 bits (81), Expect = 2.9,   Method: Composition-based stats.
 Identities = 19/94 (20%), Positives = 40/94 (42%), Gaps = 12/94 (12%)

Query: 45  GTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIV--SMAQAQIQEKLQRDEQDD 102
           G A    E+Y           D ++ E+  + AE Y ++     A+A+ + + Q ++   
Sbjct: 201 GNANK-REKYFE------ENKDKIIEESEKRKAE-YAKMTPEEAAKARKERRSQHNQLIM 252

Query: 103 LLVKEQKERAQNALSEF--EASPCPLIEEGKEPI 134
              +E+ E+ Q  L     +A+P    +  ++P 
Sbjct: 253 KKRQEKYEKQQRKLQGQTQQAAPQDFNQNQQQPG 286


>gi|70999524|ref|XP_754481.1| ARID/BRIGHT domain protein (SWI1) [Aspergillus fumigatus Af293]
 gi|66852118|gb|EAL92443.1| ARID/BRIGHT domain protein (SWI1), putative [Aspergillus fumigatus
           Af293]
          Length = 981

 Score = 36.1 bits (81), Expect = 2.9,   Method: Composition-based stats.
 Identities = 20/142 (14%), Positives = 43/142 (30%), Gaps = 13/142 (9%)

Query: 78  EHYNRIVSM--------AQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEAS---PCPL 126
           EHY R ++          Q Q  +++Q++            + Q+   +       P P+
Sbjct: 364 EHYQRNLAAYEQAFLSTQQKQFADQMQQNSLPRQPSDSSAVQFQSPTVKQAQGFEVPQPV 423

Query: 127 IEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVE 186
                     N+ Q  + +       +         ++   R  +P   P   +G  P +
Sbjct: 424 GASPGSMSVANNAQQSLPNGFATPTQVKASNKQQQHRLSVSRQSQPPATPQDSTGQLPNQ 483

Query: 187 ATETIVPQELN--SDNASSVDQ 206
           +              +A S +Q
Sbjct: 484 SPAQSTKPLGGTPGKSAKSFEQ 505


>gi|332830663|gb|EGK03269.1| transcription termination factor Rho [Dysgonomonas gadei ATCC
           BAA-286]
          Length = 636

 Score = 36.1 bits (81), Expect = 2.9,   Method: Composition-based stats.
 Identities = 19/116 (16%), Positives = 46/116 (39%), Gaps = 4/116 (3%)

Query: 90  QIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCP--LIEEGKEPIFENSIQPKVEDVA 147
           Q ++++++ ++      + K++AQN   + + +P P        +     ++QPK ED  
Sbjct: 59  QSEDRIEQQQKKSQAAAKGKQKAQNQTKKQDQTPKPQTTPPAPAKETKVAAVQPKKEDTP 118

Query: 148 FKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASS 203
              P   +E     K    + P+  +    A          + I+ ++ N +   +
Sbjct: 119 --KPTPQKEVKKEAKPEPVKAPVEEKKEATAPVVAAEKAPQKEIIVKKNNGEPKEN 172


>gi|307250414|ref|ZP_07532361.1| hypothetical protein appser4_11950 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306857543|gb|EFM89652.1| hypothetical protein appser4_11950 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
          Length = 372

 Score = 36.1 bits (81), Expect = 3.0,   Method: Composition-based stats.
 Identities = 16/104 (15%), Positives = 36/104 (34%)

Query: 88  QAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVA 147
           Q Q ++   + EQ      +Q++  Q    + +       +E  +       QPK +   
Sbjct: 57  QPQPKQDQPKQEQPKQEQPKQEQPKQEQPKQDQPKQEQPKQEQPKQDQPKQEQPKQDQPK 116

Query: 148 FKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETI 191
            + P   + K    K+ + ++    +  P  +   Q     +T 
Sbjct: 117 QEQPKQDQPKQDQPKQDQPKQDQPKQDQPKQEQPKQDQPKDKTS 160


>gi|56205372|emb|CAI24007.1| misshapen-like kinase 1 (zebrafish) [Mus musculus]
 gi|123233528|emb|CAM28126.1| misshapen-like kinase 1 (zebrafish) [Mus musculus]
          Length = 1197

 Score = 36.1 bits (81), Expect = 3.0,   Method: Composition-based stats.
 Identities = 22/140 (15%), Positives = 48/140 (34%), Gaps = 15/140 (10%)

Query: 79  HYNRIVSMAQ-----AQIQEKLQRDEQDDLLVKEQKERAQNALSE-FEASPCPLIEEGKE 132
           HY R ++ A       +++E+ + ++Q +  + + K  +        +ASP P     + 
Sbjct: 361 HYGRGINPADKPAWAREVEERARMNKQQNSPLAKAKPSSAGPEPPISQASPSPPGPLSQT 420

Query: 133 PIFENSIQPKVED-------VAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPV 185
           P  +  ++P+               P  +        + +  R L    FP +   +   
Sbjct: 421 PPMQRPVEPQEGPHKSLVAHRVPLKPYAAPVPRSQSLQDQPTRNLA--AFPASHDPDPAA 478

Query: 186 EATETIVPQELNSDNASSVD 205
             T T  P    +    + D
Sbjct: 479 VPTPTATPSARGAVIRQNSD 498


>gi|289616839|emb|CBI56405.1| unnamed protein product [Sordaria macrospora]
          Length = 1316

 Score = 36.1 bits (81), Expect = 3.0,   Method: Composition-based stats.
 Identities = 23/134 (17%), Positives = 52/134 (38%), Gaps = 8/134 (5%)

Query: 75  QHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPI 134
           QH  HY    S  + + QE+    +Q     +   ++ ++ L         +     +P+
Sbjct: 172 QHVPHYPPPYSPFRPEEQEQFVLRQQQRQQQQAGTQQGESQLRGGGKLQKRMWLGQVKPL 231

Query: 135 FENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPN------AKSGNQPVEAT 188
             ++  P +       P+ +  +  S ++ R+++  +PRV  N      ++    P  + 
Sbjct: 232 RLSAPPPAL--ALPTIPEGTSPRRASLREARKKQENKPRVLSNITEEADSQRSLTPPPSV 289

Query: 189 ETIVPQELNSDNAS 202
               P+  NS+ A 
Sbjct: 290 HFGSPKRRNSETAE 303


>gi|110635501|ref|YP_675709.1| TolA, TolA protein [Mesorhizobium sp. BNC1]
 gi|110286485|gb|ABG64544.1| Cell division and transport-associated protein TolA [Chelativorans
           sp. BNC1]
          Length = 351

 Score = 36.1 bits (81), Expect = 3.0,   Method: Composition-based stats.
 Identities = 23/119 (19%), Positives = 34/119 (28%), Gaps = 6/119 (5%)

Query: 89  AQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAF 148
            Q  E     +     V++  E  Q A +E    P P  E   +P  E    P  E +  
Sbjct: 101 EQASEPPPSPKPQPKPVEKPVETPQEAKAEEVPVPTPEREPEPQPRQEVKPNPAPEPLVA 160

Query: 149 KTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQD 207
           +  +    K      V + RP  P      K         +           AS   +D
Sbjct: 161 ENAEGESVKLPPAAPVPQARPQPP------KPQIAKAPERKEAEKPAAEQKQASRATKD 213


>gi|15030181|gb|AAH11346.1| Mink1 protein [Mus musculus]
          Length = 1197

 Score = 36.1 bits (81), Expect = 3.0,   Method: Composition-based stats.
 Identities = 22/140 (15%), Positives = 48/140 (34%), Gaps = 15/140 (10%)

Query: 79  HYNRIVSMAQ-----AQIQEKLQRDEQDDLLVKEQKERAQNALSE-FEASPCPLIEEGKE 132
           HY R ++ A       +++E+ + ++Q +  + + K  +        +ASP P     + 
Sbjct: 361 HYGRGINPADKPAWAREVEERARMNKQQNSPLAKAKPSSAGPEPPISQASPSPPGPLSQT 420

Query: 133 PIFENSIQPKVED-------VAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPV 185
           P  +  ++P+               P  +        + +  R L    FP +   +   
Sbjct: 421 PPMQRPVEPQEGPHKSLVAHRVPLKPYAAPVPRSQSLQDQPTRNLA--AFPASHDPDPAA 478

Query: 186 EATETIVPQELNSDNASSVD 205
             T T  P    +    + D
Sbjct: 479 VPTPTATPSARGAVIRQNSD 498


>gi|134115995|ref|XP_773384.1| hypothetical protein CNBI3230 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50256008|gb|EAL18737.1| hypothetical protein CNBI3230 [Cryptococcus neoformans var.
           neoformans B-3501A]
          Length = 952

 Score = 36.1 bits (81), Expect = 3.0,   Method: Composition-based stats.
 Identities = 15/85 (17%), Positives = 29/85 (34%), Gaps = 2/85 (2%)

Query: 84  VSMAQAQIQEKLQRDEQD--DLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQP 141
           +  A +  Q   + DE D  DL V    +         E  P P+ +   +   +   +P
Sbjct: 563 IPPASSADQAPQEEDEADGWDLDVAASTKLEARTEHAPEPQPQPVSQHEPQHEPQRESEP 622

Query: 142 KVEDVAFKTPDISREKDVSYKKVRR 166
           + E      P  +       ++ +R
Sbjct: 623 QPEPKPVSAPAPTSAPTKPLREAKR 647


>gi|269103102|ref|ZP_06155799.1| DNA polymerase III subunits gamma and tau [Photobacterium damselae
           subsp. damselae CIP 102761]
 gi|268163000|gb|EEZ41496.1| DNA polymerase III subunits gamma and tau [Photobacterium damselae
           subsp. damselae CIP 102761]
          Length = 698

 Score = 36.1 bits (81), Expect = 3.0,   Method: Composition-based stats.
 Identities = 19/118 (16%), Positives = 37/118 (31%), Gaps = 1/118 (0%)

Query: 86  MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVED 145
             Q +       D +  L +   +  A   +S     P  +    +EPI   ++QP    
Sbjct: 331 ALQGRQDLAFAPDGRTGLEMVLLRMLAFRPMSGAGIVPQAISVPTQEPIQGATVQPMPAP 390

Query: 146 VA-FKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNAS 202
               +     R +         + P +P V    +   QP       V  + +  +A+
Sbjct: 391 QQSMEKVQALRAQVQQPSAPAPQMPSQPPVGHQVQGYTQPKPQNVPPVAMQQSEPDAA 448


>gi|2544174