RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780876|ref|YP_003065289.1| hypothetical protein CLIBASIA_03865 [Candidatus Liberibacter asiaticus str. psy62] (210 letters) >gnl|CDD|100032 cd02196, PurM, PurM (Aminoimidazole Ribonucleotide [AIR] synthetase), one of eleven enzymes required for purine biosynthesis, catalyzes the conversion of formylglycinamide ribonucleotide (FGAM) and ATP to AIR, ADP, and Pi, the fifth step in de novo purine biosynthesis. The N-terminal domain of PurM is related to the ATP-binding domains of hydrogen expression/formation protein HypE, the AIR synthases, selenophosphate synthetase (SelD), and FGAM synthase and is thought to bind ATP.. Length = 297 Score = 30.5 bits (70), Expect = 0.34 Identities = 8/37 (21%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Query: 34 YDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVA 70 Y YD+ G A + E+ ++ + GD ++ Sbjct: 111 YAEGEYDLA--GFAVGVVEKDKIIDGSKIKPGDVLIG 145 >gnl|CDD|36212 KOG0994, KOG0994, KOG0994, Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]. Length = 1758 Score = 27.4 bits (60), Expect = 3.0 Identities = 13/54 (24%), Positives = 22/54 (40%) Query: 69 VAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEAS 122 A L A + + A+ ++ L + L E ++ AQ AL + AS Sbjct: 1409 RAGGALLMAGDADTQLRSKLAEAEQTLSMVREAKLSASEAQQSAQRALEQANAS 1462 >gnl|CDD|132735 cd06937, NR_LBD_RAR, The ligand binding domain (LBD) of retinoic acid receptor (RAR), a members of the nuclear receptor superfamily. The ligand binding domain (LBD) of retinoic acid receptor (RAR): Retinoic acid receptors are members of the nuclear receptor (NR) superfamily of ligand-regulated transcription factors. RARs mediate the biological effect of retinoids, including both naturally dietary vitamin A (retinol) metabolites and active synthetic analogs. Retinoids play key roles in a wide variety of essential biological processes, such as vertebrate embryonic morphogenesis and organogenesis, differentiation and apoptosis, and homeostasis. RARs function as heterodimers with retinoic X receptors by binding to specific RAR response elements (RAREs) found in the promoter regions of retinoid target genes. In the absence of ligand, the RAR-RXR heterodimer recruits the corepressor proteins NCoR or AMRT, and associated factors such as histone deacetylases or DNA-methyltransferases, leading to an inactive condensed chromatin structure, preventing transcription. Upon ligand binding, the corepressors are released, and coactivator complexes such as histone acetyltransferase or histone arginine methyltransferases are recruited to activate transcription. There are three RAR subtypes (alpha, beta, gamma), originating from three distinct genes. For each subtype, several isoforms exist that differ in their N-terminal region, allowing retinoids to exert their pleiotropic effects. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, retinoic acid receptors have a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a non-conserved hinge and a C-terminal ligand binding domain (LBD). Length = 231 Score = 26.7 bits (59), Expect = 4.7 Identities = 7/13 (53%), Positives = 10/13 (76%) Query: 164 VRRRRPLRPRVFP 176 R+RRP +P +FP Sbjct: 178 ARKRRPDKPHMFP 190 >gnl|CDD|113294 pfam04518, DUF582, Protein of unknown function, DUF582. This family contains several uncharacterized chlamydial proteins. Length = 380 Score = 26.5 bits (59), Expect = 5.7 Identities = 10/36 (27%), Positives = 18/36 (50%) Query: 87 AQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEAS 122 A+A + + L R + D L EQK + L+ + + Sbjct: 223 AKAVLNKLLARIKADAKLTSEQKSELLDTLNNYTDN 258 >gnl|CDD|146600 pfam04053, Coatomer_WDAD, Coatomer WD associated region. This region is composed of WD40 repeats. Length = 435 Score = 26.4 bits (59), Expect = 6.6 Identities = 8/26 (30%), Positives = 15/26 (57%) Query: 57 LARDAMSAGDYVVAENHLQHAEHYNR 82 L A+S G+ +AE Q A+ +++ Sbjct: 345 LGDAALSQGNIKLAEEAYQKAKDFDK 370 >gnl|CDD|147657 pfam05605, Di19, Drought induced 19 protein (Di19). This family consists of several drought induced 19 (Di19) like proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought. The precise function of Di19 is unknown. Length = 210 Score = 26.3 bits (58), Expect = 7.4 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 3/30 (10%) Query: 91 IQEKLQRDEQ-DDLLVKEQKERAQNALSEF 119 Q+ +R+ Q L +EQ+E+A+ SEF Sbjct: 174 DQKLSERNSQDSSLSKEEQEEKAKR--SEF 201 >gnl|CDD|147546 pfam05416, Peptidase_C37, Southampton virus-type processing peptidase. Corresponds to Merops family C37. Norwalk-like viruses (NLVs), including the Southampton virus, cause acute non-bacterial gastroenteritis in humans. The NLV genome encodes three open reading frames (ORFs). ORF1 encodes a polyprotein, which is processed by the viral protease into six proteins. Length = 535 Score = 26.0 bits (57), Expect = 8.2 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 2/61 (3%) Query: 110 ERAQNALSEFEASPCPLIEEGKEPIFENSIQ--PKVEDVAFKTPDISREKDVSYKKVRRR 167 E ++AL +++ +PC +I G + + VE V TP + E + +++R Sbjct: 98 EELKHALKDYKIAPCQIIYRGATYSVSSDGKGNVSVEKVLVTTPQLVNELSNALRRLRAA 157 Query: 168 R 168 R Sbjct: 158 R 158 >gnl|CDD|34155 COG4477, EzrA, Negative regulator of septation ring formation [Cell division and chromosome partitioning]. Length = 570 Score = 25.6 bits (56), Expect = 9.1 Identities = 19/82 (23%), Positives = 34/82 (41%), Gaps = 4/82 (4%) Query: 41 VKVRGTAQHIAERYS----VLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQ 96 VR + + E S +L Y +++L+ E + Q ++QE L Sbjct: 347 GSVRKFEKELKELESVLDEILENIEAQEVAYSELQDNLEEIEKALTDIEDEQEKVQEHLT 406 Query: 97 RDEQDDLLVKEQKERAQNALSE 118 +D+L +E ER ++ L E Sbjct: 407 SLRKDELEARENLERLKSKLHE 428 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.312 0.128 0.356 Gapped Lambda K H 0.267 0.0522 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,353,413 Number of extensions: 115241 Number of successful extensions: 252 Number of sequences better than 10.0: 1 Number of HSP's gapped: 252 Number of HSP's successfully gapped: 28 Length of query: 210 Length of database: 6,263,737 Length adjustment: 90 Effective length of query: 120 Effective length of database: 4,318,927 Effective search space: 518271240 Effective search space used: 518271240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 55 (25.4 bits)