RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780876|ref|YP_003065289.1| hypothetical protein CLIBASIA_03865 [Candidatus Liberibacter asiaticus str. psy62] (210 letters) >gnl|CDD|151399 pfam10952, DUF2753, Protein of unknown function (DUF2753). This bacterial family of proteins has no known function. Length = 140 Score = 28.9 bits (65), Expect = 1.1 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 8/53 (15%) Query: 52 ERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLL 104 ER+++LA +A+ GD + + H Q A +A++Q ++ DE +DLL Sbjct: 2 ERHTLLADEALKNGDPLRSILHYQQA--------LAESQELDESNEDELEDLL 46 >gnl|CDD|180049 PRK05385, PRK05385, phosphoribosylaminoimidazole synthetase; Provisional. Length = 327 Score = 28.1 bits (64), Expect = 1.6 Identities = 8/37 (21%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Query: 34 YDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVA 70 Y YD+ G A + E+ ++ + GD ++ Sbjct: 143 YHEGDYDLA--GFAVGVVEKDKIIDGSKVKEGDVLIG 177 >gnl|CDD|183314 PRK11788, PRK11788, tetratricopeptide repeat protein; Provisional. Length = 389 Score = 27.5 bits (62), Expect = 2.7 Identities = 14/65 (21%), Positives = 23/65 (35%), Gaps = 5/65 (7%) Query: 41 VKVRGTAQH--IAERYSVLARDAMSAGDYVVAENHLQHAEHYNRI---VSMAQAQIQEKL 95 K+ G + IA Y LA+ A++ GD A L+ A + S+ + Sbjct: 168 EKLGGDSLRVEIAHFYCELAQQALARGDLDAARALLKKALAADPQCVRASILLGDLALAQ 227 Query: 96 QRDEQ 100 Sbjct: 228 GDYAA 232 >gnl|CDD|182123 PRK09866, PRK09866, hypothetical protein; Provisional. Length = 741 Score = 27.1 bits (60), Expect = 3.6 Identities = 5/34 (14%), Positives = 16/34 (47%), Gaps = 4/34 (11%) Query: 85 SMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSE 118 + ++Q +L+ + L +++Q E + + Sbjct: 681 ASCLTELQTRLR----ESLALRQQNESVVRLMQQ 710 >gnl|CDD|117002 pfam08423, Rad51, Rad51. Rad51 is a DNA repair and recombination protein and is a homologue of the bacterial ATPase RecA protein. Length = 261 Score = 26.9 bits (60), Expect = 4.4 Identities = 12/45 (26%), Positives = 20/45 (44%), Gaps = 4/45 (8%) Query: 50 IAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEK 94 IAER+ + + + Y A N EH +++ A A + E Sbjct: 97 IAERFGLDPEEVLDNIAYARAYNT----EHQMQLLLQAAAMMSES 137 >gnl|CDD|181920 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional. Length = 387 Score = 26.7 bits (59), Expect = 4.4 Identities = 12/28 (42%), Positives = 21/28 (75%) Query: 88 QAQIQEKLQRDEQDDLLVKEQKERAQNA 115 QA QE+L++ E++ L +EQK++A+ A Sbjct: 96 QAAEQERLKQLEKERLAAQEQKKQAEEA 123 >gnl|CDD|152557 pfam12122, DUF3582, Protein of unknown function (DUF3582). This domain is found in bacteria, and is approximately 130 amino acids in length. It is found associated with pfam01694. There is a conserved ASW sequence motif. This domain has a single completely conserved residue F that may be functionally important. Length = 126 Score = 26.5 bits (59), Expect = 5.1 Identities = 12/42 (28%), Positives = 21/42 (50%), Gaps = 4/42 (9%) Query: 86 MAQAQIQEKLQRDEQD--DLLV--KEQKERAQNALSEFEASP 123 +A I +L + Q L + +EQ +A+ L+EF +P Sbjct: 20 LATQGIDLELMPERQGQVALWLADEEQLAQAEAELAEFLQNP 61 >gnl|CDD|162374 TIGR01464, hemE, uroporphyrinogen decarboxylase. This model represents uroporphyrinogen decarboxylase (HemE), which converts uroporphyrinogen III to coproporphyrinogen III. This step takes the pathway toward protoporphyrin IX, a common precursor of both heme and chlorophyll, rather than toward precorrin 2 and its products. Length = 338 Score = 26.5 bits (59), Expect = 5.3 Identities = 12/46 (26%), Positives = 17/46 (36%), Gaps = 7/46 (15%) Query: 127 IEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSY-----KKVRRR 167 EGK P+ I+ EDV E ++ Y K +R Sbjct: 84 FVEGKGPVIPEPIRTP-EDVERLKEFDP-ESELPYVYEAIKLLREE 127 >gnl|CDD|183073 PRK11281, PRK11281, hypothetical protein; Provisional. Length = 1113 Score = 26.4 bits (59), Expect = 6.2 Identities = 9/34 (26%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Query: 86 MAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEF 119 + +AQ Q++ R + + L+ +E + Q LS+ Sbjct: 262 VQEAQSQDEAARIQANPLVAQELEINLQ--LSQR 293 >gnl|CDD|183823 PRK12901, secA, preprotein translocase subunit SecA; Reviewed. Length = 1112 Score = 25.8 bits (57), Expect = 7.7 Identities = 15/83 (18%), Positives = 28/83 (33%), Gaps = 1/83 (1%) Query: 83 IVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPK 142 I +I+E + D + QKE Q++ AS + + P+ + Sbjct: 1019 IPVQEAPEIREAAPE-RRLDPKYRTQKEEIQDSDQRAAASRDTGAQVKETPVRVEKKIGR 1077 Query: 143 VEDVAFKTPDISREKDVSYKKVR 165 + V + D K +K Sbjct: 1078 NDPVPCQNVDGGSGKKYKFKHAE 1100 >gnl|CDD|178875 PRK00115, hemE, uroporphyrinogen decarboxylase; Validated. Length = 346 Score = 25.9 bits (58), Expect = 8.3 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 7/52 (13%) Query: 127 IEEGKEPIFENSIQPKVEDV-AFKTPDISREKDVSY--KKVRR-RRPLRPRV 174 EEG+ P+F+N I+ DV PD E+D+ Y + VR RR L V Sbjct: 90 FEEGEGPVFDNPIR-TEADVEKLPVPDP--EEDLPYVLEAVRLLRRELGGEV 138 >gnl|CDD|173148 PRK14685, PRK14685, hypothetical protein; Provisional. Length = 177 Score = 25.5 bits (55), Expect = 9.3 Identities = 9/25 (36%), Positives = 14/25 (56%) Query: 162 KKVRRRRPLRPRVFPNAKSGNQPVE 186 +++ RR P PR P A+ G P + Sbjct: 18 RRLHRRPPASPRARPGARDGGSPTQ 42 >gnl|CDD|179525 PRK03003, PRK03003, GTP-binding protein Der; Reviewed. Length = 472 Score = 25.7 bits (57), Expect = 9.3 Identities = 10/35 (28%), Positives = 17/35 (48%), Gaps = 4/35 (11%) Query: 35 DSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVV 69 D+ G++ +G +AE+ A AM D V+ Sbjct: 92 DTGGWEPDAKGLQASVAEQ----AEVAMRTADAVL 122 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.312 0.128 0.356 Gapped Lambda K H 0.267 0.0715 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,339,072 Number of extensions: 207676 Number of successful extensions: 381 Number of sequences better than 10.0: 1 Number of HSP's gapped: 380 Number of HSP's successfully gapped: 35 Length of query: 210 Length of database: 5,994,473 Length adjustment: 89 Effective length of query: 121 Effective length of database: 4,071,361 Effective search space: 492634681 Effective search space used: 492634681 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 55 (25.0 bits)