>pfam06068 TIP49 TIP49 C-terminus. This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins. The N-terminal domain contains the pfam00004 domain. In zebrafish, the liebeskummer (lik) mutation, causes development of hyperplastic embryonic hearts. lik encodes Reptin, a component of a DNA-stimulated ATPase complex. Beta-catenin and Pontin, a DNA-stimulated ATPase that is often part of complexes with Reptin, are in the same genetic pathways. The Reptin/Pontin ratio serves to regulate heart growth during development, at least in part via the beta-catenin pathway. TBP-interacting protein 49 (TIP49) was originally identified as a TBP-binding protein, and two related proteins are encoded by individual genes, tip49a and b. Although the function of this gene family has not been elucidated, they are supposed to play a critical role in nuclear events because they interact with various kinds of nuclear

Probab=98.88 E-value=6.1e-08 Score=83.51 Aligned_cols=103 Identities=19% Similarity=0.353 Sum_probs=79.3 Q ss_pred CEEEEHHHHHCCHHHHHHHHHHHHCCEEECCCCCEEECCCCEEEECCCHHHHHHHCCHHHHHHHHHHHHHHHCCHHHHCC Q ss_conf 10220214414989999999984045788799977830331559548512687640326799999999986288577266 Q gi|254780877|r 672 QVVLFDEIEKAHSDVHNILLQVLDDGRLTDSQGRTVDFRNTLIIMTSNLGAEYLIEDGDSVHDKVMGIVRSAFKPEFLNR 751 (853) Q Consensus 672 sVil~DEiEKah~~v~~~llqild~G~ltd~~G~~v~f~n~iii~TsN~G~~~~~~~~~~~~~~~~~~l~~~f~peflnR 751 (853) T Consensus 277 GVLFIDEvHMLDiEcFsfLnralEs~-----------la-PivI~ATNRG~~~IRGTd~~s--------PHGiP~DlLDR 336 (395) T pfam06068 277 GVLFIDEVHMLDIECFSFLNRALESE-----------LA-PIVILATNRGICTIRGTDIIS--------PHGIPLDLLDR 336 (395) T ss_pred CCEEEECCHHCCHHHHHHHHHHHCCC-----------CC-CEEEEEECCCCEEECCCCCCC--------CCCCCHHHHHH T ss_conf 74688500000058998887765056-----------78-769998446520352567758--------88998777730 Q ss_pred CCCEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHCCCC Q ss_conf 68158628899899999999999999999985798999988999999970898 Q gi|254780877|r 752 LDEIILFEKLRKEDMAKIVRIQLGRVLSLIKERNISMDFDDQVIDWLSCRGYD 804 (853) Q Consensus 752 id~iv~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i~l~~~~~~~~~l~~~~~~ 804 (853) T Consensus 337 l-lII~T~py~~~ei~~Ii~iRa---------~~E~v~l~~~al~~L~~ig~~ 379 (395) T pfam06068 337 L-LIITTEPYTREEIKQILEIRA---------QEEGVEISEEALDLLAKIGEE 379 (395) T ss_pred E-EEEECCCCCHHHHHHHHHHHH---------HHHCCCCCHHHHHHHHHHHHH T ss_conf 2-588568899899999999877---------760787798999999986532

HHsearch alignment for GI: 254780877 and conserved domain: pfam06068