Query gi|254780878|ref|YP_003065291.1| hypothetical protein CLIBASIA_03875 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 51 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Sun May 29 23:55:23 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780878.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 pfam01007 IRK Inward rectifier 44.7 28 0.00071 16.7 3.6 23 12-34 36-58 (336) 2 KOG1688 consensus 34.0 42 0.0011 15.7 3.0 20 2-21 116-135 (188) 3 pfam12297 EVC2_like Ellis van 31.2 47 0.0012 15.5 3.6 32 11-42 68-99 (429) 4 COG1584 Predicted membrane pro 27.9 15 0.00039 18.0 -0.2 28 20-48 120-147 (207) 5 TIGR02876 spore_yqfD sporulati 24.8 52 0.0013 15.3 2.0 26 2-27 73-105 (406) 6 TIGR03110 exosort_Gpos exosort 22.0 71 0.0018 14.5 4.4 37 2-38 24-65 (187) 7 COG5085 Predicted membrane pro 21.9 71 0.0018 14.5 3.7 34 7-40 83-116 (230) 8 KOG4503 consensus 21.9 71 0.0018 14.5 3.7 34 7-40 83-116 (230) 9 TIGR02897 QoxC cytochrome aa3 20.3 58 0.0015 15.0 1.5 12 26-37 179-190 (190) 10 TIGR02842 CyoC cytochrome o ub 19.7 44 0.0011 15.6 0.8 19 18-36 153-179 (180) No 1 >pfam01007 IRK Inward rectifier potassium channel. Probab=44.69 E-value=28 Score=16.66 Aligned_cols=23 Identities=22% Similarity=0.706 Sum_probs=17.2 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99999999999899999999997 Q gi|254780878|r 12 IFFIALLIVFSLSWFVFTLLYLI 34 (51) Q Consensus 12 iffiallivfslswfvftllyli 34 (51) -+++.....|-+||+.|.++|.+ T Consensus 36 ~~l~if~~~y~~sw~~Fa~l~~l 58 (336) T pfam01007 36 YMLLIFSLAFLLSWLFFGTIWWL 58 (336) T ss_pred HHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99999999999999999999999 No 2 >KOG1688 consensus Probab=33.99 E-value=42 Score=15.73 Aligned_cols=20 Identities=45% Similarity=0.853 Sum_probs=16.4 Q ss_pred CHHHHHHHHHHHHHHHHHHH Q ss_conf 37688999999999999999 Q gi|254780878|r 2 GFRFWVSRIQIFFIALLIVF 21 (51) Q Consensus 2 gfrfwvsriqiffiallivf 21 (51) .|.||-|-+..+-||++..| T Consensus 116 EFKFW~s~~ka~~ia~~~tf 135 (188) T KOG1688 116 EFKFWYSSTKATLIALLCTF 135 (188) T ss_pred HHHHHHHHHHHHHHHHHHHH T ss_conf 14899999999999999999 No 3 >pfam12297 EVC2_like Ellis van Creveld protein 2 like protein. This family of proteins is found in eukaryotes. Proteins in this family are typically between 571 and 1310 amino acids in length. There are two conserved sequence motifs: LPA and ELH. EVC2 is implicated in Ellis van Creveld chondrodysplastic dwarfism in humans. Mutations in this protein can give rise to this congenital condition. LIMBIN is a protein which shares around 80% sequence homology with EVC2 and it is implicated in a similar condition in bovine chondrodysplastic dwarfism. Probab=31.23 E-value=47 Score=15.48 Aligned_cols=32 Identities=25% Similarity=0.274 Sum_probs=26.6 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEE Q ss_conf 99999999999989999999999712314465 Q gi|254780878|r 11 QIFFIALLIVFSLSWFVFTLLYLIGDVRLRTC 42 (51) Q Consensus 11 qiffiallivfslswfvftllyligdvrlrtc 42 (51) --||||+++-.-|.|.+|-+++.-+-.+-+.| T Consensus 68 agf~vaf~vsiVlt~~~~f~l~rt~~~~~~~l 99 (429) T pfam12297 68 AGFVVAFLVSIVLTLLAFFLLGRTRCLQGRML 99 (429) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC T ss_conf 89999999999999999999987411013531 No 4 >COG1584 Predicted membrane protein [Function unknown] Probab=27.91 E-value=15 Score=17.98 Aligned_cols=28 Identities=36% Similarity=0.700 Sum_probs=20.0 Q ss_pred HHHHHHHHHHHHHHHCCCEEEEEEEEEEE Q ss_conf 99989999999999712314465134676 Q gi|254780878|r 20 VFSLSWFVFTLLYLIGDVRLRTCDFQMTF 48 (51) Q Consensus 20 vfslswfvftllyligdvrlrtcdfqmtf 48 (51) .+-.-|.+||++-+++..+. +-.+|++| T Consensus 120 ~yL~~WgiFT~~M~~~Tlk~-~~al~~~F 147 (207) T COG1584 120 WYLILWGIFTLLMFIGTLKS-TRALQFVF 147 (207) T ss_pred HHHHHHHHHHHHHHHHHHHH-HHHHHHHH T ss_conf 99999999999999999899-99999999 No 5 >TIGR02876 spore_yqfD sporulation protein YqfD; InterPro: IPR010690 This family consists of several putative bacterial stage IV sporulation (SpoIV) proteins. YqfD of Bacillus subtilis (P54469 from SWISSPROT) is known to be essential for efficient sporulation although its exact function is unknown .. Probab=24.84 E-value=52 Score=15.25 Aligned_cols=26 Identities=35% Similarity=0.687 Sum_probs=16.4 Q ss_pred CHHHHHHHHHH-------HHHHHHHHHHHHHHH Q ss_conf 37688999999-------999999999989999 Q gi|254780878|r 2 GFRFWVSRIQI-------FFIALLIVFSLSWFV 27 (51) Q Consensus 2 gfrfwvsriqi-------ffiallivfslswfv 27 (51) |+-||..|+.= +++-++++|.||=|+ T Consensus 73 G~pF~~~r~~kr~~~~~G~L~f~~~~~~lS~fi 105 (406) T TIGR02876 73 GLPFLIKRLRKRPGILIGILLFLAIVYLLSTFI 105 (406) T ss_pred CCHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCE T ss_conf 814788898855007668999999999861755 No 6 >TIGR03110 exosort_Gpos exosortase family protein. Members of this protein family are found in a modest number of non-pathogenic Gram-positive bacteria, including three species of Lactococcus and three paralogs in Clostridium acetobutylicum. This protein appears related to the conserved core region of a family of proposed transpeptidases, exosortase (previously EpsH), thought to act on PEP-CTERM proteins, and members of the seed alignment include all proposed active site residues. Probab=21.96 E-value=71 Score=14.54 Aligned_cols=37 Identities=43% Similarity=0.595 Sum_probs=28.0 Q ss_pred CHHHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHCCCE Q ss_conf 376889999999999999-----9998999999999971231 Q gi|254780878|r 2 GFRFWVSRIQIFFIALLI-----VFSLSWFVFTLLYLIGDVR 38 (51) Q Consensus 2 gfrfwvsriqiffialli-----vfslswfvftllyligdvr 38 (51) +|.||+..+..|+|-+.+ |..+|--|-+...+|||.. T Consensus 24 ~fyFivGS~GlF~i~~~~~~py~v~~ls~~Vs~v~g~iG~lT 65 (187) T TIGR03110 24 FFYFIVGSVGLFFILTFFFRNYLVWFLSRCVSTVLGLIGDLT 65 (187) T ss_pred EEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC T ss_conf 003236148899999999702158899999998888850743 No 7 >COG5085 Predicted membrane protein [Function unknown] Probab=21.92 E-value=71 Score=14.53 Aligned_cols=34 Identities=26% Similarity=0.390 Sum_probs=26.5 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEE Q ss_conf 9999999999999999899999999997123144 Q gi|254780878|r 7 VSRIQIFFIALLIVFSLSWFVFTLLYLIGDVRLR 40 (51) Q Consensus 7 vsriqiffiallivfslswfvftllyligdvrlr 40 (51) .+-+|.||-|..+++-++..+--++-|-.||+.+ T Consensus 83 ~gYLQLflNaiv~~iilyf~~kfi~glQnDv~~k 116 (230) T COG5085 83 IGYLQLFLNAIVIGIILYFVVKFIVGLQNDVGYK 116 (230) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 9999999999999999999999999988777788 No 8 >KOG4503 consensus Probab=21.92 E-value=71 Score=14.53 Aligned_cols=34 Identities=26% Similarity=0.390 Sum_probs=26.5 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEE Q ss_conf 9999999999999999899999999997123144 Q gi|254780878|r 7 VSRIQIFFIALLIVFSLSWFVFTLLYLIGDVRLR 40 (51) Q Consensus 7 vsriqiffiallivfslswfvftllyligdvrlr 40 (51) .+-+|.||-|..+++-++..+--++-|-.||+.+ T Consensus 83 ~gYLQLflNaiv~~iilyf~~kfi~glQnDv~~k 116 (230) T KOG4503 83 IGYLQLFLNAIVIGIILYFVVKFIVGLQNDVGYK 116 (230) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 9999999999999999999999999988777788 No 9 >TIGR02897 QoxC cytochrome aa3 quinol oxidase, subunit III; InterPro: IPR014246 This entry encodes subunit III of the aa3-type quinone oxidase (QoxC), one of several bacterial terminal oxidases . This complex couples oxidation of reduced quinones to the reduction of molecular oxygen to water, and the pumping of protons to form the proton gradient utilised for ATP production. aa3-type oxidases contain two heme a cofactors as well as copper atoms at the active site.. Probab=20.29 E-value=58 Score=15.00 Aligned_cols=12 Identities=58% Similarity=1.159 Sum_probs=10.0 Q ss_pred HHHHHHHHHCCC Q ss_conf 999999997123 Q gi|254780878|r 26 FVFTLLYLIGDV 37 (51) Q Consensus 26 fvftllyligdv 37 (51) |+||..|++|-| T Consensus 179 FIfT~VYl~GMV 190 (190) T TIGR02897 179 FIFTAVYLLGMV 190 (190) T ss_pred HHHHHHHHHCCC T ss_conf 999999975179 No 10 >TIGR02842 CyoC cytochrome o ubiquinol oxidase, subunit III; InterPro: IPR014206 This entry represents subunit 3 (CyoC) of the cytochrome o terminal oxidase complex, which is a component of the aerobic respiratory chain that reacts with oxygen, reducing it to water with the concomitant transport of 4 protons across the membrane. Also known as the cytochrome bo complex, cytochrome o ubiquinol oxidase contains four subunits, two heme b cofactors and a copper atom which is believed to be the oxygen active site. This complex is structurally related to the cytochrome caa3 oxidases which utilise cytochrome c as the reductant and contain heme a cofactors, as well as the intermediate form aa3 oxidases which also react directly with quinones as the reductant.. Probab=19.73 E-value=44 Score=15.63 Aligned_cols=19 Identities=53% Similarity=0.999 Sum_probs=13.5 Q ss_pred HHHHHHHH--------HHHHHHHHHCC Q ss_conf 99999899--------99999999712 Q gi|254780878|r 18 LIVFSLSW--------FVFTLLYLIGD 36 (51) Q Consensus 18 livfslsw--------fvftllyligd 36 (51) |.-+||=| +|||..||.|- T Consensus 153 L~CLSLFWHFLDIvWIcVFT~VYL~G~ 179 (180) T TIGR02842 153 LACLSLFWHFLDIVWICVFTFVYLLGV 179 (180) T ss_pred HHHHCCHHHHHHHHHHHHHHHHHHHCC T ss_conf 998611376665364431218885113 Done!