RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780878|ref|YP_003065291.1| hypothetical protein CLIBASIA_03875 [Candidatus Liberibacter asiaticus str. psy62] (51 letters) >gnl|CDD|144198 pfam00517, GP41, Retroviral envelope protein. This family includes envelope protein from a variety of retroviruses. It includes the GP41 subunit of the envelope protein complex from human and simian immunodeficiency viruses (HIV and SIV) which mediate membrane fusion during viral entry. The family also includes bovine immunodeficiency virus, feline immunodeficiency virus and Equine infectious anaemia (EIAV). The family also includes the Gp36 protein from mouse mammary tumour virus (MMTV) and human endogenous retroviruses (HERVs). Length = 204 Score = 24.3 bits (53), Expect = 7.9 Identities = 13/41 (31%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Query: 6 WVSRIQIFFIALLIVFSLSWFVFTLLYLIGDVRLRTCDFQM 46 W+S I+I + LLI+ L + +L VR QM Sbjct: 153 WISYIKIGILILLIIIVLR-ILPGVLRNCRRVRQGYSPLQM 192 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.350 0.155 0.548 Gapped Lambda K H 0.267 0.0775 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 699,760 Number of extensions: 27419 Number of successful extensions: 507 Number of sequences better than 10.0: 1 Number of HSP's gapped: 504 Number of HSP's successfully gapped: 55 Length of query: 51 Length of database: 6,263,737 Length adjustment: 24 Effective length of query: 27 Effective length of database: 5,745,121 Effective search space: 155118267 Effective search space used: 155118267 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 14 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 38 (21.9 bits) S2: 51 (23.3 bits)