RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780878|ref|YP_003065291.1| hypothetical protein CLIBASIA_03875 [Candidatus Liberibacter asiaticus str. psy62] (51 letters) >1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, cytosolic assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 Length = 333 Score = 28.4 bits (63), Expect = 0.37 Identities = 10/32 (31%), Positives = 17/32 (53%) Query: 13 FFIALLIVFSLSWFVFTLLYLIGDVRLRTCDF 44 FF +L +F ++ +F LLY +GD + Sbjct: 63 FFASLAALFVVNNTLFALLYQLGDAPIANQSP 94 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.350 0.155 0.548 Gapped Lambda K H 0.267 0.0526 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 458,888 Number of extensions: 13203 Number of successful extensions: 128 Number of sequences better than 10.0: 1 Number of HSP's gapped: 128 Number of HSP's successfully gapped: 20 Length of query: 51 Length of database: 5,693,230 Length adjustment: 23 Effective length of query: 28 Effective length of database: 5,135,618 Effective search space: 143797304 Effective search space used: 143797304 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 14 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 38 (21.9 bits) S2: 50 (23.5 bits)