HHsearch alignment for GI: 254780879 and conserved domain: TIGR01995

>TIGR01995 PTS-II-ABC-beta PTS system, beta-glucoside-specific IIABC component; InterPro: IPR011297 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) , is a major carbohydrate transport system in bacteria. The PTS catalyses the phosphorylation of incoming sugar substrates and coupled with translocation across the cell membrane, makes the PTS a link between the uptake and metabolism of sugars. The general mechanism of the PTS is the following: a phosphoryl group from phosphoenolpyruvate (PEP) is transferred via a signal transduction pathway, to enzyme I (EI) which in turn transfers it to a phosphoryl carrier, the histidine protein (HPr). Phospho-HPr then transfers the phosphoryl group to a sugar-specific permease, a membrane-bound complex known as enzyme 2 (EII), which transports the sugar to the cell. EII consists of at least three structurally distinct domains IIA, IIB and IIC . These can either be fused together in a single polypeptide chain or exist as two or three interactive chains, formerly called enzymes II (EII) and III (EIII). The first domain (IIA or EIIA) carries the first permease-specific phosphorylation site, a histidine which is phosphorylated by phospho-HPr. The second domain (IIB or EIIB) is phosphorylated by phospho-IIA on a cysteinyl or histidyl residue, depending on the sugar transported. Finally, the phosphoryl group is transferred from the IIB domain to the sugar substrate concomitantly with the sugar uptake processed by the IIC domain. This third domain (IIC or EIIC) forms the translocation channel and the specific substrate-binding site. An additional transmembrane domain IID, homologous to IIC, can be found in some PTSs, e.g. for mannose , , , . This entry represents a family of PTS enzyme II proteins in which all three domains are found in the same polypeptide chain and which appear to have a broad specificity for beta-glucosides including salicin (beta-D-glucose-1-salicylate) and arbutin (hydroquinone-O-beta-D-glucopyranoside) . These are distinct from the closely related sucrose-specific and trehalose-specific PTS transporters.; GO: 0008982 protein-N(PI)-phosphohistidine-sugar phosphotransferase activity, 0009401 phosphoenolpyruvate-dependent sugar phosphotransferase system.
Probab=91.00  E-value=0.46  Score=26.33  Aligned_cols=68  Identities=28%  Similarity=0.315  Sum_probs=52.7

Q ss_pred             CCEEECCCCCCCEEECCCCEEEEE-------EEECCCCCEEEEECCCCEEEEEHHHHHHHHCCCCCCEEECCCEEEEE
Q ss_conf             200302679672797159679996-------53089700799983997488200214454118899788349589984
Q gi|254780879|r  514 TGVDWAAPRGTPIVAVGDGIVEKA-------NWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWI  584 (652)
Q Consensus       514 ~GVD~aAp~GTPI~Aag~G~V~~a-------g~~~GyGn~V~I~H~~Gy~T~YaHlS~~a~gV~~G~~V~qGQvIG~v  584 (652)
T Consensus       538 ~G~Ai-~P~eG~~~AP~dG~v~~VF~T~HAiGi~~~nG~E~LI-Hv-GIDTV~L~G~~Fe~~V~~Gd~v~~Gq~L~~~  612 (660)
T TIGR01995       538 KGVAI-LPSEGEVVAPVDGTVTAVFPTKHAIGIRSDNGVEILI-HV-GIDTVELKGEYFEILVKVGDKVKAGQLLLTF  612 (660)
T ss_pred             CCEEE-EECCCEEECCCCCEEEEEECCCCEEEECCCCCEEEEE-EE-EEEEEEECCEEEEEEEEECCEEEECCCCCEE
T ss_conf             84589-7158778823377899997486227412689728999-84-1234565450122214566787506631221