Query         gi|254780879|ref|YP_003065292.1| hypothetical protein CLIBASIA_03880 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 652
No_of_seqs    232 out of 1214
Neff          7.1 
Searched_HMMs 23785
Date          Tue May 31 22:41:08 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780879.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 2gu1_A Zinc peptidase; alpha/b 100.0       0       0  626.1  31.7  345  277-638     8-355 (361)
  2 2hsi_A Putative peptidase M23; 100.0 1.5E-40 5.6E-45  302.7  11.1  125  484-611   152-276 (282)
  3 3nyy_A Putative glycyl-glycine 100.0 1.1E-41       0  310.6   0.8  205  403-610     4-236 (252)
  4 1qwy_A Peptidoglycan hydrolase 100.0 3.8E-35 1.6E-39  264.6   9.1  121  485-614   163-289 (291)
  5 3it5_A Protease LASA; metallop 100.0 2.7E-30 1.1E-34  230.4  12.1  111  502-619    21-145 (182)
  6 3csq_A Morphogenesis protein 1  99.9   1E-27 4.3E-32  212.3   6.8  119  485-611   168-295 (334)
  7 2djp_A Hypothetical protein SB  97.8 4.3E-05 1.8E-09   53.1   6.2   51  276-330    15-65  (77)
  8 1e0g_A Membrane-bound lytic mu  97.5 8.7E-05 3.6E-09   51.0   4.1   45  277-327     3-47  (48)
  9 2gpr_A Glucose-permease IIA co  94.9   0.023 9.8E-07   33.9   4.1   84  505-591    27-122 (154)
 10 1f3z_A EIIA-GLC, glucose-speci  93.7   0.088 3.7E-06   29.8   5.0   95  485-585    14-116 (161)
 11 1ax3_A Iiaglc, glucose permeas  93.6   0.079 3.3E-06   30.2   4.6   83  505-591    32-127 (162)
 12 1ci3_M Protein (cytochrome F);  92.8    0.12   5E-06   28.9   4.4   62  520-581   166-227 (249)
 13 1y7m_A Hypothetical protein BS  92.5   0.025   1E-06   33.7   0.6   45  278-327     3-47  (164)
 14 2jxm_B Cytochrome F; copper, e  92.3     0.1 4.3E-06   29.4   3.6   62  519-581   166-227 (249)
 15 1q90_A Apocytochrome F; membra  90.2    0.25   1E-05   26.7   3.8  106  519-636   164-281 (292)
 16 2yty_A Cold shock domain-conta  75.7     1.9 7.8E-05   20.5   3.1   45  532-584    21-65  (88)
 17 3cdx_A Succinylglutamatedesucc  75.1     1.5 6.1E-05   21.3   2.5   16  569-584   282-297 (354)
 18 2qj8_A MLR6093 protein; NP_106  72.5     1.7 7.2E-05   20.8   2.3   22  567-588   270-291 (332)
 19 2k5n_A Putative cold-shock pro  72.4     2.8 0.00012   19.3   3.3   51  531-603     4-54  (74)
 20 1e2w_A Cytochrome F; electron   72.4     3.9 0.00017   18.2   4.8   57  523-582   168-229 (251)
 21 1h95_A CSD, Y-box binding prot  72.4       2 8.6E-05   20.2   2.7   32  532-566    11-42  (79)
 22 3h5q_A PYNP, pyrimidine-nucleo  71.5     1.4 5.7E-05   21.5   1.6   57  520-586   335-402 (436)
 23 2auk_A DNA-directed RNA polyme  68.8     4.7  0.0002   17.7   5.7   17  568-584   169-185 (190)
 24 1c9o_A CSPB, cold-shock protei  67.5     4.2 0.00017   18.1   3.4   46  531-583     3-49  (66)
 25 3fmc_A Putative succinylglutam  66.8     3.7 0.00015   18.4   3.0   23  568-590   304-326 (368)
 26 2kcm_A Cold shock domain famil  66.5     5.1 0.00021   17.4   3.7   32  531-566     2-33  (74)
 27 1dcz_A Transcarboxylase 1.3S s  66.2       3 0.00013   19.0   2.5   18  569-586    24-41  (77)
 28 1bdo_A Acetyl-COA carboxylase;  66.0     3.1 0.00013   19.0   2.5   19  569-587    27-45  (80)
 29 3a0j_A Cold shock protein; OB-  65.5     3.6 0.00015   18.5   2.8   52  531-589     3-55  (73)
 30 2k32_A A; NMR {Campylobacter j  63.9     3.6 0.00015   18.5   2.5   18  569-586    83-101 (116)
 31 1z6h_A Biotin/lipoyl attachmen  62.7     3.8 0.00016   18.3   2.5   18  569-586    52-69  (72)
 32 2q6k_A Chlorinase; complex wit  61.8     6.2 0.00026   16.8   5.3   22  574-602   230-251 (283)
 33 2d5d_A Methylmalonyl-COA decar  61.2     4.3 0.00018   18.0   2.5   19  569-587    21-39  (74)
 34 1wfq_A UNR protein; beta-barre  60.8     4.9 0.00021   17.6   2.7   60  516-583     5-64  (89)
 35 1g6p_A Cold shock protein TMCS  59.7     5.5 0.00023   17.2   2.8   46  531-583     2-48  (66)
 36 3i2z_B RNA chaperone, negative  59.6     5.4 0.00023   17.2   2.8   48  530-583     6-54  (71)
 37 1uou_A Thymidine phosphorylase  58.9     4.2 0.00018   18.0   2.1   59  520-588   369-436 (474)
 38 3cam_A Cold-shock domain famil  58.8     6.5 0.00027   16.7   3.1   47  531-583     3-50  (67)
 39 1hcz_A Cytochrome F; electron   57.8     7.3 0.00031   16.4   4.7   56  523-581   168-227 (252)
 40 1brw_A PYNP, protein (pyrimidi  57.5     1.5 6.5E-05   21.1  -0.3   60  520-589   332-402 (433)
 41 1x65_A UNR protein; cell-free   55.1     5.9 0.00025   17.0   2.4   44  532-584    11-54  (89)
 42 3fpp_A Macrolide-specific effl  55.0     6.2 0.00026   16.8   2.5   11  419-429   205-215 (341)
 43 2tpt_A Thymidine phosphorylase  53.8     1.9   8E-05   20.5  -0.3   57  520-586   337-404 (440)
 44 3lnn_A Membrane fusion protein  53.1     7.1  0.0003   16.4   2.5   12  420-431   221-232 (359)
 45 2jku_A Propionyl-COA carboxyla  52.8     3.1 0.00013   19.0   0.6   18  569-586    41-58  (94)
 46 2ytx_A Cold shock domain-conta  52.7     4.8  0.0002   17.6   1.6   46  532-585    21-66  (97)
 47 2kcc_A Acetyl-COA carboxylase   52.5     6.8 0.00029   16.6   2.3   17  569-585    57-73  (84)
 48 2ejm_A Methylcrotonoyl-COA car  52.2     6.8 0.00029   16.6   2.3   18  569-586    67-84  (99)
 49 1xjv_A Protection of telomeres  51.7       9 0.00038   15.7   7.5   76  556-635   215-291 (294)
 50 2dn8_A Acetyl-COA carboxylase   49.4     7.3 0.00031   16.3   2.1   17  569-585    69-85  (100)
 51 1ghj_A E2, E2, the dihydrolipo  49.4     6.5 0.00027   16.7   1.8   20  569-588    60-79  (79)
 52 3crk_C Dihydrolipoyllysine-res  48.5     9.2 0.00039   15.6   2.5   40  549-588    42-84  (87)
 53 1qjo_A Dihydrolipoamide acetyl  47.6     7.9 0.00033   16.1   2.0   22  569-590    59-80  (80)
 54 3hbl_A Pyruvate carboxylase; T  47.1     9.9 0.00042   15.4   2.5   18  569-586  1093-1110(1150)
 55 2dnc_A Pyruvate dehydrogenase   45.7      11 0.00046   15.1   2.5   44  548-591    43-89  (98)
 56 2zbv_A Uncharacterized conserv  45.0      11 0.00048   15.0   5.2   23  574-603   222-244 (263)
 57 2dne_A Dihydrolipoyllysine-res  44.7      11 0.00048   15.0   2.5   15  570-584    30-44  (108)
 58 2i8g_A Hypothetical protein DI  44.4     3.4 0.00014   18.7  -0.3   11  516-526    86-96  (151)
 59 2ww8_A RRGA, cell WALL surface  44.3     3.8 0.00016   18.3   0.0   36  522-557   777-812 (893)
 60 1y8o_B Dihydrolipoyllysine-res  43.7      12  0.0005   14.9   2.5   20  569-588    86-106 (128)
 61 2wv9_A Flavivirin protease NS2  42.5      12 0.00052   14.7   3.9   25  605-629   563-590 (673)
 62 2r9q_A AGR_C_764P, 2'-deoxycyt  41.6     7.1  0.0003   16.4   1.0   78  529-615   286-365 (370)
 63 2pze_A Cystic fibrosis transme  41.1      13 0.00054   14.6   2.4   52  255-313     8-59  (229)
 64 2axw_A DRAD invasin; homodimer  40.7      13 0.00055   14.6   3.6   11  315-325    13-23  (134)
 65 1pmr_A Dihydrolipoyl succinylt  40.2     9.8 0.00041   15.5   1.6   17  569-585    61-77  (80)
 66 1gjx_A Pyruvate dehydrogenase;  38.8      14 0.00059   14.4   2.9   42  549-590    38-81  (81)
 67 2qf7_A Pyruvate carboxylase pr  38.5      10 0.00043   15.3   1.4   17  569-585  1148-1164(1165)
 68 2bh8_A 1B11; transcription, mo  37.2      13 0.00054   14.6   1.8   49  531-582    18-66  (101)
 69 2x5c_A Hypothetical protein OR  34.7      16 0.00068   13.9   2.8   24  530-554    60-83  (131)
 70 2ytv_A Cold shock domain-conta  34.1      16 0.00066   14.0   1.8   47  530-584     9-55  (79)
 71 1k8m_A E2 component of branche  33.5      17 0.00071   13.8   3.3   28  569-596    63-90  (93)
 72 3h9i_A Cation efflux system pr  33.4      13 0.00055   14.6   1.3   31  419-452   256-286 (407)
 73 1l5p_A Ferredoxin; [2Fe-2S] cl  32.8      17 0.00073   13.7   2.4   23  275-297    10-32  (93)
 74 1vf5_C Cytochrome F; photosynt  32.5     2.8 0.00012   19.3  -2.2   80  523-611   169-255 (289)
 75 2cbz_A Multidrug resistance-as  30.5      19 0.00079   13.5   2.2   15  524-538   196-210 (237)
 76 2kw8_A LPXTG-SITE transpeptida  29.8      18 0.00078   13.5   1.6   12  314-325    86-97  (158)
 77 2r9v_A ATP synthase subunit al  28.6      20 0.00085   13.2   3.8   22  515-536   336-357 (515)
 78 2f4n_A Hypothetical protein MJ  27.7      19 0.00079   13.5   1.3   19  577-602   227-245 (273)
 79 2qi9_C Vitamin B12 import ATP-  27.6      21 0.00088   13.1   2.4   14  524-537   201-214 (249)
 80 2dk3_A E3 ubiquitin-protein li  27.5      21 0.00088   13.1   1.5   21  536-556    53-73  (86)
 81 1rr7_A Middle operon regulator  27.3      21 0.00089   13.1   3.7   29  283-311    91-119 (129)
 82 3bg3_A Pyruvate carboxylase, m  26.5      15 0.00065   14.0   0.7   16  569-584   665-680 (718)
 83 1czp_A Ferredoxin I; [2Fe-2S]   26.4      22 0.00093   13.0   3.2   22  276-297    15-36  (98)
 84 3bk7_A ABC transporter ATP-bin  26.4      22 0.00093   13.0   1.5   15  574-588   378-392 (607)
 85 2ixe_A Antigen peptide transpo  25.5      23 0.00096   12.9   2.2   13  526-538   226-238 (271)
 86 1iyu_A E2P, dihydrolipoamide a  25.4      23 0.00096   12.9   4.9   42  548-589    34-77  (79)
 87 2cw5_A Bacterial fluorinating   25.0      23 0.00098   12.8   4.4   27  570-603   211-237 (255)
 88 3lxf_A Ferredoxin; iron, iron-  24.4      24   0.001   12.7   3.1   23  275-297    11-33  (104)
 89 3bbo_X Ribosomal protein L27;   23.8     6.3 0.00026   16.8  -1.7   86  499-600    98-187 (198)
 90 2eo4_A 150AA long hypothetical  22.8      26  0.0011   12.5   4.6   49  590-639    90-141 (149)
 91 3hui_A Ferredoxin; cytochrome   22.7      26  0.0011   12.5   3.1   23  275-297    32-54  (126)
 92 2wlb_A ETP1-FD, electron trans  22.6      26  0.0011   12.5   3.7   23  275-297    14-36  (103)
 93 2ghi_A Transport protein; mult  22.5      26  0.0011   12.5   2.2   17  523-539   220-236 (260)
 94 1xlq_A Putidaredoxin, PDX; [2F  22.3      26  0.0011   12.5   3.1   23  275-297    11-33  (106)
 95 2elh_A CG11849-PA, LD40883P; s  21.9      27  0.0011   12.4   2.5   31  281-311    35-65  (87)

No 1  
>2gu1_A Zinc peptidase; alpha/beta, beta barrel, structural genomics, PSI, protein structure initiative; 1.90A {Vibrio cholerae}
Probab=100.00  E-value=0  Score=626.09  Aligned_cols=345  Identities=22%  Similarity=0.305  Sum_probs=311.8

Q ss_pred             EEEEECCCCCHHHHHHHCCCCHHHHHHHHHHHHCCCCHHHCCCCCEEEEEECCCCCCCEEEEEEECCCCCEEEEEEECCC
Q ss_conf             36884179708999997499989999999985401561016998889999727888640589997168834899984278
Q gi|254780879|r  277 DLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDN  356 (652)
Q Consensus       277 ~~v~VK~GDTL~~IL~r~Gvs~~ei~~i~~al~~~~~~~~Lr~Gq~L~I~~~~~~~~~~~~r~si~~~~~~~~~va~~d~  356 (652)
                      ..++||+||||++||+++|++.+++.+++++.++..++++|++||.|.|.++..+   ++..+.+.........+.+.+.
T Consensus         8 i~Y~Vk~GDTL~~Ia~r~gvs~~~i~~i~~~~~~~~~~~~L~~Gq~l~i~~~~~~---~l~~l~~~~s~~~~~~~~~~~~   84 (361)
T 2gu1_A            8 IHYMVKVGDTLSGIFAQLGVPYSILQKILSVDLDHLQLDMIQPGEELELMMDDMG---QLSRLIYHMSIVEKAIYTREND   84 (361)
T ss_dssp             EEEECCTTCCHHHHHHHTTCCHHHHHHHHHHGGGTCCGGGCCTTCEEEEEECTTS---CEEEEEEEEETTEEEEEEECTT
T ss_pred             EEEEECCCCCHHHHHHHCCCCHHHHHHHHHHCCCCCCHHHCCCCCEEEEEECCCC---CEEEEEEECCCCEEEEEEECCC
T ss_conf             6899899985999998859799999999873704574621799998999989999---7468999538760699994056


Q ss_pred             CCEEECCCCCCCHHHCCCCCCCCCCCCCCCCHHHHHHHHHCCCCHHHHHHHHHHHCCCCHHHHHCCCCCEEEEEEEEECC
Q ss_conf             84320133321000001221112334542110256668871999899999999730111012101445406887532115
Q gi|254780879|r  357 NEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHA  436 (652)
Q Consensus       357 g~fv~~~ep~~~~~~~~~~~~~~~~~~~~I~~SLy~aa~~~gip~~ii~~lv~i~a~dVDFqr~ir~GD~f~Vlye~~~~  436 (652)
                      +.|.....       ............+.|.+|||.++.++|+|..++.+++++++|++||++++++||+|++.|+....
T Consensus        85 ~~~~~~~~-------~~~~~~~~~~~~g~I~~SL~~~a~~~gl~~~~~~~l~~i~~~~Id~~~~i~~gd~~~i~~e~~~~  157 (361)
T 2gu1_A           85 GSFSYDFQ-------EISGEWREILFSGEINGSFSVSARRVGLTSSQVANITQVMKDKIDFSRSLRAGDRFDILVKQQYL  157 (361)
T ss_dssp             SCEEEEEE-------ECCCEEEEEEEEEESSSCHHHHHHHTTCCHHHHHHHHHHHTTTCCTTTCCCC-CEEEEEEEEEEE
T ss_pred             CCCEEEEC-------CCCCCCEEEEEEEEECCCCCHHHHHCCCCHHHHHHHHHHCCCCCCHHHHCCCCCEEEEECCCEEC
T ss_conf             74112202-------23442003677545536400111103753455555554213645522313579889984010010


Q ss_pred             CCCCCCCCCEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCCCCC--CCCCCCCCCCC-CCCCCCCCCC
Q ss_conf             78512467236889623885420134557665544433556610000011233345--41023567641-4340443464
Q gi|254780879|r  437 NNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPF--GRMTSGFGMRY-HPILGYSRMH  513 (652)
Q Consensus       437 ~g~~~~~geil~A~~~~~g~~~~~yrf~~~~~~~~~yyd~~G~S~~k~llr~Pv~~--~risS~Fg~R~-hPilg~~r~H  513 (652)
                      +++....++++.+.+...++....|++.+     ..|||.+|++.++.++++|+..  .||+|+||+|+ ||++|+++||
T Consensus       158 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~yd~~G~s~~~~~~~~P~~~~~~risS~fg~r~~~~~~~~~~~H  232 (361)
T 2gu1_A          158 GEHNTGNSEIKAISFKLAKGDVSAFLAED-----GRFYDRAGNSLERAFNRYPVDKAYRQITSGFNPKRKHPVTGRVVPH  232 (361)
T ss_dssp             TTEEEEEEEEEEEEEECTTCCEEEEECTT-----SCEEETTSCBSSCCCCSCSSCGGGCCEEECCBTTCBCTTTCCBCCB
T ss_pred             CCCCCCCCCEEEEEEECCCCCEEEEEECC-----CCEECCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             66522332023456522786135675035-----6421477740111122101113344444545653353314641014


Q ss_pred             CCEEECCCCCCCEEECCCCEEEEEEEECCCCCEEEEECCCCEEEEEHHHHHHHHCCCCCCEEECCCEEEEECCCCCCCCC
Q ss_conf             20030267967279715967999653089700799983997488200214454118899788349589984166788874
Q gi|254780879|r  514 TGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGP  593 (652)
Q Consensus       514 ~GVD~aAp~GTPI~Aag~G~V~~ag~~~GyGn~V~I~H~~Gy~T~YaHlS~~a~gV~~G~~V~qGQvIG~vGsTG~STGP  593 (652)
                      +||||+||+||||+|+++|+|+++||++||||+|+|+|+|||+|+|||||+|+  |++||+|+|||+||||||||+||||
T Consensus       233 ~GiDiaa~~GtpV~Aa~~G~V~~ag~~~gyGn~V~I~H~~g~~T~YaHls~~~--V~~G~~V~~Gq~Ig~vG~TG~stgp  310 (361)
T 2gu1_A          233 NGTDFATPIGAPVYSTGDGKVIVVRKHPYAGNYLVIEHNSVYKTRYLHLDKIL--VKKGQLVKRGQKIALAGATGRLTGP  310 (361)
T ss_dssp             CSEEECCCTTCEEECSSSEEEEEEEEETTTEEEEEEECSSSEEEEEEEESEEC--CCTTCEECTTCEEEECCCCSSCSSC
T ss_pred             CCEEEECCCCCCEEEEEEEEEEEEEECCCCCCEEEEECCCCEEEEEECCCCCC--CCCCCEECCCCEEEEECCCCCCCCC
T ss_conf             41576447797202130368999986478887589987998599984451113--3889999979999987688998986


Q ss_pred             EEEEEEEECCEECCCCEECCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             268899786788366200078878788899999999999999998
Q gi|254780879|r  594 HLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLL  638 (652)
Q Consensus       594 HLHfEv~vnG~~VdP~~~~lp~~~~l~~~~l~~F~~~~~~id~ll  638 (652)
                      ||||||++||++||||+++||.+++|++++|++|++++++||.--
T Consensus       311 hLHFEvr~~g~~vdPl~~~~p~~~~l~~~~~~~f~~~~~~~~~~~  355 (361)
T 2gu1_A          311 HLHFEVLVRNRPVDAMKADLPIAKSLSSNQKTSFLARVSEFDHEG  355 (361)
T ss_dssp             CEEEEEEETTEEECTTCSSCC------------------------
T ss_pred             EEEEEEEECCEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             789999989989699635788988789899999999999986136


No 2  
>2hsi_A Putative peptidase M23; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.90A {Pseudomonas aeruginosa PAO1}
Probab=100.00  E-value=1.5e-40  Score=302.65  Aligned_cols=125  Identities=34%  Similarity=0.568  Sum_probs=119.5

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCEEECCCCEEEEEEEECCCCCEEEEECCCCEEEEEHHHH
Q ss_conf             01123334541023567641434044346420030267967279715967999653089700799983997488200214
Q gi|254780879|r  484 FLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQD  563 (652)
Q Consensus       484 ~llr~Pv~~~risS~Fg~R~hPilg~~r~H~GVD~aAp~GTPI~Aag~G~V~~ag~~~GyGn~V~I~H~~Gy~T~YaHlS  563 (652)
                      ..+.+|+.+ +++|+||.|||+..+...+|.||||+++.||||+|+.+|+|+++||..+|||+|+|+|++||.|.|+|||
T Consensus       152 ~~~~~Pv~G-~it~~fG~~r~~~~~~~~~h~GiDi~~~~gt~V~A~~~G~V~~~~~~~~~G~~v~i~hg~g~~t~Y~hls  230 (282)
T 2hsi_A          152 LMLDKPVDG-PLSSPFGLRRFFNGEERNPHSGLDFAVPAGTPIKAPAAGKVILIGDYFFNGKTVFVDHGQGFISMFCHLS  230 (282)
T ss_dssp             SSCCCSSSS-CBCSCC------------CCCSEEECCCTTCEEECSSCEEEEEEEEETTTEEEEEEEEETTEEEEEEEES
T ss_pred             CCCCCCCCC-CEECCCCCEECCCCCCCCCCCEEEEECCCCCCEEEEEEEEEEECCCCCCCCCEEEEECCCCEEEEECCCC
T ss_conf             665478636-6867987538788877874012599748997274057127474135687980999986997799963636


Q ss_pred             HHHHCCCCCCEEECCCEEEEECCCCCCCCCEEEEEEEECCEECCCCEE
Q ss_conf             454118899788349589984166788874268899786788366200
Q gi|254780879|r  564 AIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKV  611 (652)
Q Consensus       564 ~~a~gV~~G~~V~qGQvIG~vGsTG~STGPHLHfEv~vnG~~VdP~~~  611 (652)
                      ++.  |++||+|++||+||+||+||++|||||||||++||++|||+..
T Consensus       231 ~i~--V~~G~~V~~G~~IG~vG~tg~~tGphLhfei~~~g~~vdP~~~  276 (282)
T 2hsi_A          231 KID--VKLGQQVPRGGVLGKVGATGRATGPHMHWNVSLNDARVDPAIF  276 (282)
T ss_dssp             EEC--SCTTCEECTTCEEEECCCTTTCSSCCEEEEEEETTEEECHHHH
T ss_pred             CCC--CCCCCEECCCCEEEEECCCCCCCCCEEEEEEEECCEEECHHHH
T ss_conf             035--3879999989979974589999986799999999999895997


No 3  
>3nyy_A Putative glycyl-glycine endopeptidase LYTM; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE 2PE SO4; 1.60A {Ruminococcus gnavus}
Probab=100.00  E-value=1.1e-41  Score=310.60  Aligned_cols=205  Identities=18%  Similarity=0.278  Sum_probs=165.3

Q ss_pred             HHHHHHHHHCCCCHHHHHCCCCCEEEEEEEEECCCCCCCCCCCEEEEEEE-------CCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99999997301110121014454068875321157851246723688962-------38854201345576655444335
Q gi|254780879|r  403 LVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHAR-------FGETRTRFYRFLNPVDGSVEYFN  475 (652)
Q Consensus       403 ii~~lv~i~a~dVDFqr~ir~GD~f~Vlye~~~~~g~~~~~geil~A~~~-------~~g~~~~~yrf~~~~~~~~~yyd  475 (652)
                      .++++.+.+.+++||+ +++.+|+|.++|+.....++.+.. .++.+.+.       ...+.+....+....+....||+
T Consensus         4 ~~~~l~~~~~~~~dfr-~~~~~d~~~~~~~~~~~~g~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   81 (252)
T 3nyy_A            4 GFQRLQKPVVSQPDFR-RQPVSETMQVYLKQAADPGRDVGL-YWMATDFENRRFPGKVSPSGFQKLYRQWRNQTGWDAYV   81 (252)
T ss_dssp             HHHHHTSCSTTSHHHH-HCCCCHHHHHHHTTCSSHHHHHHH-HHHHHTTTTSCCCSCSSHHHHHHHHHHHTTSTTHHHHH
T ss_pred             HHHHHHHHHCCCCCHH-HCCCCCEEEEEEEHHHHCCCCHHH-EEEHHHHCCCCCCEECCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             7888877642360223-227798776431003105882210-11002313344530204045788887664112455665


Q ss_pred             CCCCCHHHCCCCCCCCCCCCCCCC------CCCCCCCCCCCCCCCCEEECCCCCC----CEEECCCCEEEEEEEECCCCC
Q ss_conf             566100000112333454102356------7641434044346420030267967----279715967999653089700
Q gi|254780879|r  476 ENGKSSRPFLLRTPVPFGRMTSGF------GMRYHPILGYSRMHTGVDWAAPRGT----PIVAVGDGIVEKANWAGGYGK  545 (652)
Q Consensus       476 ~~G~S~~k~llr~Pv~~~risS~F------g~R~hPilg~~r~H~GVD~aAp~GT----PI~Aag~G~V~~ag~~~GyGn  545 (652)
                      ..+++..+.++..|+++.++++.+      +++.|+.+|..|+|.||||+||.||    ||+|++||+|+++||.++|||
T Consensus        82 ~~~~~~~~~~~~~P~~~~~~~~~~~~~~~~~~~~~r~~g~~r~H~GiDi~a~~Gt~~~~PV~A~~dG~V~~~g~~~~~G~  161 (252)
T 3nyy_A           82 QSCRAIWNDVKYFPIPQSLDDTEDKISYVDSWMFERNYGGKRGHEGTDIMAEKNTPGYYPVVSMTDGVVTEKGWLEKGGW  161 (252)
T ss_dssp             HHHHHHHTTCCSCSSCEESSSSCCCEECCCCHHHHHTTCSCTTCCCEEEEESSCCTTCSEEECSSCEEEEEEEEETTTEE
T ss_pred             HHHHHHHHHCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCEEEEEECEEEEEEEECCCCCE
T ss_conf             51145542101565787666778885201788877889779860789955789986665489965679998557499980


Q ss_pred             EEEEECCCCEEEEEHHHHHHHHCCCCCCEEECCCEEEEECCCCC----CCC---CEEEEEEEECC----EECCCCE
Q ss_conf             79998399748820021445411889978834958998416678----887---42688997867----8836620
Q gi|254780879|r  546 QTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGL----STG---PHLHYELIVNG----IKVDSTK  610 (652)
Q Consensus       546 ~V~I~H~~Gy~T~YaHlS~~a~gV~~G~~V~qGQvIG~vGsTG~----STG---PHLHfEv~vnG----~~VdP~~  610 (652)
                      +|+|+|++|+.|.|+||++++ .|++|++|++||+||+||+||.    +||   |||||||++++    .+|||+.
T Consensus       162 ~V~I~h~~g~~t~Y~HL~~~~-~V~~G~~V~~Gq~IG~vG~TG~~~~~stg~~~pHLHfev~~~~~~~~~~vdP~~  236 (252)
T 3nyy_A          162 RIGITAPTGAYFYYAHLDSYA-ELEKGDPVKAGDLLGYMGDSGYGEEGTTGEFPVHLHLGIYLKEGTEEISVNPYP  236 (252)
T ss_dssp             EEEEECTTSCEEEEEEESEEC-SCCTTCEECTTCEEEECBCCCSSSTTCCCSSCCEEEEEEEEEETTEEEEECCHH
T ss_pred             EEEEEECCCCEEEEEECCCCC-CCCCCCEECCCCEEEEECCCCCCCCCCCCCCCCEEEEEEEECCCCCCEEECCHH
T ss_conf             999996898889851356555-568899998689999825777889887898898789999989987754708799


No 4  
>1qwy_A Peptidoglycan hydrolase; LYTM lysostaphin metalloprotease asparagine switch; 1.30A {Staphylococcus aureus subsp} SCOP: b.84.3.2 PDB: 2b0p_A 2b13_A* 2b44_A
Probab=100.00  E-value=3.8e-35  Score=264.55  Aligned_cols=121  Identities=31%  Similarity=0.528  Sum_probs=108.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCEEECCCCEEEEEEEE-CCCCCEEEEECCCC-EEEEEHHH
Q ss_conf             11233345410235676414340443464200302679672797159679996530-89700799983997-48820021
Q gi|254780879|r  485 LLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWA-GGYGKQTLIHHGNG-YVSSYNHQ  562 (652)
Q Consensus       485 llr~Pv~~~risS~Fg~R~hPilg~~r~H~GVD~aAp~GTPI~Aag~G~V~~ag~~-~GyGn~V~I~H~~G-y~T~YaHl  562 (652)
                      -++||+.+ ++.++||..|.     .++|.||||++|.||||+|+.+|+|+++||. .||||+|+|+|.++ +.|.|+||
T Consensus       163 ~~~wp~~g-~~~~~fG~~rg-----G~~H~GIDi~a~~GtpV~A~~dG~Vv~~g~~~~g~G~~ViI~h~~g~~~t~Y~HL  236 (291)
T 1qwy_A          163 DASWLTSR-KQLQPYGQYHG-----GGAHYGVDYAMPENSPVYSLTDGTVVQAGWSNYGGGNQVTIKEANSNNYQWYMHN  236 (291)
T ss_dssp             SCHHHHTS-CEEECSEECTT-----SSEECSEEEECCTTCEEECSSSEEEEEEEEETTTTEEEEEEEETTSSEEEEEEEE
T ss_pred             CCCCCCCC-CCCCCCCCCCC-----CCCEEEEEECCCCCCEEEECCCEEEEEEEECCCCCCEEEEEEECCCCEEEEEEEC
T ss_conf             42056678-65588688897-----9965838858899996980128799998874678986999984899889997878


Q ss_pred             HHHHHCCCCCCEEECCCEEEEECCCCCCCCCEEEEEEEECC----EECCCCEECCC
Q ss_conf             44541188997883495899841667888742688997867----88366200078
Q gi|254780879|r  563 DAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNG----IKVDSTKVRIP  614 (652)
Q Consensus       563 S~~a~gV~~G~~V~qGQvIG~vGsTG~STGPHLHfEv~vnG----~~VdP~~~~lp  614 (652)
                      +++.  |++||+|++||+||+||+||.||||||||||+.+|    ++|||+.. |+
T Consensus       237 ~~i~--Vk~Gq~V~~Gq~IG~vG~TG~stgpHLHFEI~~~g~~~~~~VDP~~~-L~  289 (291)
T 1qwy_A          237 NRLT--VSAGDKVKAGDQIAYSGSTGNSTAPHVHFQRMSGGIGNQYAVDPTSY-LQ  289 (291)
T ss_dssp             SEEC--CCTTCEECTTCEEEECCCCSSCSSSEEEEEEEESEESGGGEECCHHH-HC
T ss_pred             CCCC--CCCCCEECCCCEEEEECCCCCCCCCEEEEEEEECCCCCCEECCCHHH-HH
T ss_conf             8256--68889999789999868889989866899999899179877286997-01


No 5  
>3it5_A Protease LASA; metallopeptidase, beta-protein, cell membrane, cell outer membrane, hydrolase, membrane, metal-binding; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 3it7_A*
Probab=99.97  E-value=2.7e-30  Score=230.43  Aligned_cols=111  Identities=26%  Similarity=0.354  Sum_probs=100.4

Q ss_pred             CCCCCCCCCCCCCCEEEC------CCCCCCEEECCCCEEEEEEEECCCCCEEEEECCCCEEEEEHHHHHHHHCCCCCCEE
Q ss_conf             414340443464200302------67967279715967999653089700799983997488200214454118899788
Q gi|254780879|r  502 RYHPILGYSRMHTGVDWA------APRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAV  575 (652)
Q Consensus       502 R~hPilg~~r~H~GVD~a------Ap~GTPI~Aag~G~V~~ag~~~GyGn~V~I~H~~Gy~T~YaHlS~~a~gV~~G~~V  575 (652)
                      +.|+..+..++|.|+|++      ++.|+||+|+.+|+|++++     ||+|+|+|++||.|.|+||++|.  |++||+|
T Consensus        21 g~~~~~g~~~~~~g~d~~~g~~~~a~~g~~V~a~~~G~V~~~~-----G~~V~I~H~~G~~t~Y~Hl~~~~--V~~G~~V   93 (182)
T 3it5_A           21 GAHSNTGSGYPYSSFDASYDWPRWGSATYSVVAAHAGTVRVLS-----RCQVRVTHPSGWATNYYHMDQIQ--VSNGQQV   93 (182)
T ss_dssp             CCBCTTSSSSSCCEEEEESSCCCTTSCCCEEECSSSEEEEEEE-----TTEEEEECTTSEEEEEESEESCC--CCTTCEE
T ss_pred             CCCCCCCCCCCCCCEEECCCCCEECCCCCEEEEEECCCEEEEC-----CCEEEEEECCCCEEEEECCEECC--CCCCCEE
T ss_conf             8576089686127786267886360799979997468779989-----84999993898389864240126--7689899


Q ss_pred             ECCCEEEEEC--------CCCCCCCCEEEEEEEECCEECCCCEECCCCCCCC
Q ss_conf             3495899841--------6678887426889978678836620007887878
Q gi|254780879|r  576 KQGQIIGWIG--------TTGLSTGPHLHYELIVNGIKVDSTKVRIPERENL  619 (652)
Q Consensus       576 ~qGQvIG~vG--------sTG~STGPHLHfEv~vnG~~VdP~~~~lp~~~~l  619 (652)
                      ++||+||++|        +||+||||||||||++||++|||+...++.-+-.
T Consensus        94 ~~Gq~IG~~g~~~~~~~g~tG~stgpHLHfei~~~g~~v~~~~~~~~~~~~~  145 (182)
T 3it5_A           94 SADTKLGVYAGNINTALCEGGSSTGPHLHFSLLYNGAFVSLQGASFGPYRIN  145 (182)
T ss_dssp             CTTCEEEEECSSHHHHTTTSCCCSSSCEEEEEEETTEECCCTTCEETTEEEE
T ss_pred             ECCCEEEEECCCCCCCCCCCCCCCCCEEEEEEEECCEEECCCCCCCCCEEEE
T ss_conf             4772882753766652147776588888999998998969798645881562


No 6  
>3csq_A Morphogenesis protein 1; hydrolase, infection, late protein; 1.80A {Bacteriophage phi-29}
Probab=99.94  E-value=1e-27  Score=212.28  Aligned_cols=119  Identities=21%  Similarity=0.223  Sum_probs=94.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCC----CCCEEECCCCEEEEEEEECCC---CCEEEEECCCCEE-
Q ss_conf             11233345410235676414340443464200302679----672797159679996530897---0079998399748-
Q gi|254780879|r  485 LLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPR----GTPIVAVGDGIVEKANWAGGY---GKQTLIHHGNGYV-  556 (652)
Q Consensus       485 llr~Pv~~~risS~Fg~R~hPilg~~r~H~GVD~aAp~----GTPI~Aag~G~V~~ag~~~Gy---Gn~V~I~H~~Gy~-  556 (652)
                      ++..|....+++++++.+        +.|.|+|++++.    ||||+|+.||+|+++++.++|   |++++|.|.+|.. 
T Consensus       168 ~~~~~~~~~~~~~~~~~~--------~~H~g~d~~~~~~~~~~~pv~A~~~G~V~~~~~~~~~~~~~~~~~i~~~~g~~~  239 (334)
T 3csq_A          168 LAQFPMDIINISQGENGS--------FSHKGTLCIDFVGKTEKYPYYAPCDCTCVWRGDASAYLAWTSDKEVMCADGSVR  239 (334)
T ss_dssp             BCBCSSSEEEEEECTTCT--------TTCTTSCCEEECCSSSSCEEECSSSEEEEEEETTTTEEEEEESSCEECTTSCEE
T ss_pred             CCCCCCCCCEEECCCCCC--------CCCCCEEEEECCCCCCCCCEEECCCEEEEEEEECCCCCCCCCEEEEEECCCCEE
T ss_conf             688888886486079999--------887783614127998998589789989999972687553178699997899805


Q ss_pred             -EEEHHHHHHHHCCCCCCEEECCCEEEEECCCCCCCCCEEEEEEEECCEECCCCEE
Q ss_conf             -8200214454118899788349589984166788874268899786788366200
Q gi|254780879|r  557 -SSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKV  611 (652)
Q Consensus       557 -T~YaHlS~~a~gV~~G~~V~qGQvIG~vGsTG~STGPHLHfEv~vnG~~VdP~~~  611 (652)
                       +.|.||+.....|++||+|++||+||+||+||+||||||||||+++..+..-++.
T Consensus       240 ~~~y~~~~~~~~~v~~G~~V~~G~~ig~~G~tG~stgpHLHfev~~g~~~~~~~~~  295 (334)
T 3csq_A          240 YITWVNVHESPLPFDVGKKLKKGDLMGHTGIGGNVTGDHWHFNVIDGKEYQGWTKK  295 (334)
T ss_dssp             CEEEEEECCSSCCCCTTCEECTTSEEEECBCCC----CBEEEEEEESSCCCCEEES
T ss_pred             EEEEEEECCCCCCCCCCCEECCCCEEEEECCCCCCCCCEEEEEEEECCCCCCCCCC
T ss_conf             99999734464568889897689779975789988998789999989844772337


No 7  
>2djp_A Hypothetical protein SB145; LYSM, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=97.77  E-value=4.3e-05  Score=53.11  Aligned_cols=51  Identities=10%  Similarity=0.070  Sum_probs=43.9

Q ss_pred             EEEEEECCCCCHHHHHHHCCCCHHHHHHHHHHHHCCCCHHHCCCCCEEEEEECCC
Q ss_conf             1368841797089999974999899999999854015610169988899997278
Q gi|254780879|r  276 DDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQK  330 (652)
Q Consensus       276 e~~v~VK~GDTL~~IL~r~Gvs~~ei~~i~~al~~~~~~~~Lr~Gq~L~I~~~~~  330 (652)
                      ...|+|++||||++|.++||++.+++.++    |+..+.+.|++||.|.|+....
T Consensus        15 ~~~h~V~~GDTL~~IA~~y~v~~~~i~~~----N~l~~~~~l~~G~~L~IP~~~~   65 (77)
T 2djp_A           15 RLEHQLEPGDTLAGLALKYGVTMEQIKRA----NRLYTNDSIFLKKTLYIPILTE   65 (77)
T ss_dssp             EEEECCCTTCCHHHHHHHHTCCHHHHHHH----HTCCCSSCGGGSSCEEEEEECC
T ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHHHHH----CCCCCCCCCCCCCEEEECCCCC
T ss_conf             77989899999999999988899999987----5999977676399999736898


No 8  
>1e0g_A Membrane-bound lytic murein transglycosylase D; cell WALL, hydrolase, glycosidase, lipoprotein, outer membrane, multigene family; NMR {Escherichia coli} SCOP: d.7.1.1
Probab=97.47  E-value=8.7e-05  Score=50.99  Aligned_cols=45  Identities=11%  Similarity=0.132  Sum_probs=37.9

Q ss_pred             EEEEECCCCCHHHHHHHCCCCHHHHHHHHHHHHCCCCHHHCCCCCEEEEEE
Q ss_conf             368841797089999974999899999999854015610169988899997
Q gi|254780879|r  277 DLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGV  327 (652)
Q Consensus       277 ~~v~VK~GDTL~~IL~r~Gvs~~ei~~i~~al~~~~~~~~Lr~Gq~L~I~~  327 (652)
                      ..|+|++||||++|+.+||++.+++.++    |+..  +.|++||.|+|++
T Consensus         3 v~y~V~~GDTl~~IA~~y~vs~~~i~~~----N~l~--~~i~~Gq~L~i~v   47 (48)
T 1e0g_A            3 ITYRVRKGDSLSSIAKRHGVNIKDVMRW----NSDT--ANLQPGDKLTLFV   47 (48)
T ss_dssp             CEEEECTTCCHHHHHHHHTCCHHHHHHH----CSCG--GGCCTTEEEECCC
T ss_pred             EEEEECCCCCHHHHHHHHCCCHHHHHHH----CCCC--CCCCCCCEEEEEE
T ss_conf             7999899999999999989689999986----5994--5588799999986


No 9  
>2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1
Probab=94.89  E-value=0.023  Score=33.92  Aligned_cols=84  Identities=14%  Similarity=0.117  Sum_probs=56.5

Q ss_pred             CCCCCCCCCCCEEECCCCCCCEEECCCCEEEEEEE-------ECCCCCEEEEECCCCEEEEEHHHHHHHHCCCCCCEEEC
Q ss_conf             34044346420030267967279715967999653-------08970079998399748820021445411889978834
Q gi|254780879|r  505 PILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANW-------AGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQ  577 (652)
Q Consensus       505 Pilg~~r~H~GVD~aAp~GTPI~Aag~G~V~~ag~-------~~GyGn~V~I~H~~Gy~T~YaHlS~~a~gV~~G~~V~q  577 (652)
                      |++-..-|=.|+-+- |.+--|+|.-||+|...-+       ....|--|.|.-  |.-|.-.+-..|-.-|++||+|++
T Consensus        27 ~vFs~k~mG~G~aI~-P~~~~v~AP~dG~V~~i~~T~HAigi~t~~G~eiLIHi--GidTV~L~G~gF~~~v~~Gd~V~~  103 (154)
T 2gpr_A           27 EVFKERMLGDGFAIN-PKSNDFHAPVSGKLVTAFPTKHAFGIQTKSGVEILLHI--GLDTVSLDGNGFESFVTQDQEVNA  103 (154)
T ss_dssp             HHHHTTSSCEEEEEE-ESSSEEECSSCEEEEECCTTCSEEEEECTTSCEEEEEC--SSSGGGGTTCSEEECCCTTCEECT
T ss_pred             HHHCCCCCCCEEEEE-CCCCEEECCCCCEEEEECCCCCEEEEECCCCCEEEEEE--CCCHHHCCCCCEEEEECCCCEECC
T ss_conf             363568801629999-27997992678299998689979999969998999997--625410389736999738999959


Q ss_pred             CCEEEEECC-----CCCCC
Q ss_conf             958998416-----67888
Q gi|254780879|r  578 GQIIGWIGT-----TGLST  591 (652)
Q Consensus       578 GQvIG~vGs-----TG~ST  591 (652)
                      ||.|..+--     -|+++
T Consensus       104 G~~L~~~D~~~i~~~g~~~  122 (154)
T 2gpr_A          104 GDKLVTVDLKSVAKKVPSI  122 (154)
T ss_dssp             TCEEEEECHHHHHHHSSCC
T ss_pred             CCEEEEECHHHHHHCCCCC
T ss_conf             9999998799998629998


No 10 
>1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A
Probab=93.72  E-value=0.088  Score=29.84  Aligned_cols=95  Identities=15%  Similarity=0.117  Sum_probs=62.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCEEECCCCEEEEEEEECCCCCEEEEECCC--------CEE
Q ss_conf             112333454102356764143404434642003026796727971596799965308970079998399--------748
Q gi|254780879|r  485 LLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGN--------GYV  556 (652)
Q Consensus       485 llr~Pv~~~risS~Fg~R~hPilg~~r~H~GVD~aAp~GTPI~Aag~G~V~~ag~~~GyGn~V~I~H~~--------Gy~  556 (652)
                      -+.+|+.+..+.-.  .=-+|++-..-|=.|+=+-. .+--|+|..||+|...-+.   |..+-|+..|        |..
T Consensus        14 ~v~APv~G~vi~L~--~v~D~vFs~~~~G~G~AI~P-~~~~v~AP~dG~I~~i~~T---~HAigi~t~~G~eiLiHiGid   87 (161)
T 1f3z_A           14 EIIAPLSGEIVNIE--DVPDVVFAEKIVGDGIAIKP-TGNKMVAPVDGTIGKIFET---NHAFSIESDSGVELFVHFGID   87 (161)
T ss_dssp             EEECSSCEEEEEGG--GSSSHHHHTTSSCEEEEEEE-CSSEEECSSSEEEEEECTT---SSEEEEEETTSCEEEEECSBS
T ss_pred             EEEECCCCEEEECC--CCCCHHHHCCCCCCEEEEEC-CCCEEEECCCEEEEEECCC---CCEEEEEECCCCEEEEEECCC
T ss_conf             99963672798833--09885882678126299983-6998990789799998689---979999948998999997645


Q ss_pred             EEEHHHHHHHHCCCCCCEEECCCEEEEEC
Q ss_conf             82002144541188997883495899841
Q gi|254780879|r  557 SSYNHQDAIAKNIKAGTAVKQGQIIGWIG  585 (652)
Q Consensus       557 T~YaHlS~~a~gV~~G~~V~qGQvIG~vG  585 (652)
                      |...+-..|-.-+++||+|++||.|..+=
T Consensus        88 Tv~l~G~gF~~~vk~Gd~V~~G~~L~~~D  116 (161)
T 1f3z_A           88 TVELKGEGFKRIAEEGQRVKVGDTVIEFD  116 (161)
T ss_dssp             GGGGTTTTEEECSCTTCEECTTCEEEEEC
T ss_pred             HHHCCCCCEEEEECCCCEEECCCEEEEEC
T ss_conf             77618974089976899993898989987


No 11 
>1ax3_A Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} SCOP: b.84.3.1 PDB: 1gpr_A
Probab=93.64  E-value=0.079  Score=30.17  Aligned_cols=83  Identities=13%  Similarity=0.080  Sum_probs=57.5

Q ss_pred             CCCCCCCCCCCEEECCCCCCCEEECCCCEEEEEEEECCCCCEEEEECCCC--------EEEEEHHHHHHHHCCCCCCEEE
Q ss_conf             34044346420030267967279715967999653089700799983997--------4882002144541188997883
Q gi|254780879|r  505 PILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNG--------YVSSYNHQDAIAKNIKAGTAVK  576 (652)
Q Consensus       505 Pilg~~r~H~GVD~aAp~GTPI~Aag~G~V~~ag~~~GyGn~V~I~H~~G--------y~T~YaHlS~~a~gV~~G~~V~  576 (652)
                      |++-..-|=.|+-+- |.+--|+|..||+|...-.   -+..+-|+..||        ..|.-.+-..|..-|++||+|+
T Consensus        32 ~vFs~~~mG~G~aI~-P~~~~v~AP~~G~V~~v~~---T~HAigi~t~~G~evLiHiGiDTV~L~G~gF~~~V~~Gd~V~  107 (162)
T 1ax3_A           32 QVFSGKMMGDGFAIL-PSEGIVVSPVRGKILNVFP---TKHAIGLQSDGGREILIHFGIDTVSLKGEGFTSFVSEGDRVE  107 (162)
T ss_dssp             HHHHTCTTSEEEEEE-ECSSEEEESCCEEEEECCS---SSSEEEEESSSSCEEEEECSSSTTTTTTTTEEESCCCCSEEC
T ss_pred             HHHCCCCCCCCEEEE-CCCCEEECCCCEEEEEECC---CCCEEEEECCCCCEEEEEECCCHHHCCCCCEEEEECCCCEEC
T ss_conf             463467802748998-2799798378969999856---896999997999799999864543218983189982699998


Q ss_pred             CCCEEEEEC-----CCCCCC
Q ss_conf             495899841-----667888
Q gi|254780879|r  577 QGQIIGWIG-----TTGLST  591 (652)
Q Consensus       577 qGQvIG~vG-----sTG~ST  591 (652)
                      +||.|..+=     .-|+++
T Consensus       108 ~G~~L~~~D~~~i~~~g~~~  127 (162)
T 1ax3_A          108 PGQKLLEVDLDAVKPNVPSL  127 (162)
T ss_dssp             SEEEEEEECHHHHGGGSSCC
T ss_pred             CCCEEEEECHHHHHHCCCCC
T ss_conf             99999997599998629998


No 12 
>1ci3_M Protein (cytochrome F); electron transfer protein, complex subunit, electron transport; HET: HEM; 1.90A {Phormidium laminosum} SCOP: b.2.6.1 b.84.2.2 PDB: 1tu2_B*
Probab=92.75  E-value=0.12  Score=28.92  Aligned_cols=62  Identities=13%  Similarity=0.115  Sum_probs=47.8

Q ss_pred             CCCCCCEEECCCCEEEEEEEECCCCCEEEEECCCCEEEEEHHHHHHHHCCCCCCEEECCCEE
Q ss_conf             67967279715967999653089700799983997488200214454118899788349589
Q gi|254780879|r  520 APRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQII  581 (652)
Q Consensus       520 Ap~GTPI~Aag~G~V~~ag~~~GyGn~V~I~H~~Gy~T~YaHlS~~a~gV~~G~~V~qGQvI  581 (652)
                      -|--+.+.|..+|+|........-++.|.|.-.+|-...|.=-..-.--|+.|+.|+.||.+
T Consensus       166 KsNN~a~~AevsG~Vs~I~~~ekG~~~I~I~t~dGe~v~y~IP~G~~L~V~eGd~VkaGq~L  227 (249)
T 1ci3_M          166 KSNNAVYNASAAGVITAIAKADDGSAEVKIRTEDGTTIVDKIPAGPELIVSEGEEVAAGAAL  227 (249)
T ss_dssp             BCSSSCCBCSSCEEEEEEEECTTSCEEEEEECTTSCEEEEEECSSSCBCCCTTCEECTTCBS
T ss_pred             CCCCCEEECCCCEEEEEEEECCCCCEEEEEECCCCCEEEEECCCCCEEEECCCCEEECCCCC
T ss_conf             57885076436759988487279988999989999799997699981577789998089842


No 13 
>1y7m_A Hypothetical protein BSU14040; surface mutagenesis, cysteine proteases, cell WALL catabolism, structural genomics, PSI; 2.05A {Bacillus subtilis subsp} SCOP: b.160.1.1 d.7.1.1
Probab=92.46  E-value=0.025  Score=33.72  Aligned_cols=45  Identities=11%  Similarity=0.077  Sum_probs=35.3

Q ss_pred             EEEECCCCCHHHHHHHCCCCHHHHHHHHHHHHCCCCHHHCCCCCEEEEEE
Q ss_conf             68841797089999974999899999999854015610169988899997
Q gi|254780879|r  278 LIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGV  327 (652)
Q Consensus       278 ~v~VK~GDTL~~IL~r~Gvs~~ei~~i~~al~~~~~~~~Lr~Gq~L~I~~  327 (652)
                      .++||+||||.+|+++++++..++.++    |...+ ..|++|+.+.++.
T Consensus         3 ~y~V~~GdtL~~IA~~f~~~~~~l~~~----Np~~~-~~L~~G~~i~vP~   47 (164)
T 1y7m_A            3 TYQVKQGDTLNSIAADFRISTAALLQA----NPSLQ-AGLTAGQSIVIPG   47 (164)
T ss_dssp             EEECCTTCCHHHHHHHTTSCCCCCCCT----SCTTC-SSCCTTCEEEETT
T ss_pred             EEEECCCCCHHHHHHHHCCCHHHHHHH----CCCCC-CCCCCCCEEECCC
T ss_conf             999899997999998869899999975----87876-6658885132012


No 14 
>2jxm_B Cytochrome F; copper, electron transport, metal-binding, transport; HET: HEC; NMR {Prochlorothrix hollandica} SCOP: i.4.1.1
Probab=92.27  E-value=0.1  Score=29.37  Aligned_cols=62  Identities=16%  Similarity=0.216  Sum_probs=47.5

Q ss_pred             CCCCCCCEEECCCCEEEEEEEECCCCCEEEEECCCCEEEEEHHHHHHHHCCCCCCEEECCCEE
Q ss_conf             267967279715967999653089700799983997488200214454118899788349589
Q gi|254780879|r  519 AAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQII  581 (652)
Q Consensus       519 aAp~GTPI~Aag~G~V~~ag~~~GyGn~V~I~H~~Gy~T~YaHlS~~a~gV~~G~~V~qGQvI  581 (652)
                      .-|.-+.+.|..+|+|.+. +...-|+.|.|.-.+|-...|.=...-.--|+.||.|+.||.+
T Consensus       166 ~KsnN~a~~Ae~aG~Vs~I-~~~kgg~~I~I~~~dGe~v~y~IP~G~~L~V~eGD~V~aGq~L  227 (249)
T 2jxm_B          166 ELSNNNAFSASIAGTIAAI-EDNGFGFDVTIQPEDGDAVVTSILPGPELIVAVGDTVEAGQLL  227 (249)
T ss_dssp             CBCSSSCCBCSSCEEEEEE-CCSSSEEEEEEECTTSCCEEEEECSSSCBCCCTTCEECTTCBS
T ss_pred             CCCCCCEEECCCCEEEEEE-EECCCCEEEEEECCCCCEEEEECCCCCEEEECCCCEECCCCCC
T ss_conf             2688873774257499997-9779976999989999889997489981477899998589842


No 15 
>1q90_A Apocytochrome F; membrane protein complex, photosynthesis, electron transfer, oxydoreductase, chlorophyll; HET: HEM CL1 BCR TDS SQD LFA LMG; 3.10A {Chlamydomonas reinhardtii} SCOP: b.2.6.1 b.84.2.2 f.23.23.1
Probab=90.20  E-value=0.25  Score=26.70  Aligned_cols=106  Identities=16%  Similarity=0.097  Sum_probs=69.8

Q ss_pred             CCCCCCCEEECCCCEEEEEEEE--CCCCCEEEEECCCCEEEEEHHHHHHHHCCCCCCEEECCCEEEEECCCCCCCCC---
Q ss_conf             2679672797159679996530--89700799983997488200214454118899788349589984166788874---
Q gi|254780879|r  519 AAPRGTPIVAVGDGIVEKANWA--GGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGP---  593 (652)
Q Consensus       519 aAp~GTPI~Aag~G~V~~ag~~--~GyGn~V~I~H~~Gy~T~YaHlS~~a~gV~~G~~V~qGQvIG~vGsTG~STGP---  593 (652)
                      .-|.-+.+.|..+|+|.+....  ..-|+.|.|...+|-...|.=--.-.--|+.|+.|+.||.+        +++|   
T Consensus       164 ~KsnN~a~~As~aGtIs~I~~~~~eKG~~~I~I~~~dGe~v~~~IP~G~~LiV~eGd~VkaGq~L--------T~nPnvg  235 (292)
T 1q90_A          164 KKSNNTIYNASAAGKIVAITALSEKKGGFEVSIEKANGEVVVDKIPAGPDLIVKEGQTVQADQPL--------TNNPNVG  235 (292)
T ss_dssp             CCCTTSCCBCSSSEEEEEEEECCTTTCCEEEEEECSSSCEEEEEECSSSCBCCCTTCEECTTCBS--------BCCCCCC
T ss_pred             CCCCCCEEECCCCEEEEEEEEECCCCCCEEEEEECCCCCEEEEECCCCCEEEECCCCEEECCCCC--------CCCCCCC
T ss_conf             05778668167875998854402678978999988999889997489997896689998089803--------4698767


Q ss_pred             ---EEEEEEEECCEECCCCEECCCC----CCCCCHHHHHHHHHHHHHHHH
Q ss_conf             ---2688997867883662000788----787888999999999999999
Q gi|254780879|r  594 ---HLHYELIVNGIKVDSTKVRIPE----RENLKGDLLQRFAMEKKRINS  636 (652)
Q Consensus       594 ---HLHfEv~vnG~~VdP~~~~lp~----~~~l~~~~l~~F~~~~~~id~  636 (652)
                         ...-||    ...||++|+=.-    .-.|.-..|--.++|.+++..
T Consensus       236 gfgq~d~eI----vlqdp~Ri~G~~af~~~v~l~Qi~LVlkkkq~ekvQ~  281 (292)
T 1q90_A          236 GFGQAETEI----VLQNPARIQGLLVFFSFVLLTQVLLVLKKKQFEKVQL  281 (292)
T ss_dssp             EEEEEEEEE----EECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCEE----CCCCHHHHHHHHHHHHHHHHHHEEEEEEEEEEEEEEE
T ss_conf             756665325----3467668665899998988756011115246887722


No 16 
>2yty_A Cold shock domain-containing protein E1; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold; NMR {Homo sapiens}
Probab=75.66  E-value=1.9  Score=20.54  Aligned_cols=45  Identities=18%  Similarity=0.333  Sum_probs=30.6

Q ss_pred             CEEEEEEEECCCCCEEEEECCCCEEEEEHHHHHHHHCCCCCCEEECCCEEEEE
Q ss_conf             67999653089700799983997488200214454118899788349589984
Q gi|254780879|r  532 GIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWI  584 (652)
Q Consensus       532 G~V~~ag~~~GyGn~V~I~H~~Gy~T~YaHlS~~a~gV~~G~~V~qGQvIG~v  584 (652)
                      |+|  ..|+.|||-   |+-.++-.-.|-|.|.|..+   -.+.+.||.|-|.
T Consensus        21 G~I--~~~kkGfGF---I~~~~~~~diF~H~s~~~~~---~~~l~~G~~V~F~   65 (88)
T 2yty_A           21 GYV--ATLKDNFGF---IETANHDKEIFFHYSEFSGD---VDSLELGDMVEYS   65 (88)
T ss_dssp             EEE--EEECSSEEE---EECSSSSCEEEEETTTCCSC---TTTCCTTCEEEEC
T ss_pred             EEE--EEEECEEEE---EEECCCCCCEEEEHHHHCCC---CCCCCCCCEEEEE
T ss_conf             999--999570838---97089993199996993168---8856899999999


No 17 
>3cdx_A Succinylglutamatedesuccinylase/aspartoacylase; structural genomics, PSI-2, protein structure initiative; 2.10A {Rhodobacter sphaeroides 2}
Probab=75.12  E-value=1.5  Score=21.26  Aligned_cols=16  Identities=38%  Similarity=0.835  Sum_probs=8.0

Q ss_pred             CCCCCEEECCCEEEEE
Q ss_conf             8899788349589984
Q gi|254780879|r  569 IKAGTAVKQGQIIGWI  584 (652)
Q Consensus       569 V~~G~~V~qGQvIG~v  584 (652)
                      ++.|++|++||+||++
T Consensus       282 v~lG~~V~kGq~ig~I  297 (354)
T 3cdx_A          282 HYVGEEVRTGETAGWI  297 (354)
T ss_dssp             CCTTCEECTTSEEEEE
T ss_pred             CCCCCEECCCCEEEEE
T ss_conf             7879994899999999


No 18 
>2qj8_A MLR6093 protein; NP_106651.1, uncharacterized protein MLR6093, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.00A {Mesorhizobium loti MAFF303099}
Probab=72.53  E-value=1.7  Score=20.75  Aligned_cols=22  Identities=23%  Similarity=0.422  Sum_probs=18.7

Q ss_pred             HCCCCCCEEECCCEEEEECCCC
Q ss_conf             1188997883495899841667
Q gi|254780879|r  567 KNIKAGTAVKQGQIIGWIGTTG  588 (652)
Q Consensus       567 ~gV~~G~~V~qGQvIG~vGsTG  588 (652)
                      ..++.|++|++||+||++-+..
T Consensus       270 ~~~~~G~~V~kGq~lg~i~~~~  291 (332)
T 2qj8_A          270 PRCSVMDEVEQGDVVGVLHPMG  291 (332)
T ss_dssp             ECSCTTCEECTTCEEEEEECTT
T ss_pred             ECCCCCCEECCCCEEEEEECCC
T ss_conf             7589899988999999981776


No 19 
>2k5n_A Putative cold-shock protein; GFT protein structure, PSI, nesgc, OB fold, structural genomics, protein structure initiative; NMR {Pectobacterium atrosepticum}
Probab=72.43  E-value=2.8  Score=19.33  Aligned_cols=51  Identities=22%  Similarity=0.256  Sum_probs=33.5

Q ss_pred             CCEEEEEEEECCCCCEEEEECCCCEEEEEHHHHHHHHCCCCCCEEECCCEEEEECCCCCCCCCEEEEEEEECC
Q ss_conf             9679996530897007999839974882002144541188997883495899841667888742688997867
Q gi|254780879|r  531 DGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNG  603 (652)
Q Consensus       531 ~G~V~~ag~~~GyGn~V~I~H~~Gy~T~YaHlS~~a~gV~~G~~V~qGQvIG~vGsTG~STGPHLHfEv~vnG  603 (652)
                      +|+|..--...|||-.. .  .+| .-.|-|.|.+. +   .+              -+..|-.+.||+..+-
T Consensus         4 ~G~Vk~~~~~kGfGFI~-~--~~G-~DvF~H~s~l~-g---~~--------------~l~~G~~V~F~~~~~~   54 (74)
T 2k5n_A            4 NGTITTWFKDKGFGFIK-D--ENG-DNRYFHVIKVA-N---PD--------------LIKKDAAVTFEPTTNN   54 (74)
T ss_dssp             EEEEEEEETTTTEEEEE-E--SSS-CEEEEEGGGBS-S---GG--------------GCCTTCEEEEEEEECS
T ss_pred             CEEEEEEECCCCEEEEE-E--CCC-CCEEEEEEEEC-C---CC--------------CCCCCCEEEEEEEECC
T ss_conf             55999998999968987-4--699-83999987207-9---88--------------5599989999999899


No 20 
>1e2w_A Cytochrome F; electron transport proteins, internal water chain, photosynthetic function impaired; HET: HEC; 1.6A {Chlamydomonas reinhardtii} SCOP: b.2.6.1 b.84.2.2 PDB: 1cfm_A* 1ewh_A* 1e2v_A* 1e2z_A*
Probab=72.38  E-value=3.9  Score=18.24  Aligned_cols=57  Identities=23%  Similarity=0.152  Sum_probs=43.0

Q ss_pred             CCCEEECCCCEEEEEE-E-ECCCCCEEEEECCCCE---EEEEHHHHHHHHCCCCCCEEECCCEEE
Q ss_conf             6727971596799965-3-0897007999839974---882002144541188997883495899
Q gi|254780879|r  523 GTPIVAVGDGIVEKAN-W-AGGYGKQTLIHHGNGY---VSSYNHQDAIAKNIKAGTAVKQGQIIG  582 (652)
Q Consensus       523 GTPI~Aag~G~V~~ag-~-~~GyGn~V~I~H~~Gy---~T~YaHlS~~a~gV~~G~~V~qGQvIG  582 (652)
                      -|..-|...|+|.... | ...-|..|.|...+|-   ++.-+-..-+   |++|+.|+.||-+-
T Consensus       168 N~~~~as~~G~I~~I~~~~~~~g~~~v~I~~~~G~~v~~~iP~Gp~l~---V~~G~~v~~~qpLT  229 (251)
T 1e2w_A          168 FTIYNASAAGKIVAITALSEKKGGFEVSIEKANGEVVVDKIPAGPDLI---VKEGQTVQADQPLT  229 (251)
T ss_dssp             SSCCBCSSCEEEEEEEESSSSSCCEEEEEECTTSCEEEEEECSSSCBC---CCTTCEECTTCBCB
T ss_pred             CCEECCCCCEEEEEEEEEECCCCCEEEEEECCCCCEEEEECCCCCEEE---EECCCEEECCCCCC
T ss_conf             726637677588887765057985799998789989878328998588---70898886798555


No 21 
>1h95_A CSD, Y-box binding protein; translation factor, transcription factor, OB-fold, 5- stranded anti-parallel beta-barrel, single stranded DNA binding; NMR {Homo sapiens} SCOP: b.40.4.5
Probab=72.38  E-value=2  Score=20.23  Aligned_cols=32  Identities=31%  Similarity=0.390  Sum_probs=22.5

Q ss_pred             CEEEEEEEECCCCCEEEEECCCCEEEEEHHHHHHH
Q ss_conf             67999653089700799983997488200214454
Q gi|254780879|r  532 GIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIA  566 (652)
Q Consensus       532 G~V~~ag~~~GyGn~V~I~H~~Gy~T~YaHlS~~a  566 (652)
                      |+|..-.-..|||-..   -.+|-.-.|-|.|.|.
T Consensus        11 G~VKwfn~~KGfGFI~---~ddg~~DvFvH~s~i~   42 (79)
T 1h95_A           11 GTVKWFNVRNGYGFIN---RNDTKEDVFVHQTAIK   42 (79)
T ss_dssp             EEEEEEETTTTEEEEE---EGGGTEEEEEEGGGBC
T ss_pred             EEEEEEECCCCCEEEE---ECCCCEEEEEEHHHHH
T ss_conf             8999996899918998---5899704999969930


No 22 
>3h5q_A PYNP, pyrimidine-nucleoside phosphorylase; structural genomics, glycosyltransferase, transferase; HET: MSE THM; 1.94A {Staphylococcus aureus}
Probab=71.55  E-value=1.4  Score=21.46  Aligned_cols=57  Identities=28%  Similarity=0.240  Sum_probs=45.1

Q ss_pred             CCCCCCEEECCCCEEEEE--------EEECCCCCEE---EEECCCCEEEEEHHHHHHHHCCCCCCEEECCCEEEEECC
Q ss_conf             679672797159679996--------5308970079---998399748820021445411889978834958998416
Q gi|254780879|r  520 APRGTPIVAVGDGIVEKA--------NWAGGYGKQT---LIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGT  586 (652)
Q Consensus       520 Ap~GTPI~Aag~G~V~~a--------g~~~GyGn~V---~I~H~~Gy~T~YaHlS~~a~gV~~G~~V~qGQvIG~vGs  586 (652)
                      ++.=++|.|..+|.|...        -+.=|-|+..   .|+|+-|+.-          .++.|++|++||.|..+=+
T Consensus       335 ~~~~~~i~a~~~G~i~~id~~~ig~~~~~lGaGR~~~~d~iD~~~Gi~~----------~~k~Gd~V~~g~~l~~i~~  402 (436)
T 3h5q_A          335 AQYQIEYKAKKSGYVTELVSNDIGVASMMLGAGRLTKEDDIDLAVGIVL----------NKKIGDKVEEGESLLTIHS  402 (436)
T ss_dssp             CSEEEEEECSSCEEEEEECHHHHHHHHHHTTTSCSSTTCCCCTTCEEEE----------SCCTTCEECTTSEEEEEEE
T ss_pred             CCEEEEEECCCCEEEEEEEHHHHHHHHHHCCCCCCCCCCCCCCCCCEEE----------ECCCCCEECCCCEEEEEEC
T ss_conf             8768999558878999950799999999829997888888885778688----------3579599679991899974


No 23 
>2auk_A DNA-directed RNA polymerase beta' chain; sandwich-barrel hybrid motif, transferase; 2.30A {Escherichia coli}
Probab=68.85  E-value=4.7  Score=17.72  Aligned_cols=17  Identities=18%  Similarity=0.526  Sum_probs=15.2

Q ss_pred             CCCCCCEEECCCEEEEE
Q ss_conf             18899788349589984
Q gi|254780879|r  568 NIKAGTAVKQGQIIGWI  584 (652)
Q Consensus       568 gV~~G~~V~qGQvIG~v  584 (652)
                      .|+.|++|+.||+|+.+
T Consensus       169 ~V~dG~~V~~GdvlAki  185 (190)
T 2auk_A          169 QLEDGVQISSGDTLARI  185 (190)
T ss_dssp             SSCTTCEECTTCEEEEE
T ss_pred             EECCCCEECCCCEEEEC
T ss_conf             99397998688899988


No 24 
>1c9o_A CSPB, cold-shock protein; beta barrel, homodimer, transcription; 1.17A {Bacillus caldolyticus} SCOP: b.40.4.5 PDB: 2hax_A 1hz9_A 1hzb_A 1i5f_A 1hza_A 1hzc_A 2es2_A 1csq_A 1nmf_A 1nmg_A 1csp_A 2f52_A 2i5m_X 2i5l_X
Probab=67.52  E-value=4.2  Score=18.06  Aligned_cols=46  Identities=28%  Similarity=0.436  Sum_probs=30.8

Q ss_pred             CCEEEEEEEECCCCCEEEEECCCCEEEEEHHHHHHHHCCCCC-CEEECCCEEEE
Q ss_conf             967999653089700799983997488200214454118899-78834958998
Q gi|254780879|r  531 DGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAG-TAVKQGQIIGW  583 (652)
Q Consensus       531 ~G~V~~ag~~~GyGn~V~I~H~~Gy~T~YaHlS~~a~gV~~G-~~V~qGQvIG~  583 (652)
                      .|+|..-....|||-. ..  .+| .-.|-|.|.+.   ..| ..+++||.+-|
T Consensus         3 ~G~Vk~f~~~kGfGFI-~~--d~g-~diF~H~s~l~---~~~~~~l~~G~~V~f   49 (66)
T 1c9o_A            3 RGKVKWFNNEKGYGFI-EV--EGG-SDVFVHFTAIQ---GEGFKTLEEGQEVSF   49 (66)
T ss_dssp             EEEEEEEETTTTEEEE-EE--TTE-EEEEEEGGGBC---SSSCCCCCTTCEEEE
T ss_pred             CEEEEEEECCCCEEEE-EC--CCC-CEEEEEEEHHC---CCCCCCCCCCCEEEE
T ss_conf             8099999699984998-36--999-38999970415---157886799999999


No 25 
>3fmc_A Putative succinylglutamate desuccinylase / aspartoacylase; YP_926482.1, structural genomics, joint center for structural genomics; HET: MSE; 1.80A {Shewanella amazonensis SB2B} PDB: 3lwu_A*
Probab=66.75  E-value=3.7  Score=18.44  Aligned_cols=23  Identities=17%  Similarity=-0.005  Sum_probs=17.7

Q ss_pred             CCCCCCEEECCCEEEEECCCCCC
Q ss_conf             18899788349589984166788
Q gi|254780879|r  568 NIKAGTAVKQGQIIGWIGTTGLS  590 (652)
Q Consensus       568 gV~~G~~V~qGQvIG~vGsTG~S  590 (652)
                      -+..|++|++||+||++-+.-..
T Consensus       304 ~~~~G~~V~~G~~lg~i~d~~~~  326 (368)
T 3fmc_A          304 LGKVGVPMKATDPLVNLLRLDLY  326 (368)
T ss_dssp             CSCTTCCBCTTCEEEEEECGGGT
T ss_pred             CCCCCCEECCCCEEEEEECCCCC
T ss_conf             79997997899889999778767


No 26 
>2kcm_A Cold shock domain family protein; nucleic acid binding protein, beta barrel, structural genomics, PSI-2, protein structure initiative; NMR {Shewanella oneidensis mr-1}
Probab=66.47  E-value=5.1  Score=17.44  Aligned_cols=32  Identities=25%  Similarity=0.185  Sum_probs=23.7

Q ss_pred             CCEEEEEEEECCCCCEEEEECCCCEEEEEHHHHHHH
Q ss_conf             967999653089700799983997488200214454
Q gi|254780879|r  531 DGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIA  566 (652)
Q Consensus       531 ~G~V~~ag~~~GyGn~V~I~H~~Gy~T~YaHlS~~a  566 (652)
                      .|+|.+--...|||-.. -  .+| .-.|-|.|.+.
T Consensus         2 ~G~Vk~f~~~KGfGFI~-~--~dg-~DvFvH~s~l~   33 (74)
T 2kcm_A            2 KGKVVSYLAAKKYGFIQ-G--DDG-ESYFLHFSELL   33 (74)
T ss_dssp             EEEEEEEETTTTEEEEE-E--TTS-CEECCCGGGSS
T ss_pred             EEEEEEEECCCCEEEEE-C--CCC-CEEEEEEEHHC
T ss_conf             37999997999873886-5--999-88999940523


No 27 
>1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A
Probab=66.16  E-value=3  Score=19.02  Aligned_cols=18  Identities=33%  Similarity=0.506  Sum_probs=10.6

Q ss_pred             CCCCCEEECCCEEEEECC
Q ss_conf             889978834958998416
Q gi|254780879|r  569 IKAGTAVKQGQIIGWIGT  586 (652)
Q Consensus       569 V~~G~~V~qGQvIG~vGs  586 (652)
                      |++|++|++||+|..+=+
T Consensus        24 V~~Gd~V~~Gq~l~~iEa   41 (77)
T 1dcz_A           24 VKEGDTVKAGQTVLVLEA   41 (77)
T ss_dssp             CCTTCEECTTSEEEEEEE
T ss_pred             CCCCCEECCCCEEEEEEE
T ss_conf             389899869998999994


No 28 
>1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hammerhead structure, selenomethionine, ligase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A
Probab=66.01  E-value=3.1  Score=19.00  Aligned_cols=19  Identities=21%  Similarity=0.394  Sum_probs=13.7

Q ss_pred             CCCCCEEECCCEEEEECCC
Q ss_conf             8899788349589984166
Q gi|254780879|r  569 IKAGTAVKQGQIIGWIGTT  587 (652)
Q Consensus       569 V~~G~~V~qGQvIG~vGsT  587 (652)
                      |++|++|+.||+++.+-+-
T Consensus        27 V~~Gd~V~~g~~l~~iEam   45 (80)
T 1bdo_A           27 IEVGQKVNVGDTLCIVEAM   45 (80)
T ss_dssp             CCTTCEECTTCEEEEEEET
T ss_pred             ECCCCEEECCCEEEEEEEC
T ss_conf             2689999668789999976


No 29 
>3a0j_A Cold shock protein; OB-fold, cytoplasm, transcription, structural genomics, NPPSFA; 1.65A {Thermus thermophilus}
Probab=65.48  E-value=3.6  Score=18.49  Aligned_cols=52  Identities=27%  Similarity=0.387  Sum_probs=33.2

Q ss_pred             CCEEEEEEEECCCCCEEEEECCCCEEEEEHHHHHHHHCCCCC-CEEECCCEEEEECCCCC
Q ss_conf             967999653089700799983997488200214454118899-78834958998416678
Q gi|254780879|r  531 DGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAG-TAVKQGQIIGWIGTTGL  589 (652)
Q Consensus       531 ~G~V~~ag~~~GyGn~V~I~H~~Gy~T~YaHlS~~a~gV~~G-~~V~qGQvIG~vGsTG~  589 (652)
                      .|+|..-....|||-.   .-. +-.-.|-|.|.|.   ..| ..++.||.|-|.=..|.
T Consensus         3 ~G~Vkwf~~~kGfGFI---~~d-~g~dvFvH~s~i~---~~g~~~l~~G~~V~f~~~~~~   55 (73)
T 3a0j_A            3 KGRVKWFNAEKGYGFI---ERE-GDTDVFVHYTAIN---AKGFRTLNEGDIVTFDVEPGR   55 (73)
T ss_dssp             EEEEEEEETTTTEEEE---ECT-TSCCEEEEGGGBC---SSSCSSCCTTCEEEEEEECCS
T ss_pred             CEEEEEEECCCCEEEE---CCC-CCCEEEEEEHHHC---CCCCCCCCCCCEEEEEEEECC
T ss_conf             8399989299984783---158-9970999847755---236987899999999999899


No 30 
>2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A*
Probab=63.87  E-value=3.6  Score=18.48  Aligned_cols=18  Identities=11%  Similarity=0.167  Sum_probs=8.4

Q ss_pred             CCCCCEEECCC-EEEEECC
Q ss_conf             88997883495-8998416
Q gi|254780879|r  569 IKAGTAVKQGQ-IIGWIGT  586 (652)
Q Consensus       569 V~~G~~V~qGQ-vIG~vGs  586 (652)
                      +++|+.|..|+ .|..+-+
T Consensus        83 ~~~G~~V~~g~~~l~~I~~  101 (116)
T 2k32_A           83 VNIGDYVSASTTELVRVTN  101 (116)
T ss_dssp             CCTTCEECTTTSCCEEEEC
T ss_pred             CCCCCEECCCCCEEEEEEC
T ss_conf             7999988899954899977


No 31 
>1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A*
Probab=62.75  E-value=3.8  Score=18.31  Aligned_cols=18  Identities=22%  Similarity=0.366  Sum_probs=10.4

Q ss_pred             CCCCCEEECCCEEEEECC
Q ss_conf             889978834958998416
Q gi|254780879|r  569 IKAGTAVKQGQIIGWIGT  586 (652)
Q Consensus       569 V~~G~~V~qGQvIG~vGs  586 (652)
                      ++.|+.|+.||.|..+-.
T Consensus        52 v~~G~~V~~G~~l~~i~~   69 (72)
T 1z6h_A           52 KKEGDFVNEGDVLLELSN   69 (72)
T ss_dssp             SCTTCEECTTCEEEEEGG
T ss_pred             ECCCCEECCCCEEEEEEC
T ss_conf             789799899999999947


No 32 
>2q6k_A Chlorinase; complex with adenosine, biosynthetic protein; HET: ADN; 1.55A {Salinispora tropica cnb-440} PDB: 2q6i_A* 2q6o_A* 2q6l_A*
Probab=61.83  E-value=6.2  Score=16.82  Aligned_cols=22  Identities=27%  Similarity=0.480  Sum_probs=16.2

Q ss_pred             EEECCCEEEEECCCCCCCCCEEEEEEEEC
Q ss_conf             88349589984166788874268899786
Q gi|254780879|r  574 AVKQGQIIGWIGTTGLSTGPHLHYELIVN  602 (652)
Q Consensus       574 ~V~qGQvIG~vGsTG~STGPHLHfEv~vn  602 (652)
                      .|..|+.+.|.||.|       ++||-+|
T Consensus       230 dv~~Ge~~al~nS~G-------~LEIAin  251 (283)
T 2q6k_A          230 EVDEGQPLLYLNSRG-------RLALGLN  251 (283)
T ss_dssp             GSCTTCEEEEECTTS-------EEEEEET
T ss_pred             CCCCCCEEEEECCCC-------CEEEEEE
T ss_conf             579998899998999-------7999995


No 33 
>2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, domain, BCCP, X-RAY diffraction, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii OT3} PDB: 2ejf_C* 2ejg_C* 2evb_A
Probab=61.20  E-value=4.3  Score=17.99  Aligned_cols=19  Identities=21%  Similarity=0.337  Sum_probs=10.5

Q ss_pred             CCCCCEEECCCEEEEECCC
Q ss_conf             8899788349589984166
Q gi|254780879|r  569 IKAGTAVKQGQIIGWIGTT  587 (652)
Q Consensus       569 V~~G~~V~qGQvIG~vGsT  587 (652)
                      |++|++|++||.|+.+-+.
T Consensus        21 v~~Gd~V~~g~~l~~iE~~   39 (74)
T 2d5d_A           21 VRVGDRVRVGQGLLVLEAM   39 (74)
T ss_dssp             CCTTCEECTTCEEEEEEET
T ss_pred             CCCCCEEECCCEEEEEEEC
T ss_conf             4899999389889999935


No 34 
>1wfq_A UNR protein; beta-barrel, translational regulation, RNA chaperone, RNA/DNA binding, QB fold, greek-KEY topology, structural genomics; NMR {Homo sapiens} SCOP: b.40.4.5
Probab=60.82  E-value=4.9  Score=17.58  Aligned_cols=60  Identities=20%  Similarity=0.252  Sum_probs=31.8

Q ss_pred             EEECCCCCCCEEECCCCEEEEEEEECCCCCEEEEECCCCEEEEEHHHHHHHHCCCCCCEEECCCEEEE
Q ss_conf             03026796727971596799965308970079998399748820021445411889978834958998
Q gi|254780879|r  516 VDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGW  583 (652)
Q Consensus       516 VD~aAp~GTPI~Aag~G~V~~ag~~~GyGn~V~I~H~~Gy~T~YaHlS~~a~gV~~G~~V~qGQvIG~  583 (652)
                      .+..+|.+|..-.=.-|+|..  |..|||-.   .-.++=.-.|-|.|.|..+   ..+++.||.|-|
T Consensus         5 ~~g~~~~~~~~~~r~~G~V~~--~~~gfGFI---~~~~g~~dvFfH~s~i~~~---~~~l~~G~~V~F   64 (89)
T 1wfq_A            5 SSGGYPNGTSAALRETGVIEK--LLTSYGFI---QCSERQARLFFHCSQYNGN---LQDLKVGDDVEF   64 (89)
T ss_dssp             SSTTSSCSSSCCCEEEEEEEE--ECSSEEEE---EETTTTEEEEEETTTCSSC---TTTCCTTCCEEE
T ss_pred             CCCCCCCCCCCCEEEEEEEEE--EECCCCEE---EECCCCCCEEEEEHHHCCC---CCCCCCCCEEEE
T ss_conf             457688898542178899999--84820258---8079997699986042378---862689999999


No 35 
>1g6p_A Cold shock protein TMCSP; greek-KEY, beta barrel, OB-fold, structural genomics; NMR {Thermotoga maritima} SCOP: b.40.4.5
Probab=59.75  E-value=5.5  Score=17.19  Aligned_cols=46  Identities=30%  Similarity=0.468  Sum_probs=27.7

Q ss_pred             CCEEEEEEEECCCCCEEEEECCCCEEEEEHHHHHHHHCCCCC-CEEECCCEEEE
Q ss_conf             967999653089700799983997488200214454118899-78834958998
Q gi|254780879|r  531 DGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAG-TAVKQGQIIGW  583 (652)
Q Consensus       531 ~G~V~~ag~~~GyGn~V~I~H~~Gy~T~YaHlS~~a~gV~~G-~~V~qGQvIG~  583 (652)
                      .|+|..-....|||-..-   .+| .-.|-|.|.+.   ..| ..++.||.+-|
T Consensus         2 ~G~Vk~f~~~kGfGFI~~---~~g-~dvFvH~s~l~---~~g~~~l~~G~~V~f   48 (66)
T 1g6p_A            2 RGKVKWFDSKKGYGFITK---DEG-GDVFVHWSAIE---MEGFKTLKEGQVVEF   48 (66)
T ss_dssp             CEEEEEEETTTTEEEEEE---TTS-CBCBBCSSSSC---CSSCCCCCSSSEEEE
T ss_pred             EEEEEEEECCCCEEEEEC---CCC-CEEEEEHHHHC---CCCCCCCCCCCEEEE
T ss_conf             289999939998289871---899-63999958816---336997899999999


No 36 
>3i2z_B RNA chaperone, negative regulator of CSPA transcription; beta barrel, DNA binding protein/transcription, cytoplasm, gene regulation; 1.10A {Salmonella typhimurium} PDB: 1mjc_A 3mef_A
Probab=59.62  E-value=5.4  Score=17.24  Aligned_cols=48  Identities=25%  Similarity=0.329  Sum_probs=29.7

Q ss_pred             CCCEEEEEEEECCCCCEEEEECCCCEEEEEHHHHHHHHCCCCC-CEEECCCEEEE
Q ss_conf             5967999653089700799983997488200214454118899-78834958998
Q gi|254780879|r  530 GDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAG-TAVKQGQIIGW  583 (652)
Q Consensus       530 g~G~V~~ag~~~GyGn~V~I~H~~Gy~T~YaHlS~~a~gV~~G-~~V~qGQvIG~  583 (652)
                      -.|+|..-.-..|||-. ..  .+|-.-.|-|.|.+.   ..| ..+++||.+-|
T Consensus         6 ~~G~Vk~fd~~kGyGFI-~~--d~g~~diF~H~s~l~---~~~~~~l~~G~~V~f   54 (71)
T 3i2z_B            6 IKGNVKWFNESKGFGFI-TP--EDGSKDVFVHFSAIQ---TNGFKTLAEGQRVEF   54 (71)
T ss_dssp             EEEEEEEEETTTTEEEE-EE--TTCCCCEEEEGGGBC---CSSCCCCCTTCEEEE
T ss_pred             EEEEEEEECCCCCEEEE-EE--CCCCCEEEEEEHHHC---CCCCCCCCCCCEEEE
T ss_conf             15799999499984899-86--899822999908825---337987899999999


No 37 
>1uou_A Thymidine phosphorylase; transferase, glycosyltransferase, chemotaxis, angiogenesis; HET: CMU; 2.11A {Homo sapiens} SCOP: a.46.2.1 c.27.1.1 d.41.3.1 PDB: 2wk6_A 2wk5_A 2j0f_A
Probab=58.93  E-value=4.2  Score=18.00  Aligned_cols=59  Identities=22%  Similarity=0.291  Sum_probs=40.2

Q ss_pred             CCCCCCEEECCCCEEEEEE-----E---ECCCCCE-EEEECCCCEEEEEHHHHHHHHCCCCCCEEECCCEEEEECCCC
Q ss_conf             6796727971596799965-----3---0897007-999839974882002144541188997883495899841667
Q gi|254780879|r  520 APRGTPIVAVGDGIVEKAN-----W---AGGYGKQ-TLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTG  588 (652)
Q Consensus       520 Ap~GTPI~Aag~G~V~~ag-----~---~~GyGn~-V~I~H~~Gy~T~YaHlS~~a~gV~~G~~V~qGQvIG~vGsTG  588 (652)
                      |+.-+.|.|..+|.|....     +   .-|-|+. =.|+|+-|+.          -.++.|++|++||.|..+=+..
T Consensus       369 a~~~~~i~a~~~G~i~~id~~~lg~~~~~LGaGR~~d~iD~~vGi~----------l~~k~Gd~V~~g~~l~~i~~~~  436 (474)
T 1uou_A          369 AREQEELLAPADGTVELVRALPLALVLHELGAGRAGEPLRLGVGAE----------LLVDVGQRLRRGTPWLRVHRDG  436 (474)
T ss_dssp             CSEEEEEECSSCEEEEEECHHHHHHHHHHHHC------CCSSCEEE----------ECSCTTCEECTTCEEEEEEESS
T ss_pred             CCEEEEEECCCCEEEEEEEHHHHHHHHHHHCCCCCCCCCCCCCCEE----------EECCCCCEECCCCEEEEEECCC
T ss_conf             7736899748986999853699999999848884889858376857----------6256869856999189996698


No 38 
>3cam_A Cold-shock domain family protein; cold shock protein, chain SWAP, structural genomics, oxford protein production facility, OPPF; 2.60A {Neisseria meningitidis MC58}
Probab=58.77  E-value=6.5  Score=16.69  Aligned_cols=47  Identities=34%  Similarity=0.448  Sum_probs=30.2

Q ss_pred             CCEEEEEEEECCCCCEEEEECCCCEEEEEHHHHHHHHCCCCCC-EEECCCEEEE
Q ss_conf             9679996530897007999839974882002144541188997-8834958998
Q gi|254780879|r  531 DGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGT-AVKQGQIIGW  583 (652)
Q Consensus       531 ~G~V~~ag~~~GyGn~V~I~H~~Gy~T~YaHlS~~a~gV~~G~-~V~qGQvIG~  583 (652)
                      .|+|..-.-..|||-..   -.+|=.-.|-|.|.|.   ..|. .+++||.|-|
T Consensus         3 ~G~Vkwf~~~kGyGFI~---~~~~~~dvFvH~s~l~---~~~~~~l~~G~~V~f   50 (67)
T 3cam_A            3 TGIVKWFNDAKGFGFIT---PDEGGEDLFAHFSAIN---MEGFKTLKEGQRVSF   50 (67)
T ss_dssp             EEEEEEEETTTTEEEEE---ETTSCCCEEEEGGGBC---GGGGSSCCTTCEEEE
T ss_pred             CEEEEEEECCCCCEEEE---ECCCCEEEEEEEHHHC---CCCCCCCCCCCEEEE
T ss_conf             83999995999948999---7799728999845615---226985899999999


No 39 
>1hcz_A Cytochrome F; electron transport, photosynthesis, cytochrome B6F complex, chloroplast transmembrane; HET: HEM; 1.96A {Brassica rapa} SCOP: b.2.6.1 b.84.2.2 PDB: 1tkw_B* 1ctm_A* 2pcf_B*
Probab=57.83  E-value=7.3  Score=16.36  Aligned_cols=56  Identities=20%  Similarity=0.153  Sum_probs=40.1

Q ss_pred             CCCEEECCCCEEEEEEEECCCCCEEEEEC-CCCE---EEEEHHHHHHHHCCCCCCEEECCCEE
Q ss_conf             67279715967999653089700799983-9974---88200214454118899788349589
Q gi|254780879|r  523 GTPIVAVGDGIVEKANWAGGYGKQTLIHH-GNGY---VSSYNHQDAIAKNIKAGTAVKQGQII  581 (652)
Q Consensus       523 GTPI~Aag~G~V~~ag~~~GyGn~V~I~H-~~Gy---~T~YaHlS~~a~gV~~G~~V~qGQvI  581 (652)
                      -|..-|...|+|...-....-|..|.|.. .+|.   ++.-+-..-+   |++|+.|+.||-+
T Consensus       168 Nn~~~as~~G~I~~I~~~ekg~~~vti~~~~~~~~v~~~iP~Gp~li---V~~G~~V~~~qpL  227 (252)
T 1hcz_A          168 NTVYNATAGGIISKILRKEKGGYEITIVDASNERQVIDIIPRGLELL---VSEGESIKLDQPL  227 (252)
T ss_dssp             SSCCBCSSCEEEEEEEECTTSCEEEEEEETTTTEEEEEEECTTCCBC---CCTTCEECTTCBS
T ss_pred             CCCCCCCCCCEEEEEEECCCCCEEEEEEECCCCCEEEEECCCCCEEE---ECCCCEEECCCCC
T ss_conf             73013555717888787588977999996699978888118998688---8089988679866


No 40 
>1brw_A PYNP, protein (pyrimidine nucleoside phosphorylase); domain movement, transferase; HET: MES; 2.10A {Geobacillus stearothermophilus} SCOP: a.46.2.1 c.27.1.1 d.41.3.1
Probab=57.54  E-value=1.5  Score=21.10  Aligned_cols=60  Identities=25%  Similarity=0.317  Sum_probs=45.2

Q ss_pred             CCCCCCEEECCCCEEEEE-----EE---ECCCCCEE---EEECCCCEEEEEHHHHHHHHCCCCCCEEECCCEEEEECCCC
Q ss_conf             679672797159679996-----53---08970079---99839974882002144541188997883495899841667
Q gi|254780879|r  520 APRGTPIVAVGDGIVEKA-----NW---AGGYGKQT---LIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTG  588 (652)
Q Consensus       520 Ap~GTPI~Aag~G~V~~a-----g~---~~GyGn~V---~I~H~~Gy~T~YaHlS~~a~gV~~G~~V~qGQvIG~vGsTG  588 (652)
                      ++.=++|.|..+|.|...     ||   .=|-|+..   .|+|+-|+.-          -++.|++|++||+|..+=+..
T Consensus       332 ~~~~~~i~a~~~G~i~~id~~~ig~~~~~lGaGR~~~~d~id~~vGi~~----------~~~~G~~V~~g~~l~~i~~~~  401 (433)
T 1brw_A          332 AAYTSTVTAAADGYVAEMAADDIGTAAMWLGAGRAKKEDVIDLAVGIVL----------HKKIGDRVQKGEALATIHSNR  401 (433)
T ss_dssp             CSEEEEEECSSSEEEEEECHHHHHHHHHHHTTSCSSTTCCCCTTCEEEE----------SCCTTCEECTTCEEEEEEESS
T ss_pred             CCEEEEEECCCCEEEEEECHHHHHHHHHHCCCCCCCCCCCCCCCCCEEE----------ECCCCCEECCCCEEEEEECCC
T ss_conf             8756999738997998754999999999808997877788896777688----------436849967999189997688


Q ss_pred             C
Q ss_conf             8
Q gi|254780879|r  589 L  589 (652)
Q Consensus       589 ~  589 (652)
                      -
T Consensus       402 ~  402 (433)
T 1brw_A          402 P  402 (433)
T ss_dssp             S
T ss_pred             C
T ss_conf             4


No 41 
>1x65_A UNR protein; cell-free protein synthesis, beta-barrel, translational regulation, RNA chaperone, RNA/DNA binding, QB fold, greek- KEY topology; NMR {Homo sapiens}
Probab=55.09  E-value=5.9  Score=16.99  Aligned_cols=44  Identities=16%  Similarity=0.305  Sum_probs=28.3

Q ss_pred             CEEEEEEEECCCCCEEEEECCCCEEEEEHHHHHHHHCCCCCCEEECCCEEEEE
Q ss_conf             67999653089700799983997488200214454118899788349589984
Q gi|254780879|r  532 GIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWI  584 (652)
Q Consensus       532 G~V~~ag~~~GyGn~V~I~H~~Gy~T~YaHlS~~a~gV~~G~~V~qGQvIG~v  584 (652)
                      |+|.  .|+.|||-.   +-.++=.-.|.|.|.|.    ...+++.||.+-|.
T Consensus        11 G~V~--~~k~GfGFI---~~~~~~~dvF~H~s~~~----~~~~l~~G~~VeF~   54 (89)
T 1x65_A           11 GVIA--AMRDGFGFI---KCVDRDVRMFFHFSEIL----DGNQLHIADEVEFT   54 (89)
T ss_dssp             EEEE--ECCTTBCEE---EESSSSSCCCCBTTGGG----GSCCCCTTCCEEEC
T ss_pred             EEEE--EEECCEEEE---EECCCCCCEEEEHHHCC----CCCCCCCCCEEEEE
T ss_conf             9999--995957378---76999966899934547----99987789999999


No 42 
>3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli}
Probab=55.04  E-value=6.2  Score=16.82  Aligned_cols=11  Identities=36%  Similarity=0.211  Sum_probs=5.4

Q ss_pred             HHCCCCCEEEE
Q ss_conf             10144540688
Q gi|254780879|r  419 EHLKPTDFLET  429 (652)
Q Consensus       419 r~ir~GD~f~V  429 (652)
                      ..+++|+...+
T Consensus       205 ~~v~~g~~v~i  215 (341)
T 3fpp_A          205 IHLKPGQKAWF  215 (341)
T ss_dssp             TTCCTTCCCEE
T ss_pred             HHHHCCCEEEE
T ss_conf             97314753789


No 43 
>2tpt_A Thymidine phosphorylase; transferase, salvage pathway; 2.60A {Escherichia coli K12} SCOP: a.46.2.1 c.27.1.1 d.41.3.1 PDB: 1azy_A 1tpt_A 1otp_A
Probab=53.84  E-value=1.9  Score=20.46  Aligned_cols=57  Identities=21%  Similarity=0.263  Sum_probs=41.4

Q ss_pred             CCCCCCEEECCCCEEEEEE--------EECCCCCEE---EEECCCCEEEEEHHHHHHHHCCCCCCEEECCCEEEEECC
Q ss_conf             6796727971596799965--------308970079---998399748820021445411889978834958998416
Q gi|254780879|r  520 APRGTPIVAVGDGIVEKAN--------WAGGYGKQT---LIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGT  586 (652)
Q Consensus       520 Ap~GTPI~Aag~G~V~~ag--------~~~GyGn~V---~I~H~~Gy~T~YaHlS~~a~gV~~G~~V~qGQvIG~vGs  586 (652)
                      |+.=+.|.|..+|.|....        +.=|-|+..   .|+|+-|+.-          -++.|++|++||.|..+=+
T Consensus       337 a~~~~~i~a~~~G~i~~i~~~~ig~~~~~lGaGR~~~~d~iD~~~Gi~~----------~~k~G~~V~~g~~l~~i~~  404 (440)
T 2tpt_A          337 AMLTKAVYADTEGFVSEMDTRALGMAVVAMGGGRRQASDTIDYSVGFTD----------MARLGDQVDGQRPLAVIHA  404 (440)
T ss_dssp             CSEEEEECCSSCEEEEEECHHHHHHHHHHHTTSCSSTTCCCCSSCEEES----------CCCTTCEEBTTBCSEEEEE
T ss_pred             CCEEEEEEECCCEEEEEECHHHHHHHHHHHCCCCCCCCCCCCCCCCEEE----------ECCCCCEECCCCEEEEEEC
T ss_conf             6636999856885898851899999999818984768888785778688----------4268698679990899974


No 44 
>3lnn_A Membrane fusion protein (MFP-RND) heavy metal CAT tricomponent efflux HMXB (CZCB-LIKE)...; structural genomics, PSI-2; 2.80A {Cupriavidus metallidurans}
Probab=53.14  E-value=7.1  Score=16.44  Aligned_cols=12  Identities=17%  Similarity=0.094  Sum_probs=5.7

Q ss_pred             HCCCCCEEEEEE
Q ss_conf             014454068875
Q gi|254780879|r  420 HLKPTDFLETFF  431 (652)
Q Consensus       420 ~ir~GD~f~Vly  431 (652)
                      .+..|+...+..
T Consensus       221 ~i~~G~~v~i~~  232 (359)
T 3lnn_A          221 HVYVGQSATVKF  232 (359)
T ss_dssp             TCCTTCEEEEBC
T ss_pred             HHCCCCEEEEEE
T ss_conf             510698489999


No 45 
>2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.5A {Homo sapiens}
Probab=52.78  E-value=3.1  Score=18.98  Aligned_cols=18  Identities=44%  Similarity=0.558  Sum_probs=10.8

Q ss_pred             CCCCCEEECCCEEEEECC
Q ss_conf             889978834958998416
Q gi|254780879|r  569 IKAGTAVKQGQIIGWIGT  586 (652)
Q Consensus       569 V~~G~~V~qGQvIG~vGs  586 (652)
                      |++|++|++||++..+-+
T Consensus        41 V~~Gd~V~~G~~l~~iEs   58 (94)
T 2jku_A           41 VKPGDAVAEGQEICVIEA   58 (94)
T ss_dssp             CCTTCCCCTTCCCEEEEC
T ss_pred             CCCCCEECCCCEEEEEEC
T ss_conf             189999958987999980


No 46 
>2ytx_A Cold shock domain-containing protein E1; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold; NMR {Homo sapiens}
Probab=52.75  E-value=4.8  Score=17.61  Aligned_cols=46  Identities=13%  Similarity=0.193  Sum_probs=24.6

Q ss_pred             CEEEEEEEECCCCCEEEEECCCCEEEEEHHHHHHHHCCCCCCEEECCCEEEEEC
Q ss_conf             679996530897007999839974882002144541188997883495899841
Q gi|254780879|r  532 GIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIG  585 (652)
Q Consensus       532 G~V~~ag~~~GyGn~V~I~H~~Gy~T~YaHlS~~a~gV~~G~~V~qGQvIG~vG  585 (652)
                      |+|..  |+.|||-.   .-.+|=.-.|-|.|.|..   ....++.||.+-|.=
T Consensus        21 G~I~~--~k~GfGFI---~~~~g~~diFfH~s~~~~---~~~~l~~G~~V~F~~   66 (97)
T 2ytx_A           21 GVVCA--MKEAFGFI---ERGDVVKEIFFHYSEFKG---DLETLQPGDDVEFTI   66 (97)
T ss_dssp             EEECC--CCSSEEEE---ECSSSCCCEEEETTTCCS---CTTSCCSCCEEEEEE
T ss_pred             EEEEE--EECCEEEE---EECCCCCCEEEEEHHHHC---CCCCCCCCCEEEEEE
T ss_conf             99989--93818189---718999519999478506---666488999999999


No 47 
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens}
Probab=52.54  E-value=6.8  Score=16.57  Aligned_cols=17  Identities=12%  Similarity=0.438  Sum_probs=9.4

Q ss_pred             CCCCCEEECCCEEEEEC
Q ss_conf             88997883495899841
Q gi|254780879|r  569 IKAGTAVKQGQIIGWIG  585 (652)
Q Consensus       569 V~~G~~V~qGQvIG~vG  585 (652)
                      +++|+.|..||.|+.+-
T Consensus        57 v~~Gd~V~~G~~l~~ie   73 (84)
T 2kcc_A           57 KRPGAVLEAGCVVARLE   73 (84)
T ss_dssp             SCTTCCCCTTCCCEEEE
T ss_pred             ECCCCEECCCCEEEEEE
T ss_conf             88989999999999994


No 48 
>2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens}
Probab=52.20  E-value=6.8  Score=16.56  Aligned_cols=18  Identities=6%  Similarity=0.053  Sum_probs=9.9

Q ss_pred             CCCCCEEECCCEEEEECC
Q ss_conf             889978834958998416
Q gi|254780879|r  569 IKAGTAVKQGQIIGWIGT  586 (652)
Q Consensus       569 V~~G~~V~qGQvIG~vGs  586 (652)
                      ++.|+.|..||+|..+-.
T Consensus        67 v~~Gd~V~~G~~L~~i~~   84 (99)
T 2ejm_A           67 YREGAQANRHTPLVEFEE   84 (99)
T ss_dssp             CCTTEEECTTCBCEEECC
T ss_pred             ECCCCEECCCCEEEEEEC
T ss_conf             289899689998999963


No 49 
>1xjv_A Protection of telomeres 1; protein-DNA complex, single-stranded DNA, transcription/DNA complex; 1.73A {Homo sapiens} SCOP: b.40.4.3 b.40.4.3 PDB: 3kjo_A 3kjp_A
Probab=51.72  E-value=9  Score=15.70  Aligned_cols=76  Identities=14%  Similarity=0.261  Sum_probs=47.8

Q ss_pred             EEEEHHHHHHHHCCCCCCEEECCCEEEEECCCCCCCCCEEEEEEEECCEECCCCEEC-CCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             882002144541188997883495899841667888742688997867883662000-7887878889999999999999
Q gi|254780879|r  556 VSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVR-IPERENLKGDLLQRFAMEKKRI  634 (652)
Q Consensus       556 ~T~YaHlS~~a~gV~~G~~V~qGQvIG~vGsTG~STGPHLHfEv~vnG~~VdP~~~~-lp~~~~l~~~~l~~F~~~~~~i  634 (652)
                      +|.|-.-+.+++.+|+|++|+-=-|=-......-+-.+-+|.|....|-..-|..|+ ||..    ..+...|++..+-+
T Consensus       215 v~~~d~Ha~~~r~lk~Gd~V~l~NV~~K~~~~~~~~~~~~~le~~lH~~~~y~rgi~~l~~~----~~~v~~l~r~~~~~  290 (294)
T 1xjv_A          215 ILVYDNHVHVARSLKVGSFLRIYSLHTKLQSMNSENQTMLSLEFHLHGGTSYGRGIRVLPES----NSDVDQLKKDLESA  290 (294)
T ss_dssp             EEEETTHHHHHHHCCTTCEEEEEEEEEEEEEECTTSCEEEEEEEEECSSCGGGCEEEEECTT----SHHHHHHHHHHHHH
T ss_pred             EEEECCHHHHHHCCCCCCEEEEEEEEEEECCCCCCCCCCCEEEEEEECCCCCCCCCEECCCC----CHHHHHHHHHHHHC
T ss_conf             99998057887428999889997558981257755677740799996782469802889998----87999998777531


Q ss_pred             H
Q ss_conf             9
Q gi|254780879|r  635 N  635 (652)
Q Consensus       635 d  635 (652)
                      +
T Consensus       291 ~  291 (294)
T 1xjv_A          291 N  291 (294)
T ss_dssp             H
T ss_pred             C
T ss_conf             3


No 50 
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=49.43  E-value=7.3  Score=16.32  Aligned_cols=17  Identities=12%  Similarity=0.438  Sum_probs=12.6

Q ss_pred             CCCCCEEECCCEEEEEC
Q ss_conf             88997883495899841
Q gi|254780879|r  569 IKAGTAVKQGQIIGWIG  585 (652)
Q Consensus       569 V~~G~~V~qGQvIG~vG  585 (652)
                      +++|+.|..||+|+.+=
T Consensus        69 v~~G~~V~~G~~l~~ie   85 (100)
T 2dn8_A           69 KRPGAVLEAGCVVARLE   85 (100)
T ss_dssp             SCTTCEECSSCEEEEEC
T ss_pred             ECCCCEECCCCEEEEEE
T ss_conf             78989999999999996


No 51 
>1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A
Probab=49.38  E-value=6.5  Score=16.72  Aligned_cols=20  Identities=25%  Similarity=0.526  Sum_probs=15.8

Q ss_pred             CCCCCEEECCCEEEEECCCC
Q ss_conf             88997883495899841667
Q gi|254780879|r  569 IKAGTAVKQGQIIGWIGTTG  588 (652)
Q Consensus       569 V~~G~~V~qGQvIG~vGsTG  588 (652)
                      +++|+.|+.||+|+++-.-|
T Consensus        60 v~~G~~v~~G~~l~~i~~~G   79 (79)
T 1ghj_A           60 KNEGDTVLSGELLGKLTEGG   79 (79)
T ss_dssp             SCTTCEECTTCEEEEECCCC
T ss_pred             ECCCCEECCCCEEEEEECCC
T ss_conf             48999978999999994799


No 52 
>3crk_C Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; pyruvate dehydrogenase kinase isozyme 2, glucose metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C*
Probab=48.53  E-value=9.2  Score=15.62  Aligned_cols=40  Identities=15%  Similarity=0.125  Sum_probs=20.7

Q ss_pred             EECCCCEEEEEHHHHHHHH--CCCCCC-EEECCCEEEEECCCC
Q ss_conf             9839974882002144541--188997-883495899841667
Q gi|254780879|r  549 IHHGNGYVSSYNHQDAIAK--NIKAGT-AVKQGQIIGWIGTTG  588 (652)
Q Consensus       549 I~H~~Gy~T~YaHlS~~a~--gV~~G~-~V~qGQvIG~vGsTG  588 (652)
                      |.-..--....+..+.+..  -+.+|+ .|+-||+|+++...|
T Consensus        42 vEtdK~~~ev~a~~~G~l~~i~v~eGd~~v~vG~~ia~i~~~~   84 (87)
T 3crk_C           42 IETDXATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKE   84 (87)
T ss_dssp             EECSSCEEEEECCSCEEEEEESSCTTCCCEETTCEEEEEESSS
T ss_pred             EEECCEEEEEECCCCEEEEEEEECCCCEEECCCCEEEEEECCC
T ss_conf             9907788868718999999999778982975999899995667


No 53 
>1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1
Probab=47.61  E-value=7.9  Score=16.09  Aligned_cols=22  Identities=27%  Similarity=0.481  Sum_probs=17.8

Q ss_pred             CCCCCEEECCCEEEEECCCCCC
Q ss_conf             8899788349589984166788
Q gi|254780879|r  569 IKAGTAVKQGQIIGWIGTTGLS  590 (652)
Q Consensus       569 V~~G~~V~qGQvIG~vGsTG~S  590 (652)
                      +++|+.|+.||+|+.+-..|-|
T Consensus        59 v~~G~~v~~G~~l~~ie~~g~a   80 (80)
T 1qjo_A           59 VNVGDKVKTGSLIMIFEVEGAA   80 (80)
T ss_dssp             CCTTCEECTTCCCEEEESCCCC
T ss_pred             ECCCCEECCCCEEEEEECCCCC
T ss_conf             5898995899999999646589


No 54 
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 3hb9_A*
Probab=47.07  E-value=9.9  Score=15.40  Aligned_cols=18  Identities=22%  Similarity=0.244  Sum_probs=13.4

Q ss_pred             CCCCCEEECCCEEEEECC
Q ss_conf             889978834958998416
Q gi|254780879|r  569 IKAGTAVKQGQIIGWIGT  586 (652)
Q Consensus       569 V~~G~~V~qGQvIG~vGs  586 (652)
                      |++|++|+.||++..+=+
T Consensus      1093 V~~Gd~V~~Gd~l~IlEA 1110 (1150)
T 3hbl_A         1093 VSVGETVKANQPLLITEA 1110 (1150)
T ss_dssp             CCTTCEECTTCEEEEEES
T ss_pred             ECCCCEECCCCEEEEEEH
T ss_conf             089999799998999965


No 55 
>2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=45.65  E-value=11  Score=15.11  Aligned_cols=44  Identities=23%  Similarity=0.339  Sum_probs=25.2

Q ss_pred             EEECCCCEEEEEHHHHHHHH--CCCCCC-EEECCCEEEEECCCCCCC
Q ss_conf             99839974882002144541--188997-883495899841667888
Q gi|254780879|r  548 LIHHGNGYVSSYNHQDAIAK--NIKAGT-AVKQGQIIGWIGTTGLST  591 (652)
Q Consensus       548 ~I~H~~Gy~T~YaHlS~~a~--gV~~G~-~V~qGQvIG~vGsTG~ST  591 (652)
                      +|.-.--..-.++-.+.+..  -+++|+ .|+-||+|+++...|-..
T Consensus        43 evEtdK~~~ev~a~~~G~l~~i~v~~Gd~~v~vG~~i~~i~~~~e~~   89 (98)
T 2dnc_A           43 EIETDKAVVTLDASDDGILAKIVVEEGSKNIRLGSLIGLIVEEGEDW   89 (98)
T ss_dssp             EEECSSCEEEEECSSCEEEEECSSCTTCCCEESSCEEEEEECTTSCS
T ss_pred             EEECCCEEEEEECCCCEEEEEEEECCCCEEECCCCEEEEEECCCCCC
T ss_conf             99858389999748998999999768982977999899990387753


No 56 
>2zbv_A Uncharacterized conserved protein; NPPSFA, national project on protein structural and functional analyses; HET: ADN; 2.05A {Thermotoga maritima MSB8} PDB: 2zbu_A*
Probab=45.02  E-value=11  Score=15.00  Aligned_cols=23  Identities=26%  Similarity=0.406  Sum_probs=18.0

Q ss_pred             EEECCCEEEEECCCCCCCCCEEEEEEEECC
Q ss_conf             883495899841667888742688997867
Q gi|254780879|r  574 AVKQGQIIGWIGTTGLSTGPHLHYELIVNG  603 (652)
Q Consensus       574 ~V~qGQvIG~vGsTG~STGPHLHfEv~vnG  603 (652)
                      .|..|+...|.||.|       +.||-+|.
T Consensus       222 ~v~~Ge~~~l~nS~G-------~LEIain~  244 (263)
T 2zbv_A          222 DVDTGELLVHPDSAG-------FLEIAVNL  244 (263)
T ss_dssp             GSCTTCEEEEECTTS-------EEEEEETT
T ss_pred             CCCCCCEEEEECCCC-------CEEEEEEC
T ss_conf             789998999988999-------19999857


No 57 
>2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens}
Probab=44.67  E-value=11  Score=14.96  Aligned_cols=15  Identities=27%  Similarity=0.636  Sum_probs=4.9

Q ss_pred             CCCCEEECCCEEEEE
Q ss_conf             899788349589984
Q gi|254780879|r  570 KAGTAVKQGQIIGWI  584 (652)
Q Consensus       570 ~~G~~V~qGQvIG~v  584 (652)
                      ++|++|++||+|.-+
T Consensus        30 ~~Gd~V~~gd~l~ev   44 (108)
T 2dne_A           30 KEGDKINEGDLIAEV   44 (108)
T ss_dssp             CTTCEECTTSEEEEE
T ss_pred             CCCCEEECCCEEEEE
T ss_conf             699998079989999


No 58 
>2i8g_A Hypothetical protein DIP2269; structural genomics, APC82926, PSI-2, protein structure initiative; HET: MSE; 1.74A {Corynebacterium diphtheriae NCTC13129} SCOP: d.107.1.4
Probab=44.42  E-value=3.4  Score=18.68  Aligned_cols=11  Identities=64%  Similarity=0.978  Sum_probs=4.3

Q ss_pred             EEECCCCCCCE
Q ss_conf             03026796727
Q gi|254780879|r  516 VDWAAPRGTPI  526 (652)
Q Consensus       516 VD~aAp~GTPI  526 (652)
                      ||||||+-+-=
T Consensus        86 VD~aAPi~~t~   96 (151)
T 2i8g_A           86 VDWAAPIDTTE   96 (151)
T ss_dssp             HHHHSCTTTSE
T ss_pred             HHCCCCCCCCC
T ss_conf             52038534578


No 59 
>2ww8_A RRGA, cell WALL surface anchor family protein; IGG, pilus, CNA_B, adhesin, integrin, cell adhesion; HET: EPE; 1.90A {Streptococcus pneumoniae}
Probab=44.27  E-value=3.8  Score=18.30  Aligned_cols=36  Identities=17%  Similarity=0.087  Sum_probs=23.1

Q ss_pred             CCCCEEECCCCEEEEEEEECCCCCEEEEECCCCEEE
Q ss_conf             967279715967999653089700799983997488
Q gi|254780879|r  522 RGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVS  557 (652)
Q Consensus       522 ~GTPI~Aag~G~V~~ag~~~GyGn~V~I~H~~Gy~T  557 (652)
                      ..+-...-.+|.+.+.+=.-|.=.+++.+=+.||.-
T Consensus       777 ~~~~~~T~~~G~~~~~~L~~G~Y~l~EtkAP~GY~~  812 (893)
T 2ww8_A          777 TYQNVRTGEDGKLTFKNLSDGKYRLFENSEPAGYKP  812 (893)
T ss_dssp             TTSSEECCTTCEEEEEEECSEEEEEEEEECCTTBCC
T ss_pred             EEEEEEECCCCEEEECCCCCEEEEEEEEECCCCCCC
T ss_conf             067899689998997988982589999978998661


No 60 
>1y8o_B Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: LPA ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A
Probab=43.71  E-value=12  Score=14.86  Aligned_cols=20  Identities=25%  Similarity=0.258  Sum_probs=11.3

Q ss_pred             CCCCC-EEECCCEEEEECCCC
Q ss_conf             88997-883495899841667
Q gi|254780879|r  569 IKAGT-AVKQGQIIGWIGTTG  588 (652)
Q Consensus       569 V~~G~-~V~qGQvIG~vGsTG  588 (652)
                      |..|. .|+.|++|+++..++
T Consensus        86 v~eGd~~v~vG~~Ia~I~~~~  106 (128)
T 1y8o_B           86 VPEGTRDVPLGTPLCIIVEKE  106 (128)
T ss_dssp             SCTTCCSEETTCEEEEEESSG
T ss_pred             ECCCCEEECCCCEEEEEECCC
T ss_conf             667983881899899993477


No 61 
>2wv9_A Flavivirin protease NS2B regulatory subunit, flavivirin protease NS3 catalytic subunit...; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus}
Probab=42.52  E-value=12  Score=14.74  Aligned_cols=25  Identities=12%  Similarity=0.161  Sum_probs=12.4

Q ss_pred             ECCCCEE---CCCCCCCCCHHHHHHHHH
Q ss_conf             8366200---078878788899999999
Q gi|254780879|r  605 KVDSTKV---RIPERENLKGDLLQRFAM  629 (652)
Q Consensus       605 ~VdP~~~---~lp~~~~l~~~~l~~F~~  629 (652)
                      +.+|..-   .+|..-.|.+.....|..
T Consensus       563 f~~p~~~~~~~~~g~~~L~~~~~~~f~~  590 (673)
T 2wv9_A          563 LYGPERDKTYTMDGEYRLRGEERKTFLE  590 (673)
T ss_dssp             CCGGGGGGCCCCTTTTCCCHHHHHHHHH
T ss_pred             CCCCCHHHHCCCCCEEECCCCCHHHHHH
T ss_conf             6799736600568603002111121566


No 62 
>2r9q_A AGR_C_764P, 2'-deoxycytidine 5'-triphosphate deaminase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.20A {Agrobacterium tumefaciens str}
Probab=41.61  E-value=7.1  Score=16.45  Aligned_cols=78  Identities=17%  Similarity=0.261  Sum_probs=44.6

Q ss_pred             CCCCEEEEEEEE-CCCCCEEEEECCCC-EEEEEHHHHHHHHCCCCCCEEECCCEEEEECCCCCCCCCEEEEEEEECCEEC
Q ss_conf             159679996530-89700799983997-4882002144541188997883495899841667888742688997867883
Q gi|254780879|r  529 VGDGIVEKANWA-GGYGKQTLIHHGNG-YVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKV  606 (652)
Q Consensus       529 ag~G~V~~ag~~-~GyGn~V~I~H~~G-y~T~YaHlS~~a~gV~~G~~V~qGQvIG~vGsTG~STGPHLHfEv~vnG~~V  606 (652)
                      ++.|.+.+|||- .|||-.+....++- ..-..+|-.-|.  |..||+|  +|+| |.=.   ++-|.-.|---.+|+|.
T Consensus       286 ~r~g~~~~agf~DpGf~g~~~~~~g~~~vLev~~~~~p~~--l~~G~~I--~qlv-fe~l---~~~p~~~Yg~~~~s~Yq  357 (370)
T 2r9q_A          286 VGEFRVHYAGFFDPGFGHAQAGGTGSRAVLEVRSHEVPFI--LEHGQIV--GRLV-YEHM---LEKPEGLYGTGLGSNYQ  357 (370)
T ss_dssp             TTTEEEESCCEECTTTTC-----CCEEEEEEEEECSSCEE--EETTCEE--EEEE-EEEB---SSCCC------------
T ss_pred             HCCCEEECCCCCCCCCCCCCCCCCCCEEEEEEECCCCCEE--EECCCEE--EEEE-EEEC---CCCCCCCCCCCCCCCCC
T ss_conf             2582676475176998764455668559999926988869--8389999--9999-9998---78765556887787144


Q ss_pred             CCCEECCCC
Q ss_conf             662000788
Q gi|254780879|r  607 DSTKVRIPE  615 (652)
Q Consensus       607 dP~~~~lp~  615 (652)
                      += .++|.+
T Consensus       358 ~Q-g~~lsK  365 (370)
T 2r9q_A          358 AQ-GLKLSK  365 (370)
T ss_dssp             ---------
T ss_pred             CC-CCCCCH
T ss_conf             88-888122


No 63 
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A
Probab=41.14  E-value=13  Score=14.60  Aligned_cols=52  Identities=15%  Similarity=0.113  Sum_probs=25.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCHHHHHHHCCCCHHHHHHHHHHHHCCCC
Q ss_conf             23342226654456777764013688417970899999749998999999998540156
Q gi|254780879|r  255 IEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVR  313 (652)
Q Consensus       255 ~~en~t~~~~~~~~~~~~~~~e~~v~VK~GDTL~~IL~r~Gvs~~ei~~i~~al~~~~~  313 (652)
                      .=+|+++.-+..   ..+-...-...|++|+.+. |+-..|.-.....++   +.+...
T Consensus         8 ~~~nvs~~Y~~~---~~~vL~~isl~i~~Ge~va-ivG~sGsGKSTLl~l---l~Gl~~   59 (229)
T 2pze_A            8 VMENVTAFWEEG---GTPVLKDINFKIERGQLLA-VAGSTGAGKTSLLMM---IMGELE   59 (229)
T ss_dssp             EEEEEEECSSTT---SCCSEEEEEEEEETTCEEE-EECCTTSSHHHHHHH---HTTSSC
T ss_pred             EEEEEEEEECCC---CCCEEECEEEEECCCCEEE-EECCCCCHHHHHHHH---HHCCCC
T ss_conf             999889993899---9710206289986998999-999998839999999---957877


No 64 
>2axw_A DRAD invasin; homodimer, beta-sandwich, immunoglobulin-like fold, swapped C-terminal strands, cell invasion; HET: GOL; 1.05A {Escherichia coli} SCOP: b.2.3.2
Probab=40.73  E-value=13  Score=14.55  Aligned_cols=11  Identities=18%  Similarity=0.172  Sum_probs=5.7

Q ss_pred             HHCCCCCEEEE
Q ss_conf             01699888999
Q gi|254780879|r  315 DQLTKDEILRI  325 (652)
Q Consensus       315 ~~Lr~Gq~L~I  325 (652)
                      ..|+-|++|-.
T Consensus        13 g~lrDG~~ia~   23 (134)
T 2axw_A           13 TQLRDGAKVAT   23 (134)
T ss_dssp             SCBCTTCEEEE
T ss_pred             CCCCCCCEEEE
T ss_conf             62458869976


No 65 
>1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1
Probab=40.18  E-value=9.8  Score=15.45  Aligned_cols=17  Identities=35%  Similarity=0.521  Sum_probs=12.8

Q ss_pred             CCCCCEEECCCEEEEEC
Q ss_conf             88997883495899841
Q gi|254780879|r  569 IKAGTAVKQGQIIGWIG  585 (652)
Q Consensus       569 V~~G~~V~qGQvIG~vG  585 (652)
                      +++|+.|+-||+|+++.
T Consensus        61 v~~G~~v~vG~~l~~i~   77 (80)
T 1pmr_A           61 EDEGTTVTSRQILGRLR   77 (80)
T ss_dssp             TCTTCEECSSSEEEBCC
T ss_pred             ECCCCEECCCCEEEEEE
T ss_conf             68999987999999997


No 66 
>1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1
Probab=38.78  E-value=14  Score=14.35  Aligned_cols=42  Identities=14%  Similarity=0.316  Sum_probs=24.0

Q ss_pred             EECCCCEEEEEHHHHHHHH--CCCCCCEEECCCEEEEECCCCCC
Q ss_conf             9839974882002144541--18899788349589984166788
Q gi|254780879|r  549 IHHGNGYVSSYNHQDAIAK--NIKAGTAVKQGQIIGWIGTTGLS  590 (652)
Q Consensus       549 I~H~~Gy~T~YaHlS~~a~--gV~~G~~V~qGQvIG~vGsTG~S  590 (652)
                      |....-....++-.+.+.+  .+++|+.|+.||.|+.+-..|-|
T Consensus        38 iEt~K~~~~i~a~~~G~v~~i~v~~G~~V~~G~~l~~ie~~g~a   81 (81)
T 1gjx_A           38 LETDKATMDVPAEVAGVVKEVKVKVGDKISEGGLIVVVEAEGTA   81 (81)
T ss_dssp             EECSSCEEEECCCCSSBBCCCCCCSSCEECSSSCCCEECCSCCC
T ss_pred             EEECCCEEEEECCCCEEEEEEEECCCCEECCCCEEEEEECCCCC
T ss_conf             99388379998055479999982898998899999999456489


No 67 
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA SAP; 2.00A {Rhizobium etli cfn 42}
Probab=38.48  E-value=10  Score=15.31  Aligned_cols=17  Identities=24%  Similarity=0.544  Sum_probs=8.7

Q ss_pred             CCCCCEEECCCEEEEEC
Q ss_conf             88997883495899841
Q gi|254780879|r  569 IKAGTAVKQGQIIGWIG  585 (652)
Q Consensus       569 V~~G~~V~qGQvIG~vG  585 (652)
                      +++|+.|+.||.+..+|
T Consensus      1148 v~~Gd~V~aGq~LvVIg 1164 (1165)
T 2qf7_A         1148 VKAGDQIDAKDLLAVYG 1164 (1165)
T ss_dssp             CCSSCEECTTBEEEEC-
T ss_pred             ECCCCEECCCCEEEEEC
T ss_conf             37959978999899947


No 68 
>2bh8_A 1B11; transcription, molecular evolution, unique architecture, activator, transcription regulation, phosphorylation; 1.9A {Escherichia coli}
Probab=37.22  E-value=13  Score=14.62  Aligned_cols=49  Identities=24%  Similarity=0.266  Sum_probs=27.4

Q ss_pred             CCEEEEEEEECCCCCEEEEECCCCEEEEEHHHHHHHHCCCCCCEEECCCEEE
Q ss_conf             9679996530897007999839974882002144541188997883495899
Q gi|254780879|r  531 DGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIG  582 (652)
Q Consensus       531 ~G~V~~ag~~~GyGn~V~I~H~~Gy~T~YaHlS~~a~gV~~G~~V~qGQvIG  582 (652)
                      .|+|..-.-.+|||-...   .+|=.-.+.|.|.+..+=..=...+.||+|-
T Consensus        18 ~g~vk~f~~~kg~gFi~~---~~g~~d~f~h~SAIq~~G~~~~~l~~G~~V~   66 (101)
T 2bh8_A           18 TGIVKWFNADKGFGFITP---DDGSKDVFVHFSAGSSGAAVRGNPQQGDRVE   66 (101)
T ss_dssp             EEEEEEEEGGGTEEEEEE---SSSSCEEEEECCCSCSSSCCCCCCCTTCEEE
T ss_pred             EEEEEEEECCCCEEEEEC---CCCCHHHHHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             687997858998188724---7896248889876543333331642114999


No 69 
>2x5c_A Hypothetical protein ORF131; viral protein; HET: GOL; 1.80A {Pyrobaculum spherical virus}
Probab=34.73  E-value=16  Score=13.92  Aligned_cols=24  Identities=33%  Similarity=0.573  Sum_probs=12.1

Q ss_pred             CCCEEEEEEEECCCCCEEEEECCCC
Q ss_conf             5967999653089700799983997
Q gi|254780879|r  530 GDGIVEKANWAGGYGKQTLIHHGNG  554 (652)
Q Consensus       530 g~G~V~~ag~~~GyGn~V~I~H~~G  554 (652)
                      +.|.|.-.....|| +|.+|||.+|
T Consensus        60 aegsvsivetkngy-kylvirhpdg   83 (131)
T 2x5c_A           60 AEGSVSIVETKNGY-KYLVIRHPDG   83 (131)
T ss_dssp             CEEEEEEEECTTSC-EEEEEECTTS
T ss_pred             CCCCEEEEEECCCC-EEEEEECCCC
T ss_conf             86626899804881-7999987999


No 70 
>2ytv_A Cold shock domain-containing protein E1; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold; NMR {Homo sapiens}
Probab=34.06  E-value=16  Score=14.02  Aligned_cols=47  Identities=13%  Similarity=0.183  Sum_probs=28.7

Q ss_pred             CCCEEEEEEEECCCCCEEEEECCCCEEEEEHHHHHHHHCCCCCCEEECCCEEEEE
Q ss_conf             5967999653089700799983997488200214454118899788349589984
Q gi|254780879|r  530 GDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWI  584 (652)
Q Consensus       530 g~G~V~~ag~~~GyGn~V~I~H~~Gy~T~YaHlS~~a~gV~~G~~V~qGQvIG~v  584 (652)
                      .-|+|..  |+.|||-.-.  +.++=.-.|-|.|.|.    ...+.+.||.+-|.
T Consensus         9 ~~G~v~s--~k~gfGFI~~--~~~~g~diF~H~s~i~----~~~~L~~G~~V~F~   55 (79)
T 2ytv_A            9 RRATVEC--VKDQFGFINY--EVGDSKKLFFHVKEVQ----DGIELQAGDEVEFS   55 (79)
T ss_dssp             CCEEEEE--CCSSEEEESC--CCSSSSSEEEETTTCC----SSCCCCTTCEEECB
T ss_pred             EEEEEEE--ECCCEEEEEE--CCCCCCEEEEEHHHCC----CCCCCCCCCEEEEE
T ss_conf             7899989--4597117770--6889966999978858----98757999999999


No 71 
>1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A
Probab=33.53  E-value=17  Score=13.79  Aligned_cols=28  Identities=21%  Similarity=0.120  Sum_probs=21.3

Q ss_pred             CCCCCEEECCCEEEEECCCCCCCCCEEE
Q ss_conf             8899788349589984166788874268
Q gi|254780879|r  569 IKAGTAVKQGQIIGWIGTTGLSTGPHLH  596 (652)
Q Consensus       569 V~~G~~V~qGQvIG~vGsTG~STGPHLH  596 (652)
                      +++|+.|+.||+|+.+-..+..--=|-|
T Consensus        63 v~eG~~V~~G~~L~~Ie~e~~~d~E~~~   90 (93)
T 1k8m_A           63 YNLDDIAYVGKPLVDIETEALKDLEHHH   90 (93)
T ss_dssp             CCSSCEECTTSEEEEEECSCCTTTC---
T ss_pred             ECCCCEECCCCEEEEEECCCCCCCCCCC
T ss_conf             3899998899999999777875520002


No 72 
>3h9i_A Cation efflux system protein CUSB; three-helix bundle, beta barrel, copper, copper transport, ION transport, transport, transport protein; 3.40A {Escherichia coli k-12} PDB: 3h94_A 3h9t_B
Probab=33.39  E-value=13  Score=14.56  Aligned_cols=31  Identities=3%  Similarity=-0.138  Sum_probs=14.1

Q ss_pred             HHCCCCCEEEEEEEEECCCCCCCCCCCEEEEEEE
Q ss_conf             1014454068875321157851246723688962
Q gi|254780879|r  419 EHLKPTDFLETFFSVNHANNQASDDSELLYIHAR  452 (652)
Q Consensus       419 r~ir~GD~f~Vlye~~~~~g~~~~~geil~A~~~  452 (652)
                      ..++.|+..++......   ...-.+.+.+....
T Consensus       256 ~~l~~G~~v~v~~~~~~---~~~~~g~v~~i~p~  286 (407)
T 3h9i_A          256 WLVKDASQFTLTVPARP---DKTLTIRKWTLLPG  286 (407)
T ss_dssp             HHCCCTTSEEEECSSSC---CSCCCEEEEEEEEE
T ss_pred             HHHCCCCEEEEEECCCC---CCCCCEEEEEECCC
T ss_conf             32035846999975788---53122158997140


No 73 
>1l5p_A Ferredoxin; [2Fe-2S] cluster, electron transfer, iron-sulfur protein, metalloprotein, oxidoreductase; 2.20A {Trichomonas vaginalis} SCOP: d.15.4.1
Probab=32.75  E-value=17  Score=13.71  Aligned_cols=23  Identities=17%  Similarity=0.439  Sum_probs=19.6

Q ss_pred             CEEEEEECCCCCHHHHHHHCCCC
Q ss_conf             01368841797089999974999
Q gi|254780879|r  275 ADDLIPIQHNTTIFDAMVHAGYS  297 (652)
Q Consensus       275 ~e~~v~VK~GDTL~~IL~r~Gvs  297 (652)
                      .++.+.+..|+||.+++.++|++
T Consensus        10 ~~~~i~~~~G~tLl~al~~~gi~   32 (93)
T 1l5p_A           10 VKKQLKFEDDQTLFTVLTEAGLM   32 (93)
T ss_dssp             EEEEEECCTTEEHHHHHHTTTSS
T ss_pred             EEEEEEECCCHHHHHHHHHCCCC
T ss_conf             39999957972899999872888


No 74 
>1vf5_C Cytochrome F; photosynthesis, membrane protein complex, electron transfer complex; HET: HEM TDS PL9 OPC CLA BCR; 3.00A {Mastigocladus laminosus} SCOP: b.2.6.1 b.84.2.2 f.23.23.1 PDB: 2d2c_C* 2e74_C* 2e75_C* 2e76_C* 2zt9_C*
Probab=32.50  E-value=2.8  Score=19.29  Aligned_cols=80  Identities=20%  Similarity=0.189  Sum_probs=48.7

Q ss_pred             CCCEEECCCCEEEEEEEE-CC---CCCEEEEECCCCE---EEEEHHHHHHHHCCCCCCEEECCCEEEEECCCCCCCCCEE
Q ss_conf             672797159679996530-89---7007999839974---8820021445411889978834958998416678887426
Q gi|254780879|r  523 GTPIVAVGDGIVEKANWA-GG---YGKQTLIHHGNGY---VSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHL  595 (652)
Q Consensus       523 GTPI~Aag~G~V~~ag~~-~G---yGn~V~I~H~~Gy---~T~YaHlS~~a~gV~~G~~V~qGQvIG~vGsTG~STGPHL  595 (652)
                      -|..-|...|+|...... .|   .|..|.|...+|-   +|.-+-..-+   |++|+.|+.||-+-.==+-|---  +.
T Consensus       169 N~v~~as~~G~I~~I~~~e~g~~~~~~~v~I~~~~G~~v~~~IP~Gpeli---V~~G~~v~~dqpLT~nPNVGGFG--Q~  243 (289)
T 1vf5_C          169 NNVFTASATGTITKIAKEEDEYGNVKYQVSIQTDSGKTVVDTIPAGPELI---VSEGQAVKAGEALTNNPNVGGFG--QD  243 (289)
T ss_dssp             SSCCCCSSSSCCCBCCCCCCCSSCCCCCCBCCCCSSSCCCCCCCSSSCCC---CCTTCCCTTSCCCSCCCCCCCBE--EE
T ss_pred             CCEECCCCCEEEEEEEECCCCCCCCCEEEEEECCCCCEEEEECCCCCEEE---EECCCEEECCCCCCCCCCCCCCC--CC
T ss_conf             72563667748889773457787740799997899989878618998588---70797685698555699856667--66


Q ss_pred             EEEEEECCEECCCCEE
Q ss_conf             8899786788366200
Q gi|254780879|r  596 HYELIVNGIKVDSTKV  611 (652)
Q Consensus       596 HfEv~vnG~~VdP~~~  611 (652)
                      .-||.    -.||.|+
T Consensus       244 d~EIV----LQ~p~Ri  255 (289)
T 1vf5_C          244 DTEIV----LQDPNRV  255 (289)
T ss_dssp             EEEEE----ECCHHHH
T ss_pred             CEEEE----EECHHHH
T ss_conf             15999----5173188


No 75 
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens}
Probab=30.52  E-value=19  Score=13.46  Aligned_cols=15  Identities=13%  Similarity=0.361  Sum_probs=6.8

Q ss_pred             CCEEECCCCEEEEEE
Q ss_conf             727971596799965
Q gi|254780879|r  524 TPIVAVGDGIVEKAN  538 (652)
Q Consensus       524 TPI~Aag~G~V~~ag  538 (652)
                      .-|+--.+|.|+..|
T Consensus       196 D~Iivl~~G~Iv~~G  210 (237)
T 2cbz_A          196 DVIIVMSGGKISEMG  210 (237)
T ss_dssp             SEEEEEETTEEEEEE
T ss_pred             CEEEEEECCEEEEEC
T ss_conf             999999899999988


No 76 
>2kw8_A LPXTG-SITE transpeptidase family protein; sortase, SRTA, protein binding; NMR {Bacillus anthracis}
Probab=29.81  E-value=18  Score=13.51  Aligned_cols=12  Identities=17%  Similarity=0.412  Sum_probs=5.3

Q ss_pred             HHHCCCCCEEEE
Q ss_conf             101699888999
Q gi|254780879|r  314 VDQLTKDEILRI  325 (652)
Q Consensus       314 ~~~Lr~Gq~L~I  325 (652)
                      +.+|+.|+.+.+
T Consensus        86 L~~l~~gd~i~l   97 (158)
T 2kw8_A           86 IASLKKGDKIYL   97 (158)
T ss_dssp             GGGCCTTCEEEE
T ss_pred             HHHCCCCCEEEE
T ss_conf             665769998999


No 77 
>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8}
Probab=28.58  E-value=20  Score=13.23  Aligned_cols=22  Identities=23%  Similarity=0.247  Sum_probs=9.9

Q ss_pred             CEEECCCCCCCEEECCCCEEEE
Q ss_conf             0030267967279715967999
Q gi|254780879|r  515 GVDWAAPRGTPIVAVGDGIVEK  536 (652)
Q Consensus       515 GVD~aAp~GTPI~Aag~G~V~~  536 (652)
                      |=|+..|.-|-+++.-||.+..
T Consensus       336 ~~D~s~pi~~~~~si~dg~i~L  357 (515)
T 2r9v_A          336 ANDISAYIPTNVISITDGQIYL  357 (515)
T ss_dssp             TTCTTSHHHHHHHHTSSEEEEB
T ss_pred             CCCCCCCHHHHHHHHCCEEEEE
T ss_conf             8777776667777445749998


No 78 
>2f4n_A Hypothetical protein MJ1651; conserved hypothetical protein, mehtanococcus jannaschii, structural genomics, PSI; 2.50A {Methanocaldococcus jannaschii}
Probab=27.74  E-value=19  Score=13.45  Aligned_cols=19  Identities=21%  Similarity=0.300  Sum_probs=12.0

Q ss_pred             CCCEEEEECCCCCCCCCEEEEEEEEC
Q ss_conf             49589984166788874268899786
Q gi|254780879|r  577 QGQIIGWIGTTGLSTGPHLHYELIVN  602 (652)
Q Consensus       577 qGQvIG~vGsTG~STGPHLHfEv~vn  602 (652)
                      .|+.++|+||.|       .+||-+|
T Consensus       227 ~G~~~al~nS~G-------~LEIAin  245 (273)
T 2f4n_A          227 KNNFICLINSEG-------FLEISKF  245 (273)
T ss_dssp             TTSCEEEECTTS-------CEEEECT
T ss_pred             CCCEEEEECCCC-------CEEEEEE
T ss_conf             998899988999-------3999997


No 79 
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C*
Probab=27.59  E-value=21  Score=13.12  Aligned_cols=14  Identities=7%  Similarity=-0.021  Sum_probs=4.5

Q ss_pred             CCEEECCCCEEEEE
Q ss_conf             72797159679996
Q gi|254780879|r  524 TPIVAVGDGIVEKA  537 (652)
Q Consensus       524 TPI~Aag~G~V~~a  537 (652)
                      .-|+.-.+|+|+..
T Consensus       201 dri~vl~~G~i~~~  214 (249)
T 2qi9_C          201 HRAWLLKGGKMLAS  214 (249)
T ss_dssp             SEEEEEETTEEEEE
T ss_pred             CEEEEEECCEEEEE
T ss_conf             99999989989998


No 80 
>2dk3_A E3 ubiquitin-protein ligase hectd1; MIB-HERC2 domain, HECT domain containing protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.19.1
Probab=27.45  E-value=21  Score=13.13  Aligned_cols=21  Identities=10%  Similarity=0.262  Sum_probs=9.0

Q ss_pred             EEEEECCCCCEEEEECCCCEE
Q ss_conf             965308970079998399748
Q gi|254780879|r  536 KANWAGGYGKQTLIHHGNGYV  556 (652)
Q Consensus       536 ~ag~~~GyGn~V~I~H~~Gy~  556 (652)
                      ..-|..|.-|.-++-|.+.|-
T Consensus        53 ~V~Wd~G~~n~YR~G~~G~~D   73 (86)
T 2dk3_A           53 DVTWDAGGSNSYRMGAEGKFD   73 (86)
T ss_dssp             EEEETTTEEEEEEBSTTSCBC
T ss_pred             EEEECCCCCEEECCCCCCCEE
T ss_conf             999689995010135899766


No 81 
>1rr7_A Middle operon regulator; MOR, transcription; 2.20A {Enterobacteria phage MU} SCOP: a.4.1.14
Probab=27.28  E-value=21  Score=13.08  Aligned_cols=29  Identities=7%  Similarity=0.109  Sum_probs=22.0

Q ss_pred             CCCCHHHHHHHCCCCHHHHHHHHHHHHCC
Q ss_conf             79708999997499989999999985401
Q gi|254780879|r  283 HNTTIFDAMVHAGYSNGDSAKIAKALKNE  311 (652)
Q Consensus       283 ~GDTL~~IL~r~Gvs~~ei~~i~~al~~~  311 (652)
                      .|.++..++++||++...|.+|+......
T Consensus        91 ~G~n~~eLArkY~LS~r~I~~Ii~~~rk~  119 (129)
T 1rr7_A           91 NGRNVSELTTRYGVTFNTVYKAIRRMRRL  119 (129)
T ss_dssp             CSSCHHHHHHHHTCCHHHHHHHHHHHHHC
T ss_pred             CCCCHHHHHHHHCCCHHHHHHHHHHHHHH
T ss_conf             89989999999897899999999999999


No 82 
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A
Probab=26.48  E-value=15  Score=14.05  Aligned_cols=16  Identities=31%  Similarity=0.476  Sum_probs=10.1

Q ss_pred             CCCCCEEECCCEEEEE
Q ss_conf             8899788349589984
Q gi|254780879|r  569 IKAGTAVKQGQIIGWI  584 (652)
Q Consensus       569 V~~G~~V~qGQvIG~v  584 (652)
                      |++|++|++||.+..+
T Consensus       665 V~~Gd~V~~G~~l~vl  680 (718)
T 3bg3_A          665 VVAGAKVAKGQPLCVL  680 (718)
T ss_dssp             SCTTCCBCTTCCCEEE
T ss_pred             ECCCCEECCCCEEEEE
T ss_conf             6999987999999999


No 83 
>1czp_A Ferredoxin I; [2Fe-2S] protein, crystal reduced with dithionite, electron transport; 1.17A {Nostoc SP} SCOP: d.15.4.1 PDB: 1ewy_C* 1fxa_A 1qt9_A 1qog_A 1j7c_A 1j7b_A 1qof_A 1qob_A 1j7a_A 1qoa_A 1rfk_A 4fxc_A 1roe_A 2cjn_A 2cjo_A 1off_A 1dox_A 1doy_A 2kaj_A 2pvg_C ...
Probab=26.39  E-value=22  Score=12.97  Aligned_cols=22  Identities=27%  Similarity=0.466  Sum_probs=19.3

Q ss_pred             EEEEEECCCCCHHHHHHHCCCC
Q ss_conf             1368841797089999974999
Q gi|254780879|r  276 DDLIPIQHNTTIFDAMVHAGYS  297 (652)
Q Consensus       276 e~~v~VK~GDTL~~IL~r~Gvs  297 (652)
                      ++.+.|.+|+||.+++.++|+.
T Consensus        15 ~~~~~v~~g~tlLdaa~~~Gi~   36 (98)
T 1czp_A           15 KHEIEVPDDEYILDAAEEQGYD   36 (98)
T ss_dssp             EEEEEEETTSCHHHHHHHTTCC
T ss_pred             EEEEEECCCCCHHHHHHHCCCC
T ss_conf             7999969598199999985999


No 84 
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi}
Probab=26.37  E-value=22  Score=12.97  Aligned_cols=15  Identities=33%  Similarity=0.986  Sum_probs=11.3

Q ss_pred             EEECCCEEEEECCCC
Q ss_conf             883495899841667
Q gi|254780879|r  574 AVKQGQIIGWIGTTG  588 (652)
Q Consensus       574 ~V~qGQvIG~vGsTG  588 (652)
                      .|++|++||.+|-.|
T Consensus       378 ~i~~GEiv~i~G~NG  392 (607)
T 3bk7_A          378 EIRKGEVIGIVGPNG  392 (607)
T ss_dssp             EEETTCEEEEECCTT
T ss_pred             CCCCCCEEEEECCCC
T ss_conf             778974899977888


No 85 
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A*
Probab=25.55  E-value=23  Score=12.87  Aligned_cols=13  Identities=23%  Similarity=0.348  Sum_probs=4.7

Q ss_pred             EEECCCCEEEEEE
Q ss_conf             7971596799965
Q gi|254780879|r  526 IVAVGDGIVEKAN  538 (652)
Q Consensus       526 I~Aag~G~V~~ag  538 (652)
                      |+--.+|.|+..|
T Consensus       226 Iivl~~G~Ive~G  238 (271)
T 2ixe_A          226 ILFLKEGSVCEQG  238 (271)
T ss_dssp             EEEEETTEEEEEE
T ss_pred             EEEEECCEEEEEC
T ss_conf             9999899999989


No 86 
>1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A
Probab=25.45  E-value=23  Score=12.86  Aligned_cols=42  Identities=14%  Similarity=0.239  Sum_probs=24.5

Q ss_pred             EEECCCCEEEEEHHHHHHHH--CCCCCCEEECCCEEEEECCCCC
Q ss_conf             99839974882002144541--1889978834958998416678
Q gi|254780879|r  548 LIHHGNGYVSSYNHQDAIAK--NIKAGTAVKQGQIIGWIGTTGL  589 (652)
Q Consensus       548 ~I~H~~Gy~T~YaHlS~~a~--gV~~G~~V~qGQvIG~vGsTG~  589 (652)
                      .|....-.....+..+....  .++.|+.|..||.|..+--++-
T Consensus        34 ~iE~~K~~~~i~a~~~G~v~~i~v~~G~~V~~G~~l~~ie~~~~   77 (79)
T 1iyu_A           34 VLESAKASMEVPSPKAGVVKSVSVKLGDKLKEGDAIIELEPAAG   77 (79)
T ss_dssp             EEECSSCEEEEECSSSSEEEEESCCTTCEEETTSEEEEEECCCS
T ss_pred             EEEECCCEEEEECCCCEEEEEEEECCCCEECCCCEEEEEECCCC
T ss_conf             99956715899879899999993589699899999999947867


No 87 
>2cw5_A Bacterial fluorinating enzyme homolog; alpha and beta protein (A/B), beta barrel, structural genomics, NPPSFA; 1.94A {Thermus thermophilus}
Probab=25.03  E-value=23  Score=12.80  Aligned_cols=27  Identities=26%  Similarity=0.495  Sum_probs=19.9

Q ss_pred             CCCCEEECCCEEEEECCCCCCCCCEEEEEEEECC
Q ss_conf             8997883495899841667888742688997867
Q gi|254780879|r  570 KAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNG  603 (652)
Q Consensus       570 ~~G~~V~qGQvIG~vGsTG~STGPHLHfEv~vnG  603 (652)
                      +.=..|..|+...|.||.|       ++||-+|+
T Consensus       211 ~ty~dv~~G~~~~l~nS~G-------~LEIain~  237 (255)
T 2cw5_A          211 RTFGEVPEGAPVAYLGSAG-------LLEVAVNR  237 (255)
T ss_dssp             SSTTSSCTTCEEEEECTTS-------SEEEEETT
T ss_pred             ECCCCCCCCCEEEEECCCC-------CEEEEEEC
T ss_conf             7044568999899989999-------49999847


No 88 
>3lxf_A Ferredoxin; iron, iron-sulfur, metal-binding, metal protein; 2.30A {Novosphingobium aromaticivorans}
Probab=24.43  E-value=24  Score=12.73  Aligned_cols=23  Identities=17%  Similarity=0.309  Sum_probs=19.3

Q ss_pred             CEEEEEECCCCCHHHHHHHCCCC
Q ss_conf             01368841797089999974999
Q gi|254780879|r  275 ADDLIPIQHNTTIFDAMVHAGYS  297 (652)
Q Consensus       275 ~e~~v~VK~GDTL~~IL~r~Gvs  297 (652)
                      .++.+.+..|+||.+++.++|++
T Consensus        11 ~~~~v~~~~G~tLl~a~~~~gi~   33 (104)
T 3lxf_A           11 TRTEIQAEPGLSLMEALRDAGID   33 (104)
T ss_dssp             CEEEEECCTTSBHHHHHHHTTCT
T ss_pred             CEEEEEECCCCHHHHHHHHCCCC
T ss_conf             99999869987599999875998


No 89 
>3bbo_X Ribosomal protein L27; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Arabidopsis thaliana} SCOP: i.1.1.1
Probab=23.84  E-value=6.3  Score=16.80  Aligned_cols=86  Identities=14%  Similarity=0.123  Sum_probs=43.9

Q ss_pred             CCCCCCCCCCCCCCCCCEEECCCCCCCEEECCCCEEEEEEEECCCCCEEEEECCCCE---EEEEH-HHHHHHHCCCCCCE
Q ss_conf             676414340443464200302679672797159679996530897007999839974---88200-21445411889978
Q gi|254780879|r  499 FGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGY---VSSYN-HQDAIAKNIKAGTA  574 (652)
Q Consensus       499 Fg~R~hPilg~~r~H~GVD~aAp~GTPI~Aag~G~V~~ag~~~GyGn~V~I~H~~Gy---~T~Ya-HlS~~a~gV~~G~~  574 (652)
                      -|.+.||-.+         -.-..-.-|+|.-+|+|.|- +..---++|.|--.+..   .-.|. .-.++. .|..|++
T Consensus        98 rgt~~~pG~n---------v~~GKD~TI~A~~~G~V~F~-k~~k~kk~V~V~P~d~~~e~p~ey~ipK~k~i-~V~egd~  166 (198)
T 3bbo_X           98 RGTKFHAGKN---------VGIGKDHTIFSLIDGLVKFE-KFGPDRKKISVYPREIVPENPNSYRARKRENF-RLQREKK  166 (198)
T ss_dssp             CCCSSCCCCS---------SSSCCCCCSBCCSCCCCCSS-SSCCCCSCCCSSCCCCC-----------------------
T ss_pred             CCCEECCCCC---------EEECCCCCEEECCCEEEEEE-ECCCCCEEEEEEECCCCCCCCCCCCCCCCCCE-ECCCCCE
T ss_conf             7872528887---------50168887786566799999-83899989999979867779651211425503-0267762


Q ss_pred             EECCCEEEEECCCCCCCCCEEEEEEE
Q ss_conf             83495899841667888742688997
Q gi|254780879|r  575 VKQGQIIGWIGTTGLSTGPHLHYELI  600 (652)
Q Consensus       575 V~qGQvIG~vGsTG~STGPHLHfEv~  600 (652)
                      |.+|+.+-.    | +.-||+=..+.
T Consensus       167 v~kgE~l~d----G-~p~PhdIL~i~  187 (198)
T 3bbo_X          167 KARRENYSY----T-LPTPELVLASA  187 (198)
T ss_dssp             --------------------------
T ss_pred             EECCEEECC----C-CCCHHHHHHHH
T ss_conf             430303124----7-99888976653


No 90 
>2eo4_A 150AA long hypothetical histidine triad nucleotide-binding protein; HIT family, structural genomics, NPPSFA; 1.80A {Sulfolobus tokodaii}
Probab=22.83  E-value=26  Score=12.52  Aligned_cols=49  Identities=22%  Similarity=0.228  Sum_probs=24.6

Q ss_pred             CCCCEEEEEEE--ECCEECCCCEECCCCCCCCCHHHHHHHHH-HHHHHHHHHH
Q ss_conf             88742688997--86788366200078878788899999999-9999999984
Q gi|254780879|r  590 STGPHLHYELI--VNGIKVDSTKVRIPERENLKGDLLQRFAM-EKKRINSLLN  639 (652)
Q Consensus       590 STGPHLHfEv~--vnG~~VdP~~~~lp~~~~l~~~~l~~F~~-~~~~id~ll~  639 (652)
                      .+-||||+.|.  .+|...|+...-.| .+..+....+.+.+ -|+.+..|-.
T Consensus        90 q~v~H~H~HiiPR~~~d~~~~~~~~~~-~~~~~~e~~~~~~~~ire~le~l~~  141 (149)
T 2eo4_A           90 QVIFHLHVHIIPTWEGDYPDIFKSFKP-RKEQEKEYYELLQKIIRESIENLKR  141 (149)
T ss_dssp             CCSCSCCEEEEEECSSCCCTTSCCCCT-TSCCCHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCEEEEEEECCCCCCCCCCCCCCCC-CCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             542779999848757988753345565-6678399999999999999999999


No 91 
>3hui_A Ferredoxin; cytochrome P450, electron transfer, iron, iron-sulfur, metal-binding, electron transport; 2.01A {Rhodopseudomonas palustris}
Probab=22.72  E-value=26  Score=12.50  Aligned_cols=23  Identities=9%  Similarity=0.326  Sum_probs=19.0

Q ss_pred             CEEEEEECCCCCHHHHHHHCCCC
Q ss_conf             01368841797089999974999
Q gi|254780879|r  275 ADDLIPIQHNTTIFDAMVHAGYS  297 (652)
Q Consensus       275 ~e~~v~VK~GDTL~~IL~r~Gvs  297 (652)
                      .++.+.+..|+||.+++.++|++
T Consensus        32 ~~~~v~~~~G~tLl~aa~~~gi~   54 (126)
T 3hui_A           32 ETRTVEVEEGATVMEAAIRNAIP   54 (126)
T ss_dssp             CEEEEEEETTSBHHHHHHTTTCT
T ss_pred             CEEEEEECCCCHHHHHHHHCCCC
T ss_conf             88999969982699999984997


No 92 
>2wlb_A ETP1-FD, electron transfer protein 1, mitochondrial; iron-sulfur, iron, transport, ferredoxin, adrenodoxin-like, electron transport; 2.60A {Schizosaccharomyces pombe}
Probab=22.56  E-value=26  Score=12.48  Aligned_cols=23  Identities=13%  Similarity=0.133  Sum_probs=19.0

Q ss_pred             CEEEEEECCCCCHHHHHHHCCCC
Q ss_conf             01368841797089999974999
Q gi|254780879|r  275 ADDLIPIQHNTTIFDAMVHAGYS  297 (652)
Q Consensus       275 ~e~~v~VK~GDTL~~IL~r~Gvs  297 (652)
                      .+..+.+..|+||.+++.++|++
T Consensus        14 ~~~~v~~~~G~tLl~a~~~~gi~   36 (103)
T 2wlb_A           14 REIMIEGNEGDSILDLAHANNID   36 (103)
T ss_dssp             CEEEEEECTTCBHHHHHHHTTCC
T ss_pred             CEEEEEECCCCHHHHHHHHCCCC
T ss_conf             89999879998299999986989


No 93 
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str}
Probab=22.46  E-value=26  Score=12.47  Aligned_cols=17  Identities=12%  Similarity=0.253  Sum_probs=10.0

Q ss_pred             CCCEEECCCCEEEEEEE
Q ss_conf             67279715967999653
Q gi|254780879|r  523 GTPIVAVGDGIVEKANW  539 (652)
Q Consensus       523 GTPI~Aag~G~V~~ag~  539 (652)
                      -.-|+--.+|+|+..|.
T Consensus       220 ~D~Iivl~~G~iv~~G~  236 (260)
T 2ghi_A          220 AESIILLNKGKIVEKGT  236 (260)
T ss_dssp             CSEEEEEETTEEEEEEC
T ss_pred             CCEEEEEECCEEEEECC
T ss_conf             99999998999999889


No 94 
>1xlq_A Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidoreductase; 1.45A {Pseudomonas putida} SCOP: d.15.4.1 PDB: 1xlp_A 1oqr_A 1r7s_A 1pdx_A 1yji_A 1yjj_A 1oqq_A 1xln_A 1xlo_A 3lb8_C* 1put_A 1gpx_A
Probab=22.34  E-value=26  Score=12.45  Aligned_cols=23  Identities=13%  Similarity=0.268  Sum_probs=18.9

Q ss_pred             CEEEEEECCCCCHHHHHHHCCCC
Q ss_conf             01368841797089999974999
Q gi|254780879|r  275 ADDLIPIQHNTTIFDAMVHAGYS  297 (652)
Q Consensus       275 ~e~~v~VK~GDTL~~IL~r~Gvs  297 (652)
                      ..+.+.+..|+||.+++.++|++
T Consensus        11 ~~~~i~~~~G~tLl~a~~~~gi~   33 (106)
T 1xlq_A           11 TRRELDVADGVSLMQAAVSNGIY   33 (106)
T ss_dssp             CEEEEECCTTCBHHHHHHHTTCT
T ss_pred             CEEEEEECCCCHHHHHHHHCCCC
T ss_conf             89999959984599999974987


No 95 
>2elh_A CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster}
Probab=21.95  E-value=27  Score=12.40  Aligned_cols=31  Identities=10%  Similarity=0.015  Sum_probs=25.6

Q ss_pred             ECCCCCHHHHHHHCCCCHHHHHHHHHHHHCC
Q ss_conf             4179708999997499989999999985401
Q gi|254780879|r  281 IQHNTTIFDAMVHAGYSNGDSAKIAKALKNE  311 (652)
Q Consensus       281 VK~GDTL~~IL~r~Gvs~~ei~~i~~al~~~  311 (652)
                      +..|.++..|++++|++...+..+.+.....
T Consensus        35 ~e~G~s~~~vAre~gi~~stl~~W~k~~~~~   65 (87)
T 2elh_A           35 IHDGESKASVARDIGVPESTLRGWCKNEDKL   65 (87)
T ss_dssp             HHHTCCHHHHHHHHTCCHHHHHHHHHHHHHH
T ss_pred             HHCCCCHHHHHHHHCCCHHHHHHHHHHHHHH
T ss_conf             9879999999999797998999999999998


Done!