BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780879|ref|YP_003065292.1| hypothetical protein
CLIBASIA_03880 [Candidatus Liberibacter asiaticus str. psy62]
         (652 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780879|ref|YP_003065292.1| hypothetical protein CLIBASIA_03880 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040556|gb|ACT57352.1| hypothetical protein CLIBASIA_03880 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 652

 Score =  641 bits (1652), Expect = 0.0,   Method: Composition-based stats.
 Identities = 652/652 (100%), Positives = 652/652 (100%)

Query: 1   MTLCTISNKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGS 60
           MTLCTISNKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGS
Sbjct: 1   MTLCTISNKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGS 60

Query: 61  LLTALDGHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTL 120
           LLTALDGHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTL
Sbjct: 61  LLTALDGHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTL 120

Query: 121 IKDHNKDIIKKIPFAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVD 180
           IKDHNKDIIKKIPFAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVD
Sbjct: 121 IKDHNKDIIKKIPFAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVD 180

Query: 181 SFEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQ 240
           SFEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQ
Sbjct: 181 SFEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQ 240

Query: 241 RHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGD 300
           RHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGD
Sbjct: 241 RHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGD 300

Query: 301 SAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYV 360
           SAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYV
Sbjct: 301 SAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYV 360

Query: 361 LGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEH 420
           LGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEH
Sbjct: 361 LGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEH 420

Query: 421 LKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKS 480
           LKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKS
Sbjct: 421 LKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKS 480

Query: 481 SRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWA 540
           SRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWA
Sbjct: 481 SRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWA 540

Query: 541 GGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELI 600
           GGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELI
Sbjct: 541 GGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELI 600

Query: 601 VNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
           VNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH
Sbjct: 601 VNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652


>gi|319781353|ref|YP_004140829.1| peptidase M23 [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317167241|gb|ADV10779.1| Peptidase M23 [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 677

 Score =  614 bits (1584), Expect = e-173,   Method: Composition-based stats.
 Identities = 238/654 (36%), Positives = 364/654 (55%), Gaps = 13/654 (1%)

Query: 6   ISNKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTAL 65
           + +  D++   G+ PP++ +        +RR+VS RWLS TF  G+TS V++G +L  AL
Sbjct: 25  MPDTEDVIAELGNEPPLIADGR--SGPPDRREVSARWLSGTFLTGVTSSVLMGVALFAAL 82

Query: 66  DGHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHN 125
           DG Q++A P +++   S     N  +   +     ++P+  +K  ++  +EV  + K  +
Sbjct: 83  DGRQQLATPPEIAELISLAG--NGDSGEVAKTTRLVAPRQIAKAKDRRRMEVSMVTKVGD 140

Query: 126 KDIIKKIPFAYARMTFATPYPKVKDHPKFDPLKIFSEGK--IESSSQMLMDTIHNVD-SF 182
           +D+I  +PF   +M  A  +   + +P FDP+++F +        +      I+      
Sbjct: 141 RDVIHTMPFVQIKMALAAGHTTSRAYPPFDPMQVFGDDGDDNAQPATAASGQIYGAKVES 200

Query: 183 EVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRH 242
           E++ + ++FP D            +E++  +      L +   Q  +L+Y DPQ   +  
Sbjct: 201 EMSLKTVDFPIDTASFDEKSDLSADEVEKVVREAGTDLSDGAVQVASLHYVDPQRFGEAF 260

Query: 243 DHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSA 302
              +  S  +KI+ EN ++     + D+ P FA+++IP   +  + +A   +GY+  D+ 
Sbjct: 261 AESMAGSYDVKIVPENVSVAPRATVDDQAPAFAEEIIPFTKDLDVTEAFADSGYTGEDAT 320

Query: 303 KIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLG 362
            +A+A+   +    L    +LR+G+    D   +VR S+Y + +H++TIALND  +YV  
Sbjct: 321 GMAEAIAKLLNATALKAGTVLRVGLEVHGDAAKVVRTSVYDRTQHIVTIALNDRGQYVPA 380

Query: 363 VEPVKMDINHQMDY-----MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNL 417
            EP                +      PN+YDGI+RA    GM+  + + +++ LAS V+ 
Sbjct: 381 QEPDPNPELLTAFDDSSAPVVVRGNLPNVYDGIYRAAYSYGMSKAMTQRLIKLLASDVDF 440

Query: 418 QEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNEN 477
           Q  L P D +E  FS    ++Q SD SELLY+ A FG     FYRF        +YF+E+
Sbjct: 441 QSRLSPADRIEVLFSQPDGDDQTSDSSELLYVSATFGGQTRNFYRFQMQDG-GTDYFDED 499

Query: 478 GKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKA 537
           G S+  FLLR P+P G+  SGFG R HPILGY RMHTGVDWAAP GTPI+A G+G VEK 
Sbjct: 500 GSSAEQFLLRNPLPAGKFRSGFGARRHPILGYVRMHTGVDWAAPIGTPIIAAGNGTVEKV 559

Query: 538 NWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHY 597
            WAGGYGKQ +I H NGY +SYNHQ A AK I+ G  V+QGQ IG++G TGL+TGPHLHY
Sbjct: 560 GWAGGYGKQIIIRHANGYETSYNHQSAFAKGIEPGVHVRQGQTIGFLGQTGLATGPHLHY 619

Query: 598 ELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTS 651
           ELIVNG KVD  +VR+P  + LKGD L  F  E++RI+ LL   ++    + ++
Sbjct: 620 ELIVNGTKVDPMRVRLPVGKVLKGDDLVAFKRERERIDELLKQEDSDSLKVASA 673


>gi|227823184|ref|YP_002827156.1| putative metalloendopeptidase [Sinorhizobium fredii NGR234]
 gi|227342185|gb|ACP26403.1| putative metalloendopeptidase [Sinorhizobium fredii NGR234]
          Length = 651

 Score =  613 bits (1580), Expect = e-173,   Method: Composition-based stats.
 Identities = 281/647 (43%), Positives = 407/647 (62%), Gaps = 13/647 (2%)

Query: 6   ISNKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTAL 65
           + + R++L S GD PPIL +        +RR++S+RWLS TF  GITS +++G +L  AL
Sbjct: 1   MISNRNMLRSLGDQPPILADGRRA---PDRREISMRWLSGTFLTGITSSLLMGVALFAAL 57

Query: 66  DGHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHN 125
           DG Q++AIPA+                 +      LSP   +K  +K ++EV T+I D  
Sbjct: 58  DGRQQLAIPAEAFAALDPAAPGAAPISAAKRGNRILSPNIVAKPADKTVMEVSTMIHDGE 117

Query: 126 KDIIKKIPFAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQML-MDTIHNVD-SFE 183
           K+++++ PF + +M  A  +   +D+P FDPL IFS  + E+        TI+  D   E
Sbjct: 118 KEVVRRRPFVHVKMALAANHQASQDYPAFDPLAIFSTNEAEAEPPPAKTGTIYGSDVESE 177

Query: 184 VTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHD 243
           V  + +NFP   +      +   +E++  +     +L     Q  +L+Y DPQ      D
Sbjct: 178 VALKTVNFPVKGSGFSFAPSMSLDEVEENVRTNGSVLTEGNTQVASLFYVDPQRFASDTD 237

Query: 244 -HPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSA 302
              +      +I+EEN T+++ + + ++  E+ADD+IP++  T +   +V+AGY+  ++ 
Sbjct: 238 NLDLIQGLSARIVEENMTVSTHETITEQSTEYADDIIPVRRATPLAAVLVNAGYAKAEAE 297

Query: 303 KIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLG 362
             A  L+  +   +L   ++LRIG++QK ++  IVR ++Y + +H+LT+AL+D   +V G
Sbjct: 298 DAAGYLEASLGAKELGAGDVLRIGIIQKGEEARIVRATVYSRNRHVLTMALDDRGHFVPG 357

Query: 363 VEPVKMDINHQM------DYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVN 416
            EP K+D             + T  + P +YDGI+RA    GMN+ ++ LI++ LAS+V+
Sbjct: 358 AEPPKLDAVATAFDDNGTPVVTTGHDLPRVYDGIYRAALSYGMNAEMISLIVKLLASNVD 417

Query: 417 LQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNE 476
            Q  LKPTD LE FFSV   + QA+++SELLY+ A+FG+  TRFYRF +P D S++YFNE
Sbjct: 418 FQAQLKPTDSLEAFFSVTDESGQATEESELLYVDAKFGDAETRFYRFQDPDDNSIDYFNE 477

Query: 477 NGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEK 536
           +GKS R FLLR PVP G   SGFGMR HPILG+SRMHTGVDW+APRGTPI+A G+G+V+K
Sbjct: 478 DGKSIRQFLLRNPVPNGHFRSGFGMRRHPILGFSRMHTGVDWSAPRGTPIIAAGNGVVDK 537

Query: 537 ANWA-GGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHL 595
           A W  GGYG QTLI H NGYVSSYNHQ AIAKN+K G  V QGQ+IGW+GTTGLSTGPHL
Sbjct: 538 AGWDSGGYGNQTLIRHANGYVSSYNHQSAIAKNVKPGAKVVQGQVIGWVGTTGLSTGPHL 597

Query: 596 HYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGE 642
           HYELIVNG KVD  ++R+P  ++L GD+L +F +E+ RI+ LL   +
Sbjct: 598 HYELIVNGNKVDPLRIRLPGGKSLSGDVLAKFEIERARIDELLGKDD 644


>gi|222087298|ref|YP_002545835.1| peptidase protein [Agrobacterium radiobacter K84]
 gi|221724746|gb|ACM27902.1| peptidase protein [Agrobacterium radiobacter K84]
          Length = 649

 Score =  612 bits (1577), Expect = e-173,   Method: Composition-based stats.
 Identities = 281/646 (43%), Positives = 407/646 (63%), Gaps = 12/646 (1%)

Query: 6   ISNKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTAL 65
           +   + +L S G+ PPIL +        +RR+VSLRWLS TF  GITS +++G +L  AL
Sbjct: 1   MMTDKMMLRSLGNEPPILADGRRA---PDRREVSLRWLSGTFLTGITSSILMGVALFAAL 57

Query: 66  DGHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHN 125
           DG Q++AIPA+ ++ TS+    + +          +S    SK  ++ I+EV T+++D +
Sbjct: 58  DGRQQLAIPAE-AYATSDSGNHDSTEDQVVRGGRLVSTAIASKPSDRSILEVSTVVRDGD 116

Query: 126 KDIIKKIPFAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVD-SFEV 184
           K+++++ PFA+ ++  AT     + +P FDPL IFS  +           I+  D   EV
Sbjct: 117 KEVVRRQPFAHVKIALATNRVATETYPAFDPLAIFSADENIPPPANRTGAIYGSDVESEV 176

Query: 185 TTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRH-D 243
           + + + FP       L  +   +E++  + +   +L +   Q   LYY DP+       D
Sbjct: 177 SLKTVPFPAKDVPFPLAGSMSLDEVEENVRSNGSVLTDGNTQLSALYYIDPRRFATDDTD 236

Query: 244 HPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAK 303
             +T     +I+EEN ++++P+ +  +  EFADD+IP++ NT I  A+  AGY   D+  
Sbjct: 237 VDLTAGLAARIVEENMSVSAPEAVTPQTQEFADDIIPVRENTPIATALTSAGYLKADADD 296

Query: 304 IAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGV 363
           I   +        L+  ++LRIG++QK ++  I+R SIY   KH+LT+A ND+ ++V G 
Sbjct: 297 ITAKIVPLFGASNLSGGDVLRIGILQKGEQARIIRASIYRGTKHVLTVAENDHGDFVAGS 356

Query: 364 EPVKMDINHQM-----DYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQ 418
           EP  +D            + T  + P++YDGI+RA    GM+  +V  I++ LAS+V+ Q
Sbjct: 357 EPPMLDAIATAFDNDAPVVATGRDLPSVYDGIYRAALSYGMSREMVAQIVKLLASNVDFQ 416

Query: 419 EHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENG 478
             LKPTD LE FFSV  AN QA+ DSELLY++A+FG+T TRFYRF +P D S++YF+++G
Sbjct: 417 AQLKPTDSLEAFFSVADANGQATADSELLYVNAKFGDTVTRFYRFEDPDDHSIDYFDDSG 476

Query: 479 KSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKAN 538
           KS R FLLR PVP G   SGFGMR HPILG++RMHTGVDWAAPRGTPI++ G+GIVEKA 
Sbjct: 477 KSIRQFLLRNPVPTGIFKSGFGMRRHPILGFARMHTGVDWAAPRGTPIISAGNGIVEKAG 536

Query: 539 WA-GGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHY 597
           W  GG+G QTLI H NGYVSSYNHQ AIAK +  G  V QGQ+IG+IG+TGL+TGPHLHY
Sbjct: 537 WDSGGFGNQTLIRHANGYVSSYNHQSAIAKGVVPGAKVVQGQVIGFIGSTGLATGPHLHY 596

Query: 598 ELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGEN 643
           ELIVNG KVD  ++R+P  + L G  L +F  E+KRI++LL++ ++
Sbjct: 597 ELIVNGTKVDPLRIRLPGGKTLDGVALAKFQDERKRIDTLLSDEKS 642


>gi|116254015|ref|YP_769853.1| transmembrane peptidase family protein [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115258663|emb|CAK09767.1| putative transmembrane peptidase family protein [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 646

 Score =  610 bits (1573), Expect = e-172,   Method: Composition-based stats.
 Identities = 276/643 (42%), Positives = 407/643 (63%), Gaps = 14/643 (2%)

Query: 6   ISNKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTAL 65
           +  ++ ++ S G+ PP+L +        +RR+VSLRWLS TF  GITS V++G +L  AL
Sbjct: 1   MMTEKMMIRSLGNEPPLLADGRRA---PDRREVSLRWLSGTFLTGITSSVLMGVALFAAL 57

Query: 66  DGHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHN 125
           DG Q++AIPA+     +   A              ++P   +K  ++ I+EV T++ D  
Sbjct: 58  DGRQQLAIPAEAYASVA---ADAHEDTTVVRGGRLIAPAIAAKPSDRAIMEVSTVVHDGE 114

Query: 126 KDIIKKIPFAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVD-SFEV 184
           K+++++ PFA+ +MT A  +   +D+P FDPL IFS  + + + Q     ++  D   EV
Sbjct: 115 KEVVRRQPFAHVKMTLAANHVATEDYPDFDPLAIFSADEPQPAPQSRTGALYGSDVESEV 174

Query: 185 TTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRH-D 243
           + + I FPT  T +Q+      EE++  + +   +L +   Q   LYY DP+       D
Sbjct: 175 SLKTIPFPTGKTSMQMASGLSLEEVEENVRSNGSVLTDGNTQLAALYYVDPRRFSNEDAD 234

Query: 244 HPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAK 303
             +T     +++E+N T+++ + +  +  EFADD++P++ +T I  A+  +GY    +  
Sbjct: 235 VDLTAGLSARVLEQNMTVSASESITPQTEEFADDILPVRVDTPIAKALTDSGYPQQYADG 294

Query: 304 IAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGV 363
           IA  +  ++    L K ++LRIG++QK ++  I+R S+Y   +HL+T+A++D   YV G 
Sbjct: 295 IAGYIAQQLGSGDLDKGDVLRIGIIQKGEQAKIIRASVYRGTRHLVTVAVDDKGRYVPGS 354

Query: 364 EPVKMDINHQMDYMRTSEESP-----NIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQ 418
           EP  +D         +    P      +YDGI+RA    GM  ++  LI++ LAS+V+ Q
Sbjct: 355 EPPMLDAIATAFDDNSFAPPPGQNLPRVYDGIYRAALSYGMTKDMTALIIKLLASNVDFQ 414

Query: 419 EHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENG 478
             L+PTD LE FFSV  +  QA++DSELLY++ARFG+T+TRFYRF +  DG+V+YF+ENG
Sbjct: 415 AQLRPTDSLEAFFSVADSGGQATEDSELLYVNARFGDTQTRFYRFQDSDDGTVDYFDENG 474

Query: 479 KSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKAN 538
           KS R FLLR PVP G   SGFGMR HPILG++RMHTGVDWAAPRGT I+A G+G VEKA 
Sbjct: 475 KSIRQFLLRNPVPNGIFKSGFGMRRHPILGFARMHTGVDWAAPRGTAIIAAGNGTVEKAG 534

Query: 539 WA-GGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHY 597
           W  GGYG QT++ H NGY SSYNHQ AIAK +  G  ++QGQ+IGW+GTTG STGPHLHY
Sbjct: 535 WDSGGYGNQTIVRHANGYESSYNHQSAIAKGVVPGAKIRQGQVIGWVGTTGESTGPHLHY 594

Query: 598 ELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNN 640
           ELIVNG KVD  ++R+P  ++L+G++L +F  E+KRI++LLNN
Sbjct: 595 ELIVNGTKVDPLRIRLPGGKSLQGEVLAKFEDERKRIDTLLNN 637


>gi|150397696|ref|YP_001328163.1| peptidase M23B [Sinorhizobium medicae WSM419]
 gi|150029211|gb|ABR61328.1| peptidase M23B [Sinorhizobium medicae WSM419]
          Length = 646

 Score =  608 bits (1567), Expect = e-171,   Method: Composition-based stats.
 Identities = 274/649 (42%), Positives = 409/649 (63%), Gaps = 17/649 (2%)

Query: 6   ISNKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTAL 65
           +S+ +++L S GD PPIL +        +RR++SLRWLS TF  GITS +++G +L  AL
Sbjct: 1   MSSDKNMLRSLGDHPPILADGRRA---PDRREISLRWLSGTFLTGITSSLLMGVALFAAL 57

Query: 66  DGHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHN 125
           DG Q++AIPA+     +       + +   +    LSP   +K  +K ++EV T+I D  
Sbjct: 58  DGRQQLAIPAEAFAALAPSAPAGAAKRGDRV----LSPNIVAKPADKTVMEVSTMIHDGE 113

Query: 126 KDIIKKIPFAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQML-MDTIHNVD-SFE 183
           K+++++ PF + +M  A  +   + +P FDPL IFS  + ++ +      TI+  D   E
Sbjct: 114 KEVVRRQPFVHVKMALAANHQTSESYPDFDPLAIFSTDEADAEAAPAKTGTIYGSDVESE 173

Query: 184 VTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHD 243
           V  + ++FP D    ++  +   +E++  +     +L     Q  +L+Y DPQ      D
Sbjct: 174 VALKTVDFPLDGGGFKVGPSMSLDEVEENVRTNGSVLTEGSTQVASLFYVDPQRFASDAD 233

Query: 244 -HPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSA 302
              +      +++EEN +++S + +  +  E+ADD+IP++    I   M +AGY+   + 
Sbjct: 234 NLDLMQGLAARVVEENMSVSSYENITKQSTEYADDIIPVRRALPIAKVMTNAGYAEAQAE 293

Query: 303 KIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLG 362
             A  L   +    L   ++LRIG++QK ++  IVR +IY   +H+LT+A++D   +V G
Sbjct: 294 DAAGYLGEALGAKNLGPGDVLRIGIIQKGEEAKIVRATIYSNSRHVLTMAVDDRGRFVPG 353

Query: 363 VEPVKMDINHQ------MDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVN 416
            EP K++             + +S + P +YDGI+RA    GMN++++ L+++ LAS+V+
Sbjct: 354 AEPPKLEAVAAAFDDTGRPVISSSHDLPRVYDGIYRAALSYGMNADMIALVVKLLASNVD 413

Query: 417 LQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNE 476
            Q  LKP D LE FFSV   + +A++DSELLY++A+FG+  TRFYRF +P D S++YF++
Sbjct: 414 FQAQLKPADSLEAFFSVTDESGRATEDSELLYVNAKFGDAETRFYRFQDPDDNSIDYFDK 473

Query: 477 NGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEK 536
           +GKS R FLLR PVP GR  SGFGMR HPILG+SRMHTGVDW+APRGTPI+A G+G+V+K
Sbjct: 474 DGKSIRQFLLRNPVPNGRFRSGFGMRRHPILGFSRMHTGVDWSAPRGTPIIAAGNGVVQK 533

Query: 537 ANWA-GGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHL 595
           A W  GGYG QTLI H NGYVSSYNHQ AIAK++K G  V QGQ+IGW+GTTGLSTGPHL
Sbjct: 534 AGWDSGGYGNQTLIRHANGYVSSYNHQSAIAKSVKPGAKVVQGQVIGWVGTTGLSTGPHL 593

Query: 596 HYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENP 644
           HYELIVNG KVD  ++R+P  ++L G+ L +F  E++RI+ LL +  N 
Sbjct: 594 HYELIVNGNKVDPLRIRLPGGKSLAGEALAQFEKERERIDELLGDDANE 642


>gi|15966360|ref|NP_386713.1| hypothetical protein SMc02432 [Sinorhizobium meliloti 1021]
 gi|307313054|ref|ZP_07592681.1| Peptidase M23 [Sinorhizobium meliloti BL225C]
 gi|307321061|ref|ZP_07600467.1| Peptidase M23 [Sinorhizobium meliloti AK83]
 gi|15075631|emb|CAC47186.1| Hypothetical transmembrane protein [Sinorhizobium meliloti 1021]
 gi|306893336|gb|EFN24116.1| Peptidase M23 [Sinorhizobium meliloti AK83]
 gi|306899373|gb|EFN30007.1| Peptidase M23 [Sinorhizobium meliloti BL225C]
          Length = 646

 Score =  608 bits (1567), Expect = e-171,   Method: Composition-based stats.
 Identities = 274/649 (42%), Positives = 414/649 (63%), Gaps = 17/649 (2%)

Query: 6   ISNKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTAL 65
           +S+ +++L S GD PPIL +        +RR++S+RWLS TF  GITS +++G +L  AL
Sbjct: 1   MSSDKNMLRSLGDHPPILADGRRA---PDRREISMRWLSGTFLTGITSSLLMGVALFAAL 57

Query: 66  DGHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHN 125
           DG Q++AIPA+          +  + +   +    LSP   +K  +K ++EV T+I D  
Sbjct: 58  DGRQQLAIPAEAFAALDPSAPVGAAKRGDRV----LSPNIVAKPADKTVMEVSTMIHDGE 113

Query: 126 KDIIKKIPFAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQML-MDTIHNVD-SFE 183
           K+++++ PF + +M  A  +   + +P FDPL IFS  + ++ +  +   TI+  D   E
Sbjct: 114 KEVVRRQPFVHVKMALAANHQTSESYPDFDPLAIFSTDEADAEAPPVKTGTIYGSDVESE 173

Query: 184 VTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHD 243
           V  + ++FP +     L  +   +E++  +     +L     Q  +L+Y DPQ      D
Sbjct: 174 VALKTVDFPLNGGGFALGPSMSLDEVEENVRTNGSVLTEGNTQVASLFYVDPQRFASDAD 233

Query: 244 -HPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSA 302
              +      +++EEN +++S + +  +  E+ADD+IP++  T I  AM++AGY+   + 
Sbjct: 234 NLDLMQGLAARVVEENMSVSSYENITKQSIEYADDIIPVRRATPIATAMINAGYAKAQAE 293

Query: 303 KIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLG 362
             A  L+  +   +L   ++LRIG++QK ++  IVR +IY   +H+LT+A++D   ++ G
Sbjct: 294 DAAGYLEEALGAKELGPGDVLRIGIIQKGEEAKIVRATIYSHSRHVLTMAVDDRGRFIPG 353

Query: 363 VEPVKMDINHQ------MDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVN 416
            EP K++             + +  + P +YDGI+RA    GMN++++ L+++ LAS+V+
Sbjct: 354 AEPAKLEAVAAAFDDTGRPVISSGHDLPRVYDGIYRAALSYGMNADMIALVVKLLASNVD 413

Query: 417 LQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNE 476
            Q  LKPTD LE FFSV   + +A++DSELLY++A+FG+  TRFYRF +P D S++YF++
Sbjct: 414 FQAQLKPTDSLEAFFSVTDESGRATEDSELLYVNAKFGDAETRFYRFQDPDDNSIDYFDK 473

Query: 477 NGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEK 536
           +GKS R FLLR PVP G   SGFGMR HPILG+SRMHTGVDW+APRGTPI+A G+G+V+K
Sbjct: 474 DGKSIRQFLLRNPVPNGHFRSGFGMRRHPILGFSRMHTGVDWSAPRGTPIIAAGNGVVQK 533

Query: 537 ANWA-GGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHL 595
           A W  GGYG QTLI H NGYVSSYNHQ AIAK++K GT V QGQ+IGW+GTTGLSTGPHL
Sbjct: 534 AGWDSGGYGNQTLIRHANGYVSSYNHQSAIAKSVKPGTKVVQGQVIGWVGTTGLSTGPHL 593

Query: 596 HYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENP 644
           HYELIVNG KVD  ++R+P  ++L G+ L +F  E++RI+ LL +  N 
Sbjct: 594 HYELIVNGNKVDPLRIRLPGGKSLGGEALAKFEKERERIDELLGDDANE 642


>gi|260467168|ref|ZP_05813346.1| Peptidase M23 [Mesorhizobium opportunistum WSM2075]
 gi|259029092|gb|EEW30390.1| Peptidase M23 [Mesorhizobium opportunistum WSM2075]
          Length = 680

 Score =  607 bits (1564), Expect = e-171,   Method: Composition-based stats.
 Identities = 244/648 (37%), Positives = 370/648 (57%), Gaps = 16/648 (2%)

Query: 6   ISNKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTAL 65
           + +  D++   G+ PP++ +        +RR+VS RWLS TF  G+TS V++G +L  AL
Sbjct: 25  MPDTEDVIAELGNEPPLIADGR--SGPPDRREVSARWLSGTFLTGVTSSVLMGVALFAAL 82

Query: 66  DGHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHN 125
           DG Q++A P +++       A N  +   +     ++P+  +K  ++  +EV  + K  +
Sbjct: 83  DGRQQLATPPEIAELIGL--ASNGDSGEVAKTTRLVAPRQIAKAKDRRRMEVSMVTKVGD 140

Query: 126 KDIIKKIPFAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQMLM-----DTIHNVD 180
           +D+I  +PF   +M  A  +   + +P FDP+++F +   ++S+Q          I+   
Sbjct: 141 RDVIHTMPFVQIKMALAAGHTTSRAYPPFDPMQVFGDDGDDASAQPATASAAAGQIYGAK 200

Query: 181 -SFEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLD 239
              E++ + ++FP              +E++  +      L +   Q  +L+Y DPQ   
Sbjct: 201 VESEMSLKTVDFPIATASFDEKSDLSADEVEKVVREAGTDLSDGAVQVASLHYVDPQRFG 260

Query: 240 QRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNG 299
           +     +  S  +KI+ EN ++     + D+ P FA+++IP   +T + +A   +GY+  
Sbjct: 261 EAFAESMAGSYDVKIVPENVSVAPRANVDDQSPAFAEEIIPFTKDTDLTEAFADSGYTGE 320

Query: 300 DSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEY 359
           D+  +A+A+   +    L    +LR+G+  + D   +VR S+Y K  H++TIAL+D  +Y
Sbjct: 321 DATGMAEAIAKLLNAPALKAGTVLRVGLEVRGDAAKVVRTSVYDKTTHIVTIALDDRGQY 380

Query: 360 VLGVEPVKMDINHQMDY-----MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASS 414
           V   EP                +      PN+YDGI+R     GM+  + + +++ LAS 
Sbjct: 381 VPAQEPDPNPELLTAFDDSSAPVVVRGNLPNVYDGIYRTAYSYGMSKKMTQRLIKLLASG 440

Query: 415 VNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYF 474
           V+ Q  L P+D LE  FS    ++Q SDDSELLY+ A FG T   FYRF      S +YF
Sbjct: 441 VDFQSRLNPSDRLEVLFSQPDGDDQTSDDSELLYVSATFGGTTRNFYRFQMQDG-STDYF 499

Query: 475 NENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIV 534
           +++G S+  FLLR P+P GR TSGFG R HPILGY RMHTG DWAAP G+PI+A G+G+V
Sbjct: 500 DQDGSSAEQFLLRNPLPNGRFTSGFGARKHPILGYVRMHTGTDWAAPIGSPIIAAGNGVV 559

Query: 535 EKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPH 594
           EKA WAGGYGKQ ++ H NGY +SYNHQ A AK I  G  V+QGQ+IG++G TGLSTGPH
Sbjct: 560 EKAGWAGGYGKQIILRHANGYETSYNHQSAFAKGIAPGVRVRQGQVIGYLGQTGLSTGPH 619

Query: 595 LHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGE 642
           LHYELIVNG KVDS +VR+P  + LKGD L  F  E++RI+ LL   +
Sbjct: 620 LHYELIVNGTKVDSMRVRLPVGKVLKGDDLVAFKRERERIDDLLKQED 667


>gi|209551096|ref|YP_002283013.1| peptidase M23 [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209536852|gb|ACI56787.1| Peptidase M23 [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 640

 Score =  606 bits (1561), Expect = e-171,   Method: Composition-based stats.
 Identities = 276/637 (43%), Positives = 404/637 (63%), Gaps = 14/637 (2%)

Query: 12  ILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKI 71
           ++ S G+ PP+L +        +RR+VSLRWLS TF  GITS V++G +L  ALDG Q++
Sbjct: 1   MIRSLGNEPPLLADGRRA---PDRREVSLRWLSGTFLTGITSSVLMGVALFAALDGRQQL 57

Query: 72  AIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKK 131
           AIP   +   +   A              ++P   +K  ++ I+EV T++ D  K+++++
Sbjct: 58  AIP---AEAYASAAADAHEDTTVVRGGRLIAPAIAAKPSDRAIMEVSTVVHDGEKEVVRR 114

Query: 132 IPFAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVD-SFEVTTQKIN 190
            PFA+ +MT A  +   +D+P FDPL IFS  + + + Q     I+  D   EV+ + ++
Sbjct: 115 QPFAHVKMTLAANHVATEDYPDFDPLAIFSADEPQPAPQSRTGAIYGSDVESEVSLKTVS 174

Query: 191 FPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRH-DHPITYS 249
           FPT  T +++      EE++  + +   +L +   Q   LYY DP+       D  +T  
Sbjct: 175 FPTGKTSMKMASGLSLEEVEENVRSNGSVLTDGNTQLAALYYVDPRRFSNEDADVDLTAG 234

Query: 250 KKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALK 309
              +++E+N T+++ + +  +  EFADD++P++ +T I  A+  +GY    +  IA  + 
Sbjct: 235 LSARVLEQNMTVSASESITPQTEEFADDILPVRVDTPIAKALTDSGYPQQYADGIAGFIS 294

Query: 310 NEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMD 369
            ++    L K ++LRIG++QK ++  I+R S+Y   +HL+T+A++D   YV G EP  +D
Sbjct: 295 QQLGSTDLDKGDVLRIGIIQKGEQAKIIRASVYRSTRHLVTVAVDDKGRYVPGSEPPMLD 354

Query: 370 INHQMDYMRTSEESP-----NIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPT 424
                    +    P      +YDGI+RA    GM  ++  LI++ LAS+V+ Q  L+PT
Sbjct: 355 AIATAFDDNSFAPPPGQNLPRVYDGIYRAALSYGMTKDMTALIIKLLASNVDFQAQLRPT 414

Query: 425 DFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPF 484
           D LE FFSV  +  QA++DSELLY++ARFG+T+TRFYRF +P DG+V+YF+ENGKS R F
Sbjct: 415 DSLEAFFSVADSAGQATEDSELLYVNARFGDTQTRFYRFQDPEDGTVDYFDENGKSIRQF 474

Query: 485 LLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWA-GGY 543
           LLR PVP G   SGFGMR HPILG++RMHTGVDWAAPRGT I+A G+G VEKA W  GGY
Sbjct: 475 LLRNPVPNGIFKSGFGMRRHPILGFARMHTGVDWAAPRGTAIIAAGNGTVEKAGWDSGGY 534

Query: 544 GKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNG 603
           G QT+I H NGY SSYNHQ AIAK +  G  ++QGQ+IGW+GTTG STGPHLHYELIVNG
Sbjct: 535 GNQTIIRHANGYESSYNHQSAIAKGVTPGAKIRQGQVIGWVGTTGESTGPHLHYELIVNG 594

Query: 604 IKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNN 640
            KVD  ++R+P  ++L+G+ L +F  E+KRI++LLNN
Sbjct: 595 TKVDPLRIRLPGGKSLQGEALAKFEDERKRIDTLLNN 631


>gi|86359336|ref|YP_471228.1| M24/M37 family peptidase [Rhizobium etli CFN 42]
 gi|86283438|gb|ABC92501.1| putative peptidase protein, M23/M37 family [Rhizobium etli CFN 42]
          Length = 640

 Score =  604 bits (1557), Expect = e-170,   Method: Composition-based stats.
 Identities = 277/637 (43%), Positives = 404/637 (63%), Gaps = 14/637 (2%)

Query: 12  ILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKI 71
           ++ S G+ PP+L +        ++R+VSLRWLS TF  GITS V++G +L  ALDG Q++
Sbjct: 1   MIRSLGNEPPLLADGRRA---PDKREVSLRWLSGTFLTGITSSVLMGVALFAALDGRQQL 57

Query: 72  AIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKK 131
           AIP   +   +   A              ++P   +K  ++ I+EV T++ D  K+++++
Sbjct: 58  AIP---AEAYASAAAEAHEDTTVVRGGRLIAPAIAAKPSDRAIMEVSTVVHDGEKEVVRR 114

Query: 132 IPFAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVD-SFEVTTQKIN 190
            PFA+ +MT A  +   +D+P FDPL IFS  + + + Q     ++  D   EV+ + + 
Sbjct: 115 QPFAHVKMTLAANHVATEDYPDFDPLAIFSADEPQPAPQSRTGALYGSDVESEVSLKTVP 174

Query: 191 FPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQR-HDHPITYS 249
           FPT  T +++      EE++  + +   +L +   Q   LYY DP+       D  +T  
Sbjct: 175 FPTAKTGMKMASDLSLEEVEENVRSNGSVLTDGNTQLAALYYVDPRRFSNEEADVDLTAG 234

Query: 250 KKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALK 309
              +++E+N T+++P+ +  +  EFADD++P++ +T I  A+  +GY    +  IA  + 
Sbjct: 235 LSARVLEQNMTVSAPESITPQTEEFADDILPVRADTPIAKALTDSGYPQQYADGIASYIS 294

Query: 310 NEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMD 369
            ++    L K ++LRIG++QK ++  I+R S+Y   +HL+T+AL+D  +YV G EP  +D
Sbjct: 295 QQLGASDLEKGDVLRIGIIQKGEQAKIIRASVYRGARHLVTVALDDKGKYVPGSEPPMLD 354

Query: 370 INHQMDYMRTSEESP-----NIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPT 424
                    T    P      +YDGI+RA    GM  ++  LI++ LAS+V+ Q  L+PT
Sbjct: 355 AIATAFDDNTFAPPPGQNLPRVYDGIYRAALSYGMTKDMTALIIKLLASNVDFQAQLRPT 414

Query: 425 DFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPF 484
           D LE FFSV  +  QA++DSELLY++ARFG+T+TRFYRF +P DG+V+YF+ENGKS R F
Sbjct: 415 DKLEAFFSVADSTGQATEDSELLYVNARFGDTQTRFYRFQDPEDGTVDYFDENGKSIRQF 474

Query: 485 LLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWA-GGY 543
           LLR PVP G   SGFGMR HPILG++RMHTGVDWAAPRGT I+A G+G VEKA W  GGY
Sbjct: 475 LLRNPVPNGIFKSGFGMRRHPILGFARMHTGVDWAAPRGTAIIAAGNGTVEKAGWDSGGY 534

Query: 544 GKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNG 603
           G QT+I H NGY SSYNHQ AIAK +  G  ++QGQ+IGW+GTTG STGPHLHYELIVNG
Sbjct: 535 GNQTIIRHANGYESSYNHQSAIAKGVVPGAKIRQGQVIGWVGTTGESTGPHLHYELIVNG 594

Query: 604 IKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNN 640
            KVD  ++R+P  ++L+G+ L +F  E+KRI+ LLNN
Sbjct: 595 TKVDPLRIRLPGGKSLQGEALAKFEDERKRIDMLLNN 631


>gi|241206498|ref|YP_002977594.1| peptidase M23 [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240860388|gb|ACS58055.1| Peptidase M23 [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 640

 Score =  604 bits (1556), Expect = e-170,   Method: Composition-based stats.
 Identities = 277/637 (43%), Positives = 404/637 (63%), Gaps = 14/637 (2%)

Query: 12  ILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKI 71
           ++ S G+ PP+L +        +RR+VSLRWLS TF  GITS V++G +L  ALDG Q++
Sbjct: 1   MIRSLGNEPPLLADGRRA---PDRREVSLRWLSGTFLTGITSSVLMGVALFAALDGRQQL 57

Query: 72  AIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKK 131
           AIPA+     +   A              ++P   +K  ++ I+EV T++ D  K+++++
Sbjct: 58  AIPAEAYASVA---ADAHEDTTVVRGGRLIAPAIAAKPSDRAIMEVSTVVHDGEKEVVRR 114

Query: 132 IPFAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVD-SFEVTTQKIN 190
            PFA+ +MT A  +   +D+P FDPL IFS  + + + Q     ++  D   EV+ + I 
Sbjct: 115 QPFAHVKMTLAANHVATEDYPDFDPLAIFSADEPQPAPQSRTGALYGSDVESEVSLKTIP 174

Query: 191 FPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRH-DHPITYS 249
           FPT  T +Q+      EE++  + +   +L +   Q   LYY DP+       D  +T  
Sbjct: 175 FPTGKTSMQMASGLSLEEVEENVRSNGSVLTDGNTQLAALYYVDPRRFSNEDADVDLTAG 234

Query: 250 KKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALK 309
              +++E+N T+++ + +  +  EFADD++P++ +T I  A+  +GY    +  IA  + 
Sbjct: 235 LSARVLEQNMTVSASESITPQTEEFADDILPVRVDTPIAKALTDSGYPQQYADGIAGYIA 294

Query: 310 NEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMD 369
            ++    L K ++LRIG++QK ++  I+R S+Y   +HL+T+A++D   YV G EP  +D
Sbjct: 295 QQLGSGDLDKGDVLRIGIIQKGEQAKIIRASVYRGTRHLVTVAVDDKGRYVPGSEPPMLD 354

Query: 370 INHQMDYMRTSEESP-----NIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPT 424
                    +    P      +YDGI+RA    GM  ++  LI++ LAS+V+ Q  L+PT
Sbjct: 355 AIATAFDDNSFAPPPGQNLPRVYDGIYRAALSYGMTKDMTALIIKLLASNVDFQAQLRPT 414

Query: 425 DFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPF 484
           D LE FFSV  +  QA++DSELLY++ARFG+T+TRFYRF +P DG+V+YF+ENGKS R F
Sbjct: 415 DSLEAFFSVADSAGQATEDSELLYVNARFGDTQTRFYRFQDPEDGTVDYFDENGKSIRQF 474

Query: 485 LLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWA-GGY 543
           LLR PVP G   SGFGMR HPILG++RMHTGVDWAAPRGT I+A G+G VEKA W  GGY
Sbjct: 475 LLRNPVPNGIFKSGFGMRRHPILGFARMHTGVDWAAPRGTAIIAAGNGTVEKAGWDSGGY 534

Query: 544 GKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNG 603
           G QT++ H NGY SSYNHQ AIAK +  G  ++QGQ+IGW+GTTG STGPHLHYELIVNG
Sbjct: 535 GNQTIVRHANGYESSYNHQSAIAKGVVPGAKIRQGQVIGWVGTTGESTGPHLHYELIVNG 594

Query: 604 IKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNN 640
            KVD  ++R+P  ++L+G+ L +F  E+KRI++LLNN
Sbjct: 595 TKVDPLRIRLPGGKSLQGEALAKFEDERKRIDTLLNN 631


>gi|15890798|ref|NP_356470.1| hypothetical protein Atu4178 [Agrobacterium tumefaciens str. C58]
 gi|15159083|gb|AAK89255.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 648

 Score =  603 bits (1554), Expect = e-170,   Method: Composition-based stats.
 Identities = 283/650 (43%), Positives = 421/650 (64%), Gaps = 15/650 (2%)

Query: 6   ISNKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTAL 65
           ++  R+++ S G  PPIL          +RR++SLRWLS TF  GITS +++G +L  AL
Sbjct: 1   MTADRNVIRSLGTEPPILAEGRRA---PDRREISLRWLSGTFLTGITSSILMGVALFAAL 57

Query: 66  DGHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHN 125
           DG Q++AIPA+   +    N    +A+  +     ++P   ++  ++ I+EV T+I + +
Sbjct: 58  DGRQQLAIPAEAFAKADMGNNATEAARRGTR---LVAPNIAARPSDRSIMEVSTVINEGD 114

Query: 126 KDIIKKIPFAYARMTFATPYPKVKDHPKFDPLKIFS---EGKIESSSQMLMDTIHNVD-S 181
           K++++K+PF++ ++  A+ Y K  D+P FDPL IF+   +    + +     TI+  +  
Sbjct: 115 KEVVRKVPFSHVKIPLASNYAKQDDYPAFDPLNIFASNDDKDAPAPAASRTGTIYGSEVE 174

Query: 182 FEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQR 241
            EV+ + + FP   ++     +   +E++ A+ +   +L +   Q   LYY DP+  D  
Sbjct: 175 SEVSLKTVAFPVQHSKYAFAGSLSFDEVEEAVRSNGSILTDGNEQVAALYYIDPRRFDND 234

Query: 242 -HDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGD 300
             D  IT     +++E+N ++++PQ     + E+ADD+IP +   TI  A+  AGYS   
Sbjct: 235 EGDVDITAGLAARVVEQNMSVSTPQSSSVPVKEYADDVIPSRQTETIEAALFGAGYSKAQ 294

Query: 301 SAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYV 360
           S++IAK L  +++ + +   ++LR+G++Q+D+K  IVR S+Y K +H++T+A++D+  +V
Sbjct: 295 SSEIAKLLSPQIQSENVESGDVLRVGIIQEDEKSDIVRVSLYRKGRHMVTMAIDDHKNFV 354

Query: 361 LGVEPVKMDINHQMDYMRTSEESPN----IYDGIWRATSFNGMNSNLVKLIMRTLASSVN 416
              EP K+D          +  +      +YDG++RA    GMN ++V  +++ LASSV+
Sbjct: 355 KASEPPKLDAVATAFDSTPAPAAGRDLPSVYDGVYRAALAYGMNQSMVSQLIKLLASSVD 414

Query: 417 LQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNE 476
            Q  LKPTD LE FFSV  A+ +A+D SELLY++A+FG+  TRFYRF +P D SV+YF+E
Sbjct: 415 FQAQLKPTDTLEAFFSVEDADGKATDKSELLYVNAKFGDNETRFYRFQSPEDNSVDYFDE 474

Query: 477 NGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEK 536
           NGKS R FLLR PVP GRMTSGFGMR HP+L +SRMHTG DWAA RGTPI+A G+G VEK
Sbjct: 475 NGKSIRQFLLRNPVPNGRMTSGFGMRRHPVLKFSRMHTGTDWAAARGTPIIATGNGTVEK 534

Query: 537 ANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLH 596
           A WA GYG QTLI H NGYVSSYNHQ AIAK +  G+ V+QGQ+IG++G+TGLSTG HLH
Sbjct: 535 AGWASGYGNQTLIRHANGYVSSYNHQSAIAKGVTEGSKVRQGQVIGYVGSTGLSTGAHLH 594

Query: 597 YELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKK 646
           YELIVNG KVD+ KVR+P  ++L G  L RF+ E+KRI++LLN  E P +
Sbjct: 595 YELIVNGTKVDAMKVRLPGGKSLSGVALARFSDERKRIDNLLNIDEKPNQ 644


>gi|90425748|ref|YP_534118.1| peptidase M23B [Rhodopseudomonas palustris BisB18]
 gi|90107762|gb|ABD89799.1| peptidase M23B [Rhodopseudomonas palustris BisB18]
          Length = 695

 Score =  602 bits (1552), Expect = e-170,   Method: Composition-based stats.
 Identities = 165/654 (25%), Positives = 305/654 (46%), Gaps = 24/654 (3%)

Query: 9   KRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGH 68
           +   +   G  PP+  +      + +RR+VS++W S T   G+    +IGG++  +LDG 
Sbjct: 19  REAGIIDLGHEPPLSVDGSEAAVI-DRRRVSVQWFSGTILTGLCGAALIGGAVFASLDGE 77

Query: 69  QKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDI 128
              A   +   + +   A   + + +S+ ++   P        + ++ V T+ +  N+D+
Sbjct: 78  MTFAKVPE-RVEGALRGAFGANDRNASLHKSDRLPPPSESAAARQVVRVSTVTRIGNRDV 136

Query: 129 IKKIPFAYARMTFA-TPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNV--DSFEVT 185
           ++  PF       A T        P F+  ++ ++    + +        +      EV+
Sbjct: 137 MRVRPFIRIAGNLALTTSELSAKVPPFNAQRMLTDVGAATPAAAEDAQNPDAVEPDAEVS 196

Query: 186 TQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHP 245
               +    + + ++      +E+   + +          + +T+  A  +      D  
Sbjct: 197 FVTRDLGPILPKAKVAAVLAIDEVLMRVRDASSWRGQTGVR-YTMASATGEAGTPHSDIK 255

Query: 246 ITYSKKI------------KIIEENRTITSPQ-VLIDKIPEFADDLIPIQHNTTIFDAMV 292
           + Y+ +             +++ EN T+               + +  ++ N +I   + 
Sbjct: 256 MAYATEGNVAADPYAGFETRVVPENVTLLPKTKDQATGGNPTNERIHIVKKNDSISTILR 315

Query: 293 HAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQ--KDDKFTIVRFSIYHKQKHLLT 350
             G +  ++  IA  L +  R   L + + +RI +       +    R  +         
Sbjct: 316 DQGATPEETRAIAATLGSRGRDGGLKEGQKIRILMAPAGPGQRLQPYRVVVASDSTVEAV 375

Query: 351 IALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPN---IYDGIWRATSFNGMNSNLVKLI 407
            AL+D  +YV         +    D     E+      +Y  I+     N + + +++ +
Sbjct: 376 AALSDLGKYVAVDVQSMNTVAEVPDSSDDDEDDGTGVRLYQSIYETALRNKVPAGVIEDM 435

Query: 408 MRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPV 467
           +R  +  V+ Q  ++  D  E FF+     + A++ +++LY     G    ++YRF  P 
Sbjct: 436 VRIYSYDVDFQRRVQAGDSFEVFFAGEDEGSNATEKNDVLYAALTVGGETKKYYRFQTPD 495

Query: 468 DGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIV 527
           D  V++++E+GKS++ FL+R PV    M SGFG R HPILGY +MHTGVDW+ P GTPI 
Sbjct: 496 DSVVDFYDESGKSAKKFLVRKPVNQAIMRSGFGGRRHPILGYVKMHTGVDWSTPYGTPIF 555

Query: 528 AVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTT 587
           A G+GIVEK  W GGYGK   + H NGY ++Y H  A AK ++ G  V+QGQ+IG++G+T
Sbjct: 556 ASGNGIVEKVGWEGGYGKYVRLKHNNGYETAYGHMSAFAKGLEPGKRVRQGQVIGFVGST 615

Query: 588 GLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNG 641
           GLSTG H+HYE++VNG  VD  +V++P   +L+G L+  F  E+ R+++++ + 
Sbjct: 616 GLSTGAHVHYEILVNGRFVDPMRVKLPRGRSLEGPLMASFEKERDRLDTMMTSR 669


>gi|332716896|ref|YP_004444362.1| putative peptidase protein, M23/M37 family [Agrobacterium sp.
           H13-3]
 gi|325063581|gb|ADY67271.1| putative peptidase protein, M23/M37 family [Agrobacterium sp.
           H13-3]
          Length = 648

 Score =  602 bits (1552), Expect = e-170,   Method: Composition-based stats.
 Identities = 281/650 (43%), Positives = 417/650 (64%), Gaps = 15/650 (2%)

Query: 6   ISNKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTAL 65
           ++  R+++ S G  PPIL          +RR++SLRWLS TF  GITS +++G +L  AL
Sbjct: 1   MTADRNVIRSLGTEPPILAEGRRA---PDRREISLRWLSGTFLTGITSSILMGVALFAAL 57

Query: 66  DGHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHN 125
           DG Q++AIPA+   +    N    +A+  +     ++P   ++  ++ I+EV T+I + +
Sbjct: 58  DGRQQLAIPAEAFAKADMGNNTAEAARRGTR---LVAPNIAARPSDRSIMEVSTVINEGD 114

Query: 126 KDIIKKIPFAYARMTFATPYPKVKDHPKFDPLKIFS---EGKIESSSQMLMDTIHNVD-S 181
           K++++K+PF++ ++  A+ Y K  D+P FDPL IF+   +    + +     TI+  +  
Sbjct: 115 KEVVRKVPFSHVKIPLASNYAKQDDYPAFDPLNIFASGDDKDAPAPAPSRTGTIYGSEVE 174

Query: 182 FEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQR 241
            EV+ + + FP   ++     +   +E++ A+ +   +L +   Q   LYY DP+  D  
Sbjct: 175 SEVSLKTVAFPIQHSKYPFAGSLSFDEVEEAVRSNGSILTDGNEQLAALYYIDPRRFDND 234

Query: 242 -HDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGD 300
             D  IT     +++E+N ++++PQ     + E+ADD+IP +   TI  A+  AGYS   
Sbjct: 235 EGDVDITAGLAARVVEQNMSVSTPQSPSVPVKEYADDVIPARQTETIEAALFGAGYSKAQ 294

Query: 301 SAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYV 360
           S++IA  L  +++ + +   ++LR+G++Q+DDK  IVR S+Y K +H++T+A++D   ++
Sbjct: 295 SSEIAGLLSPQLQSNNVESGDVLRVGIIQEDDKSDIVRVSLYRKGRHMVTMAVDDRKNFI 354

Query: 361 LGVEPVKMDINHQMDYMRTSEESPN----IYDGIWRATSFNGMNSNLVKLIMRTLASSVN 416
              EP K+D          +  +      +YDG++RA    GMN  +V  +++ LASSV+
Sbjct: 355 KASEPPKLDAVATAFDSTPAPAAGRDLPSVYDGVYRAALAYGMNQGMVSQLIKLLASSVD 414

Query: 417 LQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNE 476
            Q  LKP D LE FFSV  A+ +A+D SELLY++A+FG+  TRFYRF NP D S++YF+E
Sbjct: 415 FQAQLKPADTLEAFFSVEDADGKATDKSELLYVNAKFGDNETRFYRFQNPDDNSIDYFDE 474

Query: 477 NGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEK 536
           NGKS R FLLR PVP GRMTSGFGMR HP+L +SRMHTG DWAA RGTPI+A G+G VEK
Sbjct: 475 NGKSIRQFLLRNPVPNGRMTSGFGMRRHPVLKFSRMHTGTDWAAARGTPIIATGNGTVEK 534

Query: 537 ANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLH 596
           A WA GYG QTLI H NGYVSSYNHQ AIAK +  G+ V+QGQ+IG++G+TGLSTG HLH
Sbjct: 535 AGWASGYGNQTLIRHANGYVSSYNHQSAIAKGVTEGSKVRQGQVIGYVGSTGLSTGAHLH 594

Query: 597 YELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKK 646
           YELIVNG KVD+ KVR+P  ++L G  L RF+ E+KRI++LLN  E P +
Sbjct: 595 YELIVNGTKVDAMKVRLPGGKSLSGVALARFSDERKRIDNLLNIEEKPNQ 644


>gi|190893587|ref|YP_001980129.1| peptidase, M23/M37 family [Rhizobium etli CIAT 652]
 gi|190698866|gb|ACE92951.1| putative peptidase protein, M23/M37 family [Rhizobium etli CIAT
           652]
          Length = 640

 Score =  601 bits (1549), Expect = e-169,   Method: Composition-based stats.
 Identities = 277/637 (43%), Positives = 405/637 (63%), Gaps = 14/637 (2%)

Query: 12  ILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKI 71
           ++ S G+ PP+L +        ++R+VSLRWLS TF  GITS V++G +L  ALDG Q++
Sbjct: 1   MIRSLGNEPPLLADGRRA---PDKREVSLRWLSGTFLTGITSSVLMGVALFAALDGRQQL 57

Query: 72  AIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKK 131
           AIP   +   +   A              ++P   +K  ++ I+EV T++ D  K+++++
Sbjct: 58  AIP---AEAYASAAAETHEDTTVVRGGRLIAPAIAAKPSDRAIMEVSTVVHDGEKEVVRR 114

Query: 132 IPFAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVD-SFEVTTQKIN 190
            PFA+ +MT A  +   +D+P FDPL IFS  + + + Q     I+  D   EV+ + I 
Sbjct: 115 QPFAHVKMTLAANHVATEDYPDFDPLAIFSADEPQPAPQSRTGAIYGSDVESEVSLKTIA 174

Query: 191 FPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRH-DHPITYS 249
           FPT  T +++      EE++  + +   +L +   Q   LYY DP+       D  +T  
Sbjct: 175 FPTGKTGMKMASGLSLEEVEENVRSNGSVLTDGNTQLAALYYVDPRRFSNEDADVDLTAG 234

Query: 250 KKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALK 309
              +++E+N T+++P+ +  +  EFADD++P++ +  I  A+  +GY    +  IA  + 
Sbjct: 235 LSARVLEQNMTVSAPESITPQTEEFADDILPVRADAPIAKALTDSGYPQQYADGIAGIIA 294

Query: 310 NEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMD 369
            ++    L K ++LRIG++QK ++  I+R S+Y   +HL+T+A++D  +YV G EP  +D
Sbjct: 295 QQLGASDLEKGDVLRIGIIQKGEQAKIIRASVYRGTRHLVTVAVDDKGKYVPGSEPPMLD 354

Query: 370 INHQMDYMRTSEESP-----NIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPT 424
                    T   +P      +YDGI+RA    GM  ++  LI++ LAS+V+ Q  L+PT
Sbjct: 355 AIATAFDDNTFAPAPGQNLPRVYDGIFRAALSYGMTKDMTALIIKLLASNVDFQAQLRPT 414

Query: 425 DFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPF 484
           D LE FFSV  +  QA++DSELLY++ARFG+T+TRFYRF +P DG+V+YF+ENGKS R F
Sbjct: 415 DTLEAFFSVADSAGQATEDSELLYVNARFGDTQTRFYRFQDPEDGTVDYFDENGKSIRQF 474

Query: 485 LLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWA-GGY 543
           LLR PVP G   SGFGMR HPILG++RMHTGVDWAAPRGT I+A G+G VEKA W  GGY
Sbjct: 475 LLRNPVPNGIFKSGFGMRRHPILGFARMHTGVDWAAPRGTAIIAAGNGTVEKAGWDSGGY 534

Query: 544 GKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNG 603
           G QT+I H NGY SSYNHQ AIAK +  G  ++QGQ+IGW+GTTG STGPHLHYELIVNG
Sbjct: 535 GNQTIIRHANGYESSYNHQSAIAKGVVPGAKIRQGQVIGWVGTTGESTGPHLHYELIVNG 594

Query: 604 IKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNN 640
            KVD  ++R+P  ++L+G+ L +F  E+KRI++LLNN
Sbjct: 595 TKVDPLRIRLPGGKSLQGEALAKFEDERKRIDTLLNN 631


>gi|75674765|ref|YP_317186.1| peptidase M23B [Nitrobacter winogradskyi Nb-255]
 gi|74419635|gb|ABA03834.1| peptidase M23B [Nitrobacter winogradskyi Nb-255]
          Length = 692

 Score =  600 bits (1547), Expect = e-169,   Method: Composition-based stats.
 Identities = 164/659 (24%), Positives = 296/659 (44%), Gaps = 18/659 (2%)

Query: 9   KRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGH 68
           +   L   G  PP+  +      + +RR+VS++W S T   G+    +IGG++  +LDG 
Sbjct: 22  RETGLIDLGHEPPLSADGSEAAVI-DRRRVSVQWFSGTILTGLCGAALIGGAVFASLDGE 80

Query: 69  QKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDI 128
              A  A+   +     +       +S+ +    P        + +I V T+ +  N+D+
Sbjct: 81  TTFAQVAE-RVEGGLRGSFGTGDHQASLHKGDRLPPPSEATAARQVIRVSTVTRAGNRDV 139

Query: 129 IKKIPFAYARMTFATPYPKVKD-HPKFDPLKIFSE--GKIESSSQMLMDTIHNVDSFEVT 185
           ++  PF       +     +    P F+  ++ ++  G   ++S+            EV+
Sbjct: 140 MRVRPFVRVSGNLSMATGDLSARVPPFNAQRLLADVGGTTRTTSEDASAAAAAEPDAEVS 199

Query: 186 TQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFL---------LHNKKNQSFTLYYADPQ 236
               +  + + + ++      +E+   + +             + +    +     +   
Sbjct: 200 FVTRDLASILPKAKIAAILPIDEVLMRVRDASNWRGNSGVRYTMADAATDAPGATSSIKM 259

Query: 237 TLDQRHDHPITYSKKIKIIEENRTITSPQVLI-DKIPEFADDLIPIQHNTTIFDAMVHAG 295
                         + +I+ EN T+               + +  ++   TI   +   G
Sbjct: 260 AYAAEGGVDPYAGFEARIVPENVTLLPKTSEQLTGGNPIGERVHLVRRGDTIVSVLRDQG 319

Query: 296 YSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIV--RFSIYHKQKHLLTIAL 353
            +  ++  IA  L    R   L + + LRI +        +V  R  + +        AL
Sbjct: 320 ATPDEARAIATTLGPRGRDGGLREGQKLRIMMAPATSDQRLVPYRVIVANDSVIEAVAAL 379

Query: 354 NDNNEYVLGVEPVKMDINHQMDYMRTSEESP-NIYDGIWRATSFNGMNSNLVKLIMRTLA 412
           +D   YV         +    D     +     +Y  I+     + +   +++ ++R  +
Sbjct: 380 SDLGNYVAVDVASMNSVADVADSSDNDDGGGARLYQSIYETALRDKVPPAVIEDMIRIYS 439

Query: 413 SSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVE 472
             ++ Q  ++P D  + F++ +      ++ +E+LY     G    +++RF  P D  V+
Sbjct: 440 YDIDFQRKVQPGDSFDVFYAGDDEGTPTTEKNEVLYASLTVGGETKKYFRFQTPDDAMVD 499

Query: 473 YFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDG 532
           Y++E GKS++ FL+R P     M SGFG R HPILGY +MHTGVDWAA  GTPI A G+G
Sbjct: 500 YYDETGKSAKKFLVRKPAASAVMRSGFGTRRHPILGYVKMHTGVDWAASYGTPIFAAGNG 559

Query: 533 IVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTG 592
           +VEKA W GGYGK   I H NGY ++Y H  A AK ++ G  V+QGQ+IG++G+TG STG
Sbjct: 560 VVEKAAWEGGYGKYVRIKHNNGYETAYGHMSAFAKGMEPGKRVRQGQVIGFVGSTGRSTG 619

Query: 593 PHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTS 651
            H+HYE++VNG  VD  +VR+P   +L G +L  F  E+ R+++++N+     +    +
Sbjct: 620 AHVHYEILVNGRFVDPMRVRLPRGRSLNGTILASFEKERDRLDAMMNSRNTVARVSDAA 678


>gi|92116279|ref|YP_576008.1| peptidase M23B [Nitrobacter hamburgensis X14]
 gi|91799173|gb|ABE61548.1| peptidase M23B [Nitrobacter hamburgensis X14]
          Length = 690

 Score =  600 bits (1547), Expect = e-169,   Method: Composition-based stats.
 Identities = 159/663 (23%), Positives = 294/663 (44%), Gaps = 22/663 (3%)

Query: 9   KRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGH 68
           +   +   G  PP+  +      + +RR++S++W S T   G+    +IGG++  +LDG 
Sbjct: 16  RETGIIDLGHEPPLSADGSEAAVI-DRRRISVQWFSGTILTGLCGAALIGGAVFASLDGE 74

Query: 69  QKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDI 128
              A   +   + +   +        ++ ++   P        + +I V T+ +  N+D+
Sbjct: 75  TTFARVPE-RVEGALRGSFGAGDHQITLHKSDRLPPPSEAAAARQLIRVSTVTRAGNRDV 133

Query: 129 IKKIPFAYARMTFATPYPKVKD-HPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFE---- 183
           ++  PF       +     +    P F+  ++ ++    + +     +     +      
Sbjct: 134 MRVRPFVRVSGNLSMATSDLSAKIPPFNAQRLLTDVGSHAPTAAEDASDAAAAAAAEPDA 193

Query: 184 -VTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSF---------TLYYA 233
            V+    +    + + ++  T   +E+   + +      N   +               +
Sbjct: 194 EVSFVTRDLAPILPKAKIAATVPIDEVLMRVRDASNWRGNGGVRYTMADATADAAGATSS 253

Query: 234 DPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLI-DKIPEFADDLIPIQHNTTIFDAMV 292
                            + +I+ EN T+               + +  ++   T+   + 
Sbjct: 254 IKMAYAAEGGIDPYAGFEARIVPENVTLLPKTKEQLTGGNPVGERVHLVKKGDTVVSVLR 313

Query: 293 HAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQ--KDDKFTIVRFSIYHKQKHLLT 350
             G +  ++  IA  L    R   L + + LRI +       +    R  + +       
Sbjct: 314 DQGATPEEAKAIAATLGPRGRDGGLKEGQKLRILMAPAAPGQRLQPYRVIVANDSTIEAV 373

Query: 351 IALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNI--YDGIWRATSFNGMNSNLVKLIM 408
            AL+D  +YV              D     ++   +  Y  I+     + +   +++ ++
Sbjct: 374 AALSDLGKYVAVDVASMNSAAEIADNSDNDDDGSGVRLYQSIYETALRDKVPPAVIEDMV 433

Query: 409 RTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVD 468
           R  +  ++ Q  ++P D  + F++ +      ++ +E+LY     G    ++YRF  P D
Sbjct: 434 RIYSYDIDFQRKVQPGDSFDVFYAGDDEGTPTTEKNEVLYASLTVGGETKKYYRFQTPDD 493

Query: 469 GSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVA 528
             V+Y++E GKS++ FL+R PV    M SGFG+R HPILGY +MHTGVDWA P GTPI A
Sbjct: 494 AIVDYYDETGKSAKKFLVRKPVASAIMRSGFGIRRHPILGYVKMHTGVDWATPYGTPIFA 553

Query: 529 VGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTG 588
            G+G+VEKA W GGYGK   I H NGY ++Y H  A AK +  G  V+QGQ+IG++G+TG
Sbjct: 554 TGNGVVEKAEWEGGYGKYVRIKHNNGYETAYGHMSAFAKGMAPGKRVRQGQVIGFVGSTG 613

Query: 589 LSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPL 648
            STG H+HYE++VNG  VD  +VR+P   +L G +L  F  E+ R+++++N+     +  
Sbjct: 614 RSTGAHVHYEILVNGRFVDPMRVRLPRGRSLDGPVLASFEKERDRLDAMMNSRNASARVS 673

Query: 649 FTS 651
             +
Sbjct: 674 DAA 676


>gi|222149907|ref|YP_002550864.1| hypothetical protein Avi_3949 [Agrobacterium vitis S4]
 gi|221736889|gb|ACM37852.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 648

 Score =  599 bits (1544), Expect = e-169,   Method: Composition-based stats.
 Identities = 266/654 (40%), Positives = 400/654 (61%), Gaps = 14/654 (2%)

Query: 6   ISNKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTAL 65
           +S  +++L S G  PPIL +        +RR++SLRWL+ TF  GITS V++G +L  AL
Sbjct: 1   MSLDKNLLRSLGMEPPILADGRRA---PDRREISLRWLTGTFLTGITSSVLMGVALFAAL 57

Query: 66  DGHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHN 125
           DG Q++AIPA+       +   N SA         ++    +K   + +++V T+I+  +
Sbjct: 58  DGRQQLAIPAEAFALADLKQ-HNDSADGVRRGGRLINTVISAKTASRSVLDVSTVIRSGD 116

Query: 126 KDIIKKIPFAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVT 185
           KD++++ PF + +M  +T     +++P FDPL IF+  +   + +       NVD  E++
Sbjct: 117 KDVVRRQPFTHLKMLVSTSLSTQENYPPFDPLSIFAGDEQTVTPRTGTIYGSNVD-SEIS 175

Query: 186 TQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTL-DQRHDH 244
            + + FP + T  +       +E++  + +   +L     Q   LYY DP+   D   D 
Sbjct: 176 LKTVAFPVNGTPFKAAPGMTSDEVEENVRSNGSVLTEGTQQVSGLYYIDPERFADPDADL 235

Query: 245 PITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKI 304
            I      +++E+N ++++P  +     E+ADD+IP++   TI  A+  AGY    +  I
Sbjct: 236 DINPGLSARVVEQNLSVSTPDPVTPDTDEYADDIIPVRREQTIIAALTGAGYPEAKAKAI 295

Query: 305 AKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVE 364
           + +L  ++    L   ++LR+G++Q+ ++  +VRFS Y   KHL+T+A++D +  V G E
Sbjct: 296 SDSLSEKLGSPSLQSGDVLRLGIIQRGEQARVVRFSAYRGGKHLVTMAVDDQSHLVEGSE 355

Query: 365 PVKMDINHQM-----DYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQE 419
           P  +D            +  S + P+IYDGI+RA+   G++  L   ++R LASSV+LQ 
Sbjct: 356 PPMLDAIATAFDENSPPVMASRDLPSIYDGIYRASLSYGLSKELTGQMVRLLASSVDLQA 415

Query: 420 HLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGK 479
            L+PTD LE F+S    + +A+ DSELL++ ARFG+T T  YRF +P D SV+YF+ENGK
Sbjct: 416 PLRPTDGLEVFYSAADESGKAAADSELLFLRARFGDTTTSLYRFQDPSDNSVDYFDENGK 475

Query: 480 SSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANW 539
           ++R FL+R PVP G   SGFGMR HPILGYSRMHTGVDW AP G+PI+A G G VEKA W
Sbjct: 476 TNRQFLIRNPVPNGVFRSGFGMRRHPILGYSRMHTGVDWGAPSGSPIIAAGSGTVEKAGW 535

Query: 540 A-GGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYE 598
             GGYG QT+I H NGY SSYNHQ AIAK + AG  ++QGQ+IGW+GTTG STGPHLHYE
Sbjct: 536 DSGGYGNQTIIRHPNGYESSYNHQSAIAKGVVAGAKIRQGQVIGWVGTTGESTGPHLHYE 595

Query: 599 LIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
           +IVNG KVD  KVR+P+ ++L G  L +F  E++RI+ LL++ E  ++    ++
Sbjct: 596 IIVNGTKVDPMKVRLPDGKSLNGGTLAKFEQERQRIDDLLSSAEKNRQ--LAAN 647


>gi|327193412|gb|EGE60312.1| putative peptidase protein, M23/M37 family [Rhizobium etli
           CNPAF512]
          Length = 640

 Score =  599 bits (1544), Expect = e-169,   Method: Composition-based stats.
 Identities = 275/637 (43%), Positives = 404/637 (63%), Gaps = 14/637 (2%)

Query: 12  ILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKI 71
           ++ S G+ PP+L +        ++R+VSLRWLS TF  GITS V++G +L  ALDG Q++
Sbjct: 1   MIRSLGNEPPLLADGRRA---PDKREVSLRWLSGTFLTGITSSVLMGVALFAALDGRQQL 57

Query: 72  AIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKK 131
           AIP   +   +   A              ++P   +K  ++ I+EV T++ D  K+++++
Sbjct: 58  AIP---AEAYASAAAEAHEDTTVVRGGRLIAPAIAAKPSDRAIMEVSTVVHDGEKEVVRR 114

Query: 132 IPFAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVD-SFEVTTQKIN 190
            PFA+ +MT A  +   +D+P FDPL IFS  + + + Q     I+  D   EV+ +   
Sbjct: 115 QPFAHVKMTLAANHVATEDYPDFDPLAIFSADEPQPAPQSRTGAIYGSDVESEVSLKTNA 174

Query: 191 FPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRH-DHPITYS 249
           FPT  T +++      EE++  + +   +L +   Q   LYY DP+       D  +T  
Sbjct: 175 FPTGKTGMKMASGLSLEEVEENVRSNGSVLTDGNTQLAALYYVDPRRFSNEDADVDLTAG 234

Query: 250 KKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALK 309
              +++E+N T+++P+ +  +  EFADD++P++ +  I  A+  +GY    +  IA  + 
Sbjct: 235 LSARVLEQNMTVSAPESITPQTEEFADDILPVRADAPIAKALTDSGYPQQYADGIAGIIA 294

Query: 310 NEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMD 369
            ++    L K ++LRIG++QK ++  I+R S+Y   +HL+T+A++D  +YV G EP  +D
Sbjct: 295 QQLGASDLEKGDVLRIGIIQKGEQAKIIRASVYRGTRHLVTVAVDDKGKYVPGSEPPMLD 354

Query: 370 INHQMDYMRTSEESP-----NIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPT 424
                    +   +P      +YDGI+RA    GM  ++  LI++ LAS+V+ Q  L+PT
Sbjct: 355 AIATAFDDNSFAPAPGQNLPRVYDGIFRAALSYGMTKDMTALIIKLLASNVDFQAQLRPT 414

Query: 425 DFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPF 484
           D LE FFSV  +  QA++DSELLY++ARFG+T+TRFYRF +P DG+V+YF+ENGKS R F
Sbjct: 415 DTLEAFFSVADSAGQATEDSELLYVNARFGDTQTRFYRFQDPEDGTVDYFDENGKSIRQF 474

Query: 485 LLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWA-GGY 543
           LLR PVP G   SGFGMR HPILG++RMHTGVDWAAPRGT I+A G+G VEKA W  GGY
Sbjct: 475 LLRNPVPNGIFKSGFGMRRHPILGFARMHTGVDWAAPRGTAIIAAGNGTVEKAGWDSGGY 534

Query: 544 GKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNG 603
           G QT+I H NGY SSYNHQ AIAK +  G  ++QGQ+IGW+GTTG STGPHLHYELIVNG
Sbjct: 535 GNQTIIRHANGYESSYNHQSAIAKGVVPGAKIRQGQVIGWVGTTGESTGPHLHYELIVNG 594

Query: 604 IKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNN 640
            KVD  ++R+P  ++L+G+ L +F  E+KRI++LLNN
Sbjct: 595 TKVDPLRIRLPGGKSLQGEALAKFEDERKRIDTLLNN 631


>gi|85713590|ref|ZP_01044580.1| peptidase M23B [Nitrobacter sp. Nb-311A]
 gi|85699494|gb|EAQ37361.1| peptidase  M23B [Nitrobacter sp. Nb-311A]
          Length = 682

 Score =  595 bits (1533), Expect = e-167,   Method: Composition-based stats.
 Identities = 167/654 (25%), Positives = 299/654 (45%), Gaps = 18/654 (2%)

Query: 9   KRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGH 68
           +   +   G  PP+  +      + +RR++S++W S T   G+    +IGG++  +LDG 
Sbjct: 11  RETGIIDLGHEPPLSADGSEAAII-DRRRISVQWFSGTILTGLCGAALIGGAVFASLDGE 69

Query: 69  QKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDI 128
              A  A+   +     +       +S+ ++   P        K II V T+ +  N+D+
Sbjct: 70  TTFARVAE-RVEGGLRGSFGTGDHQASLHKSDRLPPPSEAAAAKQIIRVSTVTRAGNRDV 128

Query: 129 IKKIPFAYARMTFATPYPKVKD-HPKFDPLKIFSEGKIES--SSQMLMDTIHNVDSFEVT 185
           ++  PF       +     +    P F+  ++ ++    +  + +            EV+
Sbjct: 129 MRVRPFVRVSGNLSMATSDLSAKIPPFNAQRLLADVGSHARPAPEDASAAAAAEPDAEVS 188

Query: 186 TQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFL---------LHNKKNQSFTLYYADPQ 236
               +  + + ++ +  T   +E+   + +             +      +     +   
Sbjct: 189 FVTRDLASILPKVTIAATIPIDEVLMRVRDASNWRGNGGVRYTMAESAVDAPGATSSITM 248

Query: 237 TLDQRHDHPITYSKKIKIIEENRTITSPQVLI-DKIPEFADDLIPIQHNTTIFDAMVHAG 295
                         + +I+ EN T+ S             + +  ++   TI   + + G
Sbjct: 249 AYAAEGGVDPYAGFEARIVPENVTLLSKTSEQLTGGNPMGERVHLVRKGDTIVSVLRNHG 308

Query: 296 YSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIV--RFSIYHKQKHLLTIAL 353
            +  D+  IA  L    R   L + + LRI +        +V  R  + ++       AL
Sbjct: 309 ATPEDARAIASTLGLRGRDGGLREGQKLRILMAPAAADQRLVPYRVVVANESTIEAVAAL 368

Query: 354 NDNNEYVLGVEPVKMDINHQMDYMRTSEESP-NIYDGIWRATSFNGMNSNLVKLIMRTLA 412
           +D   YV         +    D     +     +Y  I+     + + S +++ ++R  +
Sbjct: 369 SDLGNYVAVDVASMNSVADAADSADNDDRGGARLYQSIYETALRDKVPSAVIEDMVRIYS 428

Query: 413 SSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVE 472
             ++ Q  ++P D  + F++ +      ++ +E+LY     G    ++YRF  P D +V+
Sbjct: 429 YDIDFQRKVQPGDSFDVFYAGDDEGTPTTEKNEVLYASLTVGGETKKYYRFQTPDDATVD 488

Query: 473 YFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDG 532
           Y++E GKS++ FL+R PV    M SGFG+R HPILGY +MHTGVDWAA  GTPI A G+G
Sbjct: 489 YYDETGKSAKKFLVRKPVASAIMRSGFGVRRHPILGYVKMHTGVDWAASYGTPIFAAGNG 548

Query: 533 IVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTG 592
           +VEKA W GGYGK   I H NGY ++Y H  A AK +  G  V+QGQ+IG++G+TG STG
Sbjct: 549 VVEKAEWEGGYGKYVRIKHNNGYETAYGHMSAFAKGLAPGKRVRQGQVIGFVGSTGRSTG 608

Query: 593 PHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKK 646
            H+HYE++VNG  VD  +VR+P   +L G +L  F  E+ R+ +++++     +
Sbjct: 609 AHVHYEILVNGRFVDPMRVRLPRGRSLDGAILAGFEKERDRLEAMMSSRGAVAR 662


>gi|148252761|ref|YP_001237346.1| putative metalloendopeptidase [Bradyrhizobium sp. BTAi1]
 gi|146404934|gb|ABQ33440.1| putative metalloendopeptidase [Bradyrhizobium sp. BTAi1]
          Length = 687

 Score =  592 bits (1527), Expect = e-167,   Method: Composition-based stats.
 Identities = 160/668 (23%), Positives = 302/668 (45%), Gaps = 30/668 (4%)

Query: 9   KRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGH 68
           +   +   G  PP+  +      + +RR+VS++W S T   G+    +IGG++  +LDG 
Sbjct: 12  REVGMIDLGHEPPLSVDGSEAAVI-DRRRVSVQWFSGTILTGLCGAALIGGAVFASLDGE 70

Query: 69  QKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDI 128
              A   +   +++   A   + ++++++++   P        + ++ V T+ +  ++++
Sbjct: 71  MTFARMPE-RVESALRGAFGANDRVATLRKSDRLPPPSEAAAARNVVRVSTVTRAGSREL 129

Query: 129 IKKIPFAYARMTFATPYPKVKD-HPKFDPLKIFSEGKIESSSQMLMDTIHNV--DSFEVT 185
           I+  P+       +     +    P F+  ++ ++G  + +                EV+
Sbjct: 130 IRVRPYVRISGNLSMTTSDLSAKIPPFNAQRLLNDGDNDKTGSGEDPNNPEAVEPDAEVS 189

Query: 186 TQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQT-------- 237
               +    + + ++  +   +EI   + +      N     +                 
Sbjct: 190 FVTKDLAGVLPKAKIAASVALDEIVMRVRDAANWRGNNGGVRYASLANAAADATGVQGVQ 249

Query: 238 --------LDQRHDHPITYSKKIKIIEENRTITSPQ-VLIDKIPEFADDLIPIQHNTTIF 288
                                + +++ EN T+       I       + +  ++   T+ 
Sbjct: 250 GGDLKLSYASDGTSPDPYAGFETRVVPENVTLLPKTKDQITGGNPLGERVHLVKKGDTVT 309

Query: 289 DAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQ----KDDKFTIVRFSIYHK 344
             +   G +  ++  IA  L    R   L + E LRI +         +    R  + ++
Sbjct: 310 SILRDQGATPDEAKAIAAQLGTRGRDGGLKEGEKLRILMAPSSPAPGARLQPFRVIVANE 369

Query: 345 QKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPN---IYDGIWRATSFNGMNS 401
                  AL+D  +YV         +    D     E+      +Y  I+     N + +
Sbjct: 370 SMIEAVAALSDLGKYVAVDVQSMNTVTETADNTNDEEDDGTGVRLYQSIYETAMRNKVPA 429

Query: 402 NLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQAS-DDSELLYIHARFGETRTRF 460
            +++ ++R  +  V+ Q  ++P D  + F++ +  +   + D SE+L+     G    ++
Sbjct: 430 PVIEDMIRIYSYDVDFQRKVQPGDSFDVFYAGDDDDKPGTNDKSEVLFASLTVGGETKKY 489

Query: 461 YRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAA 520
           YRF  P D  V+Y++E GKS++ FL+R PV    M SGFG R HPILGY +MHTGVDWA 
Sbjct: 490 YRFQTPDDSVVDYYDETGKSAKKFLVRKPVNNAIMRSGFGGRRHPILGYVKMHTGVDWAT 549

Query: 521 PRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQI 580
             GTPI A G+G++EK    GGYGK   I H NGY ++Y H  A AK ++ G  V+QGQ+
Sbjct: 550 AYGTPIFASGNGVLEKVGTEGGYGKYIRIKHNNGYETAYGHLSAFAKGMEPGKRVRQGQV 609

Query: 581 IGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNN 640
           IG++G+TG+STGPH+HYE++VNG  VD  +V++P   +L+G ++  F  E+ R++ ++ +
Sbjct: 610 IGFVGSTGMSTGPHVHYEILVNGRFVDPMRVKLPRGRSLEGQMMASFEKERDRVDQMMTS 669

Query: 641 GENPKKPL 648
             N    +
Sbjct: 670 RGNGASRI 677


>gi|27376518|ref|NP_768047.1| hypothetical protein bll1407 [Bradyrhizobium japonicum USDA 110]
 gi|27349659|dbj|BAC46672.1| bll1407 [Bradyrhizobium japonicum USDA 110]
          Length = 719

 Score =  591 bits (1522), Expect = e-166,   Method: Composition-based stats.
 Identities = 161/655 (24%), Positives = 300/655 (45%), Gaps = 28/655 (4%)

Query: 9   KRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGH 68
           +   +   G  PP+  +      + +RR+VS++W S T   G+    +IGG++  +LDG 
Sbjct: 47  RETGIIDLGHEPPLSVDGSEAAVI-DRRRVSVQWFSGTILTGLCGAALIGGAVFASLDGE 105

Query: 69  QKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDI 128
              A   +   + +   A   + + +++ ++   P        + I+ V T+ +  N+D+
Sbjct: 106 MTFAKVPE-RVEGALRGAFGAADRAATLHKSDRLPPPNESTASRNIVRVSTVARVGNRDV 164

Query: 129 IKKIPFAYARMTFATPYPKVKD-HPKFDPLKIFSEGKIESSSQMLMDTIHNV----DSFE 183
           ++  PF       +     +    P F+  ++ ++  + S  +   D  +N        E
Sbjct: 165 MRVRPFVRIAGNLSMTTSDLSAKIPPFNAQRLLTD--VGSDPKTAADDPNNPEAVEPDAE 222

Query: 184 VTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRH- 242
           V+    +    + + ++      ++I   + +      N   +  +L  A          
Sbjct: 223 VSFVTKDLSPVLPKAKISAVVALDDILMRVRDAANWRGNGGVRYASLANATADVSGASDM 282

Query: 243 ---------DHPITYSKKIKIIEENRTITSPQ-VLIDKIPEFADDLIPIQHNTTIFDAMV 292
                            + +++ EN T+       I       + +  ++   ++   + 
Sbjct: 283 KMAYATEVSPSDPYAGFETRVVPENVTLLPKTKEQITGGNPNGERVHLVKKGDSVASVLR 342

Query: 293 HAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQ--KDDKFTIVRFSIYHKQKHLLT 350
             G +  +   IA  L    R   L + E LRI +       +    R  + +       
Sbjct: 343 DLGATADEIKAIAATLGPRGRDGGLKEGEKLRILMAPASPGARLQPYRVVVANDTMVEAI 402

Query: 351 IALNDNNEYVLGVEPVKMDINHQMDYMRTSE------ESPNIYDGIWRATSFNGMNSNLV 404
            AL+D  +YV         +        + +          +Y  I+     N +   ++
Sbjct: 403 AALSDLGKYVAVDVSSMNTVADATANANSDDDDDDDGTGVRLYQSIYETAMRNKVPMPVI 462

Query: 405 KLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFL 464
             +++  +  V+ Q  ++P D  + F++       +++ +++L+     G    ++YR+ 
Sbjct: 463 DDMIKIYSYDVDFQRKVQPGDSFDVFYAGEDEGVTSNEKNDVLFASLTVGGETKKYYRYQ 522

Query: 465 NPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGT 524
           +P DG V+Y++E+GKS++ FL+R PV    M SGFG R HPILGY +MHTGVDWA   GT
Sbjct: 523 SPDDGVVDYYDESGKSAKKFLVRKPVNNAIMRSGFGGRRHPILGYVKMHTGVDWATAYGT 582

Query: 525 PIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWI 584
           PI A G+G++EKA   GGYGK   I H NGY ++Y H  A AK ++AG  V+QGQ+IG++
Sbjct: 583 PIFASGNGVIEKAGTEGGYGKYIRIKHNNGYETAYGHMSAFAKGMEAGKKVRQGQVIGFV 642

Query: 585 GTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLN 639
           G+TG STGPH+HYE++VNG  VD  +V++P   +L+G +L  F  E+ R++ +++
Sbjct: 643 GSTGASTGPHVHYEILVNGRFVDPLRVKLPRGRSLEGPMLAGFEKERDRLDGMMS 697


>gi|86751348|ref|YP_487844.1| peptidase M23B [Rhodopseudomonas palustris HaA2]
 gi|86574376|gb|ABD08933.1| Peptidase M23B [Rhodopseudomonas palustris HaA2]
          Length = 680

 Score =  590 bits (1520), Expect = e-166,   Method: Composition-based stats.
 Identities = 166/647 (25%), Positives = 293/647 (45%), Gaps = 20/647 (3%)

Query: 9   KRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGH 68
           +       G  PP+  +      + +RR+VS++W S T   G+    +IGG++  +LDG 
Sbjct: 9   REVGFIDLGHEPPLSVDGTEAAVI-DRRRVSVQWFSGTILTGLCGAALIGGAVFASLDGE 67

Query: 69  QKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDI 128
              A   +   + +   A   + K +++ ++   P        + +I V ++ +  N+D+
Sbjct: 68  MTFAKAPE-RVEAALRGAFG-ADKNAALHKSDRLPPPSESQAARNVIRVSSVSRVGNRDV 125

Query: 129 IKKIPFAYARMTFATPYPKVKD-HPKFDPLKIFSEGKIESSSQMLMDTIHNV-DSFEVTT 186
           ++  P+       +    ++    P F+  ++ S+    + +         V    EV+ 
Sbjct: 126 VRVRPYIKIAGNLSLSTTELSAKIPPFNAQRMLSDVGAAAPAAEDAQNPDAVEPDAEVSF 185

Query: 187 QKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQ------ 240
              +    + R ++      +EI   + +      N   +  +    D            
Sbjct: 186 ITRDLGQVLPRAKIAGFIPPDEILMRVRDAANWKGNSGVRYASATAGDIGGGGGDMRLGY 245

Query: 241 ---RHDHPITYSKKIKIIEENRTITSPQVLI-DKIPEFADDLIPIQHNTTIFDAMVHAGY 296
                        + +I+ EN T+               + +  ++   T+   +   G 
Sbjct: 246 APEGASADPYAGFETRIVPENVTLLPKTKEQVTGGNASGERVHIVKKGDTVVSVLRDQGA 305

Query: 297 SNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKD--DKFTIVRFSIYHKQKHLLTIALN 354
           S  D+  +A+AL    R   L + + LRI +       +    R  I +        AL+
Sbjct: 306 SELDANAVAQALGARGRNGGLKEGQKLRILMEPSGAAKQPQPFRVIIANDSAVEAVAALS 365

Query: 355 DNNEYVLG---VEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTL 411
           D   YV           D     D          +Y  I+     N +   ++  +++  
Sbjct: 366 DLGRYVAVDVQALNTVSDTADNSDEDEDDGTGVRLYQSIYETAMRNKVPQAIIDDMIKIY 425

Query: 412 ASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSV 471
           +  V+ Q  ++  D  E F++ +       + +++L+     G    ++YRF  P D  V
Sbjct: 426 SYDVDFQRKVQAGDSFEVFYAGDDETTTTVEKNDVLFAALTVGGETKKYYRFQTPDDSVV 485

Query: 472 EYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGD 531
           ++++E+GKS++ FL+R PV    M SGFG R HPILGY +MHTGVDW+ P GTPI A G+
Sbjct: 486 DFYDESGKSAKKFLVRKPVNNAIMRSGFGGRRHPILGYVKMHTGVDWSTPYGTPIFASGN 545

Query: 532 GIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLST 591
           G++EKA W GGYGK   I H NGY ++Y H  A AK ++ G  V+QGQ+IG++G+TGLST
Sbjct: 546 GVIEKAGWEGGYGKYIRIKHNNGYETAYGHMSAFAKGMEPGKRVRQGQVIGFVGSTGLST 605

Query: 592 GPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLL 638
           G H+HYE++VNG  VD  +V++P   +L+G LL  F  E+ R++++L
Sbjct: 606 GAHVHYEILVNGRFVDPMRVKLPRGRSLEGPLLASFEKERDRLDAML 652


>gi|153008376|ref|YP_001369591.1| peptidase M23B [Ochrobactrum anthropi ATCC 49188]
 gi|151560264|gb|ABS13762.1| peptidase M23B [Ochrobactrum anthropi ATCC 49188]
          Length = 651

 Score =  587 bits (1514), Expect = e-165,   Method: Composition-based stats.
 Identities = 244/646 (37%), Positives = 367/646 (56%), Gaps = 15/646 (2%)

Query: 14  FSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIAI 73
              GD PP+      +       +VS RWL+ TF  G+TS ++IG +L  ALDG +++A 
Sbjct: 9   LDPGDEPPLSVGGRRRPPDRR--EVSARWLAGTFLTGVTSCMLIGVALFAALDGREQLAT 66

Query: 74  PAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKIP 133
           P ++  +     A + +A   +     +S  ++ K  ++   ++ T+ K   +++I+  P
Sbjct: 67  PPEILARNDMPGATDEAA--VTKGGRLVSTVSQQKARDRRRFDLSTMQKVGEREVIRTRP 124

Query: 134 FAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVTTQKINFPT 193
           F + RM  A  +P  + +P F+ L +FSEG                   EV+ + ++FP 
Sbjct: 125 FEFVRMALAVDHPTSRKYPAFNALTVFSEGPAAPQPADAGQIYGAKVESEVSLRVVDFPM 184

Query: 194 DITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKK-- 251
           + T          +E++  + +   LL +   Q  +L+Y DP       D P        
Sbjct: 185 NSTTFDASSDLTVDEVEKVVRDTGGLLTDGDVQVASLHYVDPARFG-GTDSPFALGPALG 243

Query: 252 IKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNE 311
           +KI +EN ++            F+++LIP +    I  A+  AGY+  D+  +A +L   
Sbjct: 244 VKITQENVSVAQRGDDETVGEGFSEELIPFRQTADIKQALEDAGYTGDDAENMADSLAKL 303

Query: 312 VRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDIN 371
           +   +L +  +LR+G   +D    IVR SIY++  HL+T+ALND  +Y+   EP +  + 
Sbjct: 304 MNSPRLKEGSVLRVGTETQDGTDRIVRASIYNRTTHLVTVALNDRGQYIPSDEPEQTPLL 363

Query: 372 HQMDY-----MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDF 426
                            P++YDGI RA    GM+  + + +++ LAS V+LQ  L P+D 
Sbjct: 364 QTAFDGNALPTAIRGNLPSVYDGISRAALAYGMSETMREQLVKMLASDVDLQSRLAPSDQ 423

Query: 427 LETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLL 486
           ++ FFS+    ++   DS+LLY+ A FG T  +FYR+  P   SV+YFN +GKS++ FLL
Sbjct: 424 IDAFFSLPDDPDKPEADSQLLYVSANFGGTTRKFYRYQAPDG-SVDYFNGDGKSAKQFLL 482

Query: 487 RTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQ 546
           R PVP G   S FGMR HPILGYSRMHTGVDWAAPRGTPI+A G+G+VEKA W  GYG Q
Sbjct: 483 RNPVPNGVFRSPFGMRRHPILGYSRMHTGVDWAAPRGTPIIASGNGVVEKAGWTNGYGNQ 542

Query: 547 TLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKV 606
           TLI H NGYVSSY+HQ+AIA+ + AG  V+QGQ+IG++G+TGLSTGPHLHYE+IVNG KV
Sbjct: 543 TLIRHANGYVSSYSHQNAIARGVTAGARVRQGQVIGYVGSTGLSTGPHLHYEMIVNGTKV 602

Query: 607 DSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
           D  ++R+P+ + L G  L+ F  E+ RI++LLN+ +N  K    S+
Sbjct: 603 DPLRIRLPDNKALSGKELEAFKQERDRIDTLLNSDDNGTK--LASN 646


>gi|91978553|ref|YP_571212.1| peptidase M23B [Rhodopseudomonas palustris BisB5]
 gi|91685009|gb|ABE41311.1| peptidase M23B [Rhodopseudomonas palustris BisB5]
          Length = 681

 Score =  587 bits (1512), Expect = e-165,   Method: Composition-based stats.
 Identities = 163/647 (25%), Positives = 292/647 (45%), Gaps = 17/647 (2%)

Query: 9   KRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGH 68
           +   +   G  PP+  +      + +RR+VS++W S T   G+    +IGG++  +LDG 
Sbjct: 13  REIGMIDLGHEPPLSVDGSEAAVI-DRRRVSVQWFSGTILTGLCGAALIGGAVFASLDGE 71

Query: 69  QKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDI 128
              A   +   + +   A   + K +++ ++   P        + +I V T+ +  N+D+
Sbjct: 72  TTFAKAPE-RVEAALRGAFG-ADKNAALHKSDRLPPPSESAAARNVIRVSTVSRVGNRDV 129

Query: 129 IKKIPFAYARMTFATPYPKVKD-HPKFDPLKIFSEGKIESSSQMLMDTIHNV-DSFEVTT 186
           ++  PF       +     +    P F+  ++ S+    + +         V    EV+ 
Sbjct: 130 VRVRPFIKIAGNLSLTTSDLSAKIPAFNAQRMLSDVGAAAPAAEDAQNPDAVEPDAEVSF 189

Query: 187 QKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQT------LDQ 240
              +    + + ++      +EI   + +      N   +  +    +           +
Sbjct: 190 VTRDLGQVLPKAKIAGQIPPDEILMRVRDAANWKGNSGVRYASATSGEIGGDMRLAYAPE 249

Query: 241 RHDHPITYSKKIKIIEENRTITSPQ-VLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNG 299
                     + +I+ EN T+               + +  ++   T+   +   G S  
Sbjct: 250 GASADPYAGFETRIVPENVTLLPKTKEQATGGNPTGERVHLVKKGDTVVSVLRDQGASEE 309

Query: 300 DSAKIAKALKNEVRVDQLTKDEILRIGVVQKD--DKFTIVRFSIYHKQKHLLTIALNDNN 357
           D+  +A AL    R   + + + LRI +            R  I ++       AL+D  
Sbjct: 310 DANAVAAALGARGRSGGVKEGQKLRILMEPAGAGKPSQPFRVIIANESTVEAVAALSDLG 369

Query: 358 EYVLG---VEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASS 414
            YV           D     D          +Y  I+     N +   ++  +++  +  
Sbjct: 370 RYVAVDVQSLNTVSDTADNSDEDEDDGTGVRLYQSIYETALRNKVPQAIIDDMIKIYSYD 429

Query: 415 VNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYF 474
           V+ Q  ++  D  E F++ +       + +++L+     G    ++YRF  P D  V+++
Sbjct: 430 VDFQRKVQAGDSFEVFYAGDDETTATIEKNDVLFASLTVGGETKKYYRFQTPDDAVVDFY 489

Query: 475 NENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIV 534
           +E+GKS++ FL+R PV    M SGFG R HPILGY +MHTGVDW+ P GTPI A G+G++
Sbjct: 490 DESGKSAKKFLVRKPVNNAIMRSGFGGRRHPILGYVKMHTGVDWSTPYGTPIFASGNGVI 549

Query: 535 EKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPH 594
           EKA W GGYGK   + H NGY ++Y H  A AK ++ G  V+QGQ+IG++G+TGLSTG H
Sbjct: 550 EKAGWEGGYGKYIRVKHNNGYETAYGHMSAFAKGMEPGKRVRQGQVIGFVGSTGLSTGAH 609

Query: 595 LHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNG 641
           +HYE++VNG  VD  +V++P   +L G L+  F  E+ R++ +L + 
Sbjct: 610 VHYEILVNGRFVDPMRVKLPRGRSLDGPLMASFEKERDRLDGMLTSR 656


>gi|316935947|ref|YP_004110929.1| peptidase M23 [Rhodopseudomonas palustris DX-1]
 gi|315603661|gb|ADU46196.1| Peptidase M23 [Rhodopseudomonas palustris DX-1]
          Length = 677

 Score =  586 bits (1511), Expect = e-165,   Method: Composition-based stats.
 Identities = 168/646 (26%), Positives = 294/646 (45%), Gaps = 17/646 (2%)

Query: 7   SNKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALD 66
           + +       G  PP+  +      + +RR+VS++W S T   G+    +IGG++  +LD
Sbjct: 7   TGREVGYIDLGHEPPLSVDGSEAAVI-DRRRVSVQWFSGTILTGLCGAALIGGAVFASLD 65

Query: 67  GHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNK 126
           G    A   +L  Q +   A   + K +++ ++   P        + +I V T+ +  ++
Sbjct: 66  GETTFAKAPEL-VQAALRGAFG-ADKTAALHKSDRLPPPSEAALARSVIRVSTVSRIGHR 123

Query: 127 DIIKKIPFAYARMTFATPYPKVKD-HPKFDPLKIFSEGKIESSSQMLMDTIHNV-DSFEV 184
           D+++  PF       +     +    P F+  ++ S+    + S         V    EV
Sbjct: 124 DVVRVRPFVKISGNLSLTTSDLSAKIPAFNAQRMLSDVGAPAQSAEDAQNPDAVEPDAEV 183

Query: 185 TTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQT------L 238
           +    +  T + R ++      +EI   + +      N   +  +    D          
Sbjct: 184 SFVTRDLGTVLPRAKIAGQIAPDEILMRVRDAANWKGNSGVRYASAAAGDFGGDVKLAYA 243

Query: 239 DQRHDHPITYSKKIKIIEENRTITSPQVLI-DKIPEFADDLIPIQHNTTIFDAMVHAGYS 297
            +          + +I+ EN T+               +    ++   ++   +   G +
Sbjct: 244 PEGPSADPYAGFETRIVPENVTLLPKTKEQVTGGNPTGERTHIVKKGDSVVSVLRDQGAA 303

Query: 298 NGDSAKIAKALKNEVRVDQLTKDEILRIGVVQ--KDDKFTIVRFSIYHKQKHLLTIALND 355
             D+  +A AL    R   L + + LRI +            R  +          AL+D
Sbjct: 304 EEDARAVAAALGARGRDGGLKEGQKLRILMESSGPGKPQQPFRVIVAGDSTVEAVAALSD 363

Query: 356 NNEYVLGVEPVKMDINHQMDYMRTSEESP---NIYDGIWRATSFNGMNSNLVKLIMRTLA 412
              YV         ++   D     E+      +Y  I+     N +   ++  ++R  +
Sbjct: 364 LGRYVAVDVQSLNTVSDTADNSEDDEDDGSGVRLYQSIYETALRNKVPQTVIDDMIRIYS 423

Query: 413 SSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVE 472
             V+ Q  ++  D  E F++ +       + +++L+     G    ++YRF  P D +V+
Sbjct: 424 YDVDFQRRVQAGDSFEVFYAGDDETTATIEKNDVLFAALTVGGETKKYYRFQTPDDAAVD 483

Query: 473 YFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDG 532
           +++E GKS++ FL+R PV    M SGFG R HPILGY +MHTGVDW+ P GTPI A G+G
Sbjct: 484 FYDETGKSAKKFLVRKPVNNAIMRSGFGGRRHPILGYVKMHTGVDWSTPYGTPIFASGNG 543

Query: 533 IVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTG 592
           ++EKA W GGYGK   I H NGY ++Y H  A AK ++ G  V+QGQ+IG++G+TGLSTG
Sbjct: 544 VIEKAAWEGGYGKYIRIKHANGYETAYGHMSAFAKGMEPGKRVRQGQVIGFVGSTGLSTG 603

Query: 593 PHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLL 638
            H+HYE++VNG  VD  +VR+P   +L G +L  F  E+ R+++++
Sbjct: 604 AHVHYEILVNGRFVDPMRVRLPRGRSLDGQMLAAFEKERDRLDAMM 649


>gi|115526328|ref|YP_783239.1| peptidase M23B [Rhodopseudomonas palustris BisA53]
 gi|115520275|gb|ABJ08259.1| peptidase M23B [Rhodopseudomonas palustris BisA53]
          Length = 690

 Score =  585 bits (1508), Expect = e-165,   Method: Composition-based stats.
 Identities = 157/646 (24%), Positives = 295/646 (45%), Gaps = 20/646 (3%)

Query: 14  FSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIAI 73
              G  PP+  +      + +RR+VS++W S T   G+    +IGG++  +LDG    A 
Sbjct: 18  IDLGHEPPLSVDGSEAAVI-DRRRVSVQWFSGTILTGLCGAALIGGAVFASLDGEMTFAK 76

Query: 74  PAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKIP 133
             +   + +   A   + K +++ ++   P        + ++ V T+ +  N+D+++  P
Sbjct: 77  VPE-RVEGALRGAFGANDKNAALHKSDRLPPPSESAAARRVVRVSTVTRVGNRDVMRVRP 135

Query: 134 FAYARMTFATPYPKVKD-HPKFDPLKIFSEGKIESSSQMLMDTIHNV--DSFEVTTQKIN 190
           F       A    ++    P F+  ++ ++    +++        +      EV+    +
Sbjct: 136 FIRIAGNLALSTSELSAKIPPFNAQRMLTDVGTSTTAAAEDAQNPDAVEPDAEVSFVTRD 195

Query: 191 FPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQ--------TLDQRH 242
             + + + ++      +E+   + +      +   +       D            +   
Sbjct: 196 LGSVLPKAKIAAVVAIDEVLMRVRDASNWRGHSGVRYTMANAGDAAQGNVKMAYATEGNV 255

Query: 243 DHPITYSKKIKIIEENRTITSPQ-VLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDS 301
                   + +++ EN T+               + +  ++   +I   +   G +  + 
Sbjct: 256 AADPYAGFETRVVPENVTLLPKTKDQATGGNPAGERVHIVKKGDSIATILRDQGATAEEI 315

Query: 302 AKIAKALKNEVRVDQLTKDEILRIGVVQ--KDDKFTIVRFSIYHKQKHLLTIALNDNNEY 359
             I   L    R   L + + +R+ +       +    R  +  +       AL+D   Y
Sbjct: 316 RAIVATLGPRGRDGGLREGQKIRLLMTPAGPGMRAQPYRVVVASEATIEAVAALSDLGRY 375

Query: 360 VLGVEPVKMDINHQMDYMRTSE----ESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSV 415
           V         +    D     E        +Y  I+     N + +++++ +++  +  V
Sbjct: 376 VAVDVQSMNTVAEIPDAGDDEEDDDGSGVRLYQSIYETALRNKVPASVIEDMVKIYSYDV 435

Query: 416 NLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFN 475
           + Q  ++  D  E FF+ +      ++ +++LY     G    ++YRF  P D  V+Y++
Sbjct: 436 DFQRRVQAGDSFEVFFAGDDEGTAVTEKNDVLYASLSVGGETKKYYRFQTPDDSVVDYYD 495

Query: 476 ENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVE 535
           E+GKS++ FL+R P+  G M SGFG R HPILGY +MHTGVDW+AP GTPI A G+G+VE
Sbjct: 496 ESGKSAKKFLVRKPLNTGIMRSGFGGRRHPILGYVKMHTGVDWSAPYGTPIFASGNGVVE 555

Query: 536 KANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHL 595
           K  W GGYGK   I H NGY ++Y H  A AK ++ G  V+QGQ+IG++G+TGLSTG H+
Sbjct: 556 KFGWEGGYGKYVRIRHNNGYETAYGHMSAYAKGLEVGKRVRQGQVIGFVGSTGLSTGAHV 615

Query: 596 HYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNG 641
           HYE++VN   VD  +V++P   +L G L+  F  E+ R+++++ + 
Sbjct: 616 HYEILVNSRFVDPMRVKLPRGRSLDGTLMASFEKERDRLDAMMTSR 661


>gi|306842982|ref|ZP_07475615.1| peptidase M23B [Brucella sp. BO2]
 gi|306844836|ref|ZP_07477419.1| peptidase M23B [Brucella sp. BO1]
 gi|306274768|gb|EFM56549.1| peptidase M23B [Brucella sp. BO1]
 gi|306286853|gb|EFM58382.1| peptidase M23B [Brucella sp. BO2]
          Length = 651

 Score =  584 bits (1504), Expect = e-164,   Method: Composition-based stats.
 Identities = 240/645 (37%), Positives = 363/645 (56%), Gaps = 13/645 (2%)

Query: 14  FSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIAI 73
              GD PP+      +       +VS RWL+ TF  G+TS ++IG +L  ALDG +++A 
Sbjct: 9   LDPGDEPPLSVGGRRRPPDRR--EVSARWLAGTFLTGVTSCMLIGIALFAALDGREQLAT 66

Query: 74  PAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKIP 133
           P ++  +             ++     +S  ++ K  ++   ++ T+ +   +++I+  P
Sbjct: 67  PPEILARNEMPGI--TEDDTATKGGRLISTVSQQKTRDRRRFDLSTMQRVGEREVIRTKP 124

Query: 134 FAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVTTQKINFPT 193
           F + RM  A  +P  + +P F+ + IFSEG                   EV+ + ++FP 
Sbjct: 125 FEFVRMALAVDHPTNRKYPPFNAMTIFSEGPAAPQPSDAGQIYGAKVESEVSLRVVDFPI 184

Query: 194 DITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLD-QRHDHPITYSKKI 252
                        +E++  + +   LL +   Q  +L+Y DP           ++    +
Sbjct: 185 STATFDASSDLTVDEVEKVVRDTGGLLTDGDVQVASLHYVDPARFGGNDSPFALSPPLGV 244

Query: 253 KIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEV 312
           KI +EN +I            F+++LIP +    I  A+  AGY+  D++ +A+AL   +
Sbjct: 245 KITQENVSIAPRSDDEQVNEGFSEELIPFRQTKDIAQALEDAGYTGEDASNMAEALAKLM 304

Query: 313 RVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINH 372
              +L +  +LR+G    D    IVR SIY++  HL+T+ALND  +YV   EP +  +  
Sbjct: 305 NSPRLKQGSVLRVGTESHDGNDRIVRASIYNRTTHLVTVALNDRQQYVPSDEPEETPLLQ 364

Query: 373 QMDY-----MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFL 427
                           P++YDGI  A    GM   + + +++ LAS V+LQ  L P+D +
Sbjct: 365 TAFDGNAAPAAIRGNLPSVYDGISHAALAYGMTETMREQLVKMLASDVDLQARLSPSDAI 424

Query: 428 ETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLR 487
           + FFS+     +  +DS+LLY+ A FG T  +FYR+  P   SV+Y+NE+GKS++ FLLR
Sbjct: 425 DAFFSLPDDPEKPENDSQLLYVAATFGGTTRKFYRYQAPDG-SVDYYNEDGKSAKQFLLR 483

Query: 488 TPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQT 547
            PVP G   S FGMR HPILGY+RMHTGVDWAAPRGTPI+A G+G+VEKA W+ GYG QT
Sbjct: 484 NPVPNGIFRSPFGMRRHPILGYTRMHTGVDWAAPRGTPIIAAGNGVVEKAGWSNGYGNQT 543

Query: 548 LIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVD 607
           LI H NGYV+SY+HQ+AIA+ I  G  V+QGQ+IG++G+TGLSTGPHLHYELIVNG KVD
Sbjct: 544 LIRHANGYVTSYSHQNAIARGITPGARVRQGQVIGYVGSTGLSTGPHLHYELIVNGTKVD 603

Query: 608 STKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
           + ++R+P+ + LKG   + F  E+ RI++LLN+ EN  K    S+
Sbjct: 604 ALRIRLPDNKALKGKEFEAFKQERDRIDTLLNSDENGTK--LASN 646


>gi|146343228|ref|YP_001208276.1| putative metalloendopeptidase [Bradyrhizobium sp. ORS278]
 gi|146196034|emb|CAL80061.1| putative metalloendopeptidase [Bradyrhizobium sp. ORS278]
          Length = 683

 Score =  583 bits (1503), Expect = e-164,   Method: Composition-based stats.
 Identities = 157/658 (23%), Positives = 295/658 (44%), Gaps = 27/658 (4%)

Query: 7   SNKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALD 66
             +   +   G  PP+  +      + +RR+VS++W S T   G+    +IGG++  +LD
Sbjct: 10  MAREVGMIDLGHEPPLSVDGSEAAVI-DRRRVSVQWFSGTILTGLCGAALIGGAVFASLD 68

Query: 67  GHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNK 126
           G    A   +   +++   A   + ++++++++   P        + ++ V T+ +   +
Sbjct: 69  GELTFARMPE-RVESALRGAFGGNDRVATLRKSDRLPPPSEAAAARNVVRVSTVTRAGTR 127

Query: 127 DIIKKIPFAYARMTFATPYPKVKD-HPKFDPLKIFSEGKIESSSQMLMDTIHNV--DSFE 183
           ++I+  P+       +     +    P F+  ++ ++   + +                E
Sbjct: 128 EVIRVRPYVRISGNLSMTTSDLSAKIPPFNAQRLLTDADNDKTGTGDDPNNPAAIEPDAE 187

Query: 184 VTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQT------ 237
           V+    +    + + ++  +   +EI   + +      N     +               
Sbjct: 188 VSFVTKDLAAVLPKAKIAASVALDEIVMRVRDAANWRGNNGGVRYASLANAAADASGATG 247

Query: 238 ------LDQRHDHPITYSKKIKIIEENRTITSPQ-VLIDKIPEFADDLIPIQHNTTIFDA 290
                              + +++ EN T+       I       + +  ++   T+   
Sbjct: 248 DLKLAYASDGAAPDPYAGFETRVVPENVTLLPKTKEQITGGNPLGERVHLVKKGDTVASI 307

Query: 291 MVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQ----KDDKFTIVRFSIYHKQK 346
           +   G +  ++  IA  L    R   L + E LRI +         +   VR  + +   
Sbjct: 308 LRDQGATPDEAKAIAGQLGPRGREGGLKEGEKLRIMMAPASPAPGARLQPVRVIVANDTM 367

Query: 347 HLLTIALNDNNEYVLGV----EPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSN 402
                AL+D  +YV         V    ++  D          +Y  I+     N + + 
Sbjct: 368 IEAVAALSDLGKYVAVDVQSMNTVTETADNTNDDEEDDGTGVRLYQSIYETALRNKVPAP 427

Query: 403 LVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQAS-DDSELLYIHARFGETRTRFY 461
           +++ ++R  +  V+ Q  ++P D  + F++ +  +   + + SE+L+     G    ++Y
Sbjct: 428 VIEDMIRIYSYDVDFQRRVQPGDSFDVFYAGDDDDKPGTNEKSEVLFASLTVGGETKKYY 487

Query: 462 RFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAP 521
           RF  P D  V+Y++E GKS++ FL+R PV    M SGFG R HPILGY +MHTGVDWA  
Sbjct: 488 RFQTPDDSVVDYYDETGKSAKKFLVRKPVNNAIMRSGFGGRRHPILGYVKMHTGVDWATA 547

Query: 522 RGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQII 581
            GTPI A G+G++EK    GGYGK   I H NGY ++Y H  A  K ++ G  V+QGQ+I
Sbjct: 548 YGTPIFAAGNGVLEKVGTEGGYGKYIRIKHNNGYETAYGHMSAFVKGMEPGKRVRQGQVI 607

Query: 582 GWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLN 639
           G++G+TG STGPH+HYE++VNG  VD  +V++P   +L+G ++  F  E+ R++ ++ 
Sbjct: 608 GFVGSTGQSTGPHVHYEILVNGRFVDPLRVKLPRGRSLEGQIMAGFEKERDRVDQMMA 665


>gi|17986481|ref|NP_539115.1| lysostaphin [Brucella melitensis bv. 1 str. 16M]
 gi|23502714|ref|NP_698841.1| M24/M37 family peptidase [Brucella suis 1330]
 gi|161619780|ref|YP_001593667.1| peptidase M23B [Brucella canis ATCC 23365]
 gi|163843888|ref|YP_001628292.1| peptidase M23B [Brucella suis ATCC 23445]
 gi|225853301|ref|YP_002733534.1| peptidase M23B [Brucella melitensis ATCC 23457]
 gi|254690011|ref|ZP_05153265.1| peptidase M23B [Brucella abortus bv. 6 str. 870]
 gi|254700511|ref|ZP_05162339.1| peptidase M23B [Brucella suis bv. 5 str. 513]
 gi|254704881|ref|ZP_05166709.1| peptidase M23B [Brucella suis bv. 3 str. 686]
 gi|256045476|ref|ZP_05448361.1| peptidase M23B [Brucella melitensis bv. 1 str. Rev.1]
 gi|256112201|ref|ZP_05453122.1| peptidase M23B [Brucella melitensis bv. 3 str. Ether]
 gi|256258267|ref|ZP_05463803.1| peptidase M23B [Brucella abortus bv. 9 str. C68]
 gi|256263210|ref|ZP_05465742.1| peptidase M23/M37 [Brucella melitensis bv. 2 str. 63/9]
 gi|260562784|ref|ZP_05833270.1| peptidase M23/M37 [Brucella melitensis bv. 1 str. 16M]
 gi|260567645|ref|ZP_05838115.1| peptidase M23/M37 [Brucella suis bv. 4 str. 40]
 gi|260755547|ref|ZP_05867895.1| peptidase M23B [Brucella abortus bv. 6 str. 870]
 gi|260884571|ref|ZP_05896185.1| peptidase M23B [Brucella abortus bv. 9 str. C68]
 gi|261751014|ref|ZP_05994723.1| peptidase M23B [Brucella suis bv. 5 str. 513]
 gi|261755575|ref|ZP_05999284.1| peptidase M23B [Brucella suis bv. 3 str. 686]
 gi|265991900|ref|ZP_06104457.1| peptidase M23B [Brucella melitensis bv. 1 str. Rev.1]
 gi|265993628|ref|ZP_06106185.1| peptidase M23B [Brucella melitensis bv. 3 str. Ether]
 gi|297247109|ref|ZP_06930827.1| peptidase M23B [Brucella abortus bv. 5 str. B3196]
 gi|17982081|gb|AAL51379.1| lysostaphin [Brucella melitensis bv. 1 str. 16M]
 gi|23348728|gb|AAN30756.1| peptidase, M23/M37 family [Brucella suis 1330]
 gi|161336591|gb|ABX62896.1| peptidase M23B [Brucella canis ATCC 23365]
 gi|163674611|gb|ABY38722.1| peptidase M23B [Brucella suis ATCC 23445]
 gi|225641666|gb|ACO01580.1| peptidase M23B [Brucella melitensis ATCC 23457]
 gi|260152800|gb|EEW87892.1| peptidase M23/M37 [Brucella melitensis bv. 1 str. 16M]
 gi|260157163|gb|EEW92243.1| peptidase M23/M37 [Brucella suis bv. 4 str. 40]
 gi|260675655|gb|EEX62476.1| peptidase M23B [Brucella abortus bv. 6 str. 870]
 gi|260874099|gb|EEX81168.1| peptidase M23B [Brucella abortus bv. 9 str. C68]
 gi|261740767|gb|EEY28693.1| peptidase M23B [Brucella suis bv. 5 str. 513]
 gi|261745328|gb|EEY33254.1| peptidase M23B [Brucella suis bv. 3 str. 686]
 gi|262764609|gb|EEZ10530.1| peptidase M23B [Brucella melitensis bv. 3 str. Ether]
 gi|263002966|gb|EEZ15259.1| peptidase M23B [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093154|gb|EEZ17268.1| peptidase M23/M37 [Brucella melitensis bv. 2 str. 63/9]
 gi|297174278|gb|EFH33625.1| peptidase M23B [Brucella abortus bv. 5 str. B3196]
 gi|326409866|gb|ADZ66931.1| peptidase M23B [Brucella melitensis M28]
 gi|326539580|gb|ADZ87795.1| peptidase M23B [Brucella melitensis M5-90]
          Length = 651

 Score =  582 bits (1501), Expect = e-164,   Method: Composition-based stats.
 Identities = 240/645 (37%), Positives = 363/645 (56%), Gaps = 13/645 (2%)

Query: 14  FSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIAI 73
              GD PP+      +       +VS RWL+ TF  G+TS ++IG +L  ALDG +++A 
Sbjct: 9   LDPGDEPPLSVGGRRRPPDRR--EVSARWLAGTFLTGVTSCMLIGIALFAALDGREQLAT 66

Query: 74  PAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKIP 133
           P ++  +             ++     +S  ++ K  ++   ++ T+ +   +++I+  P
Sbjct: 67  PPEILARNEMPGI--TEDDTATKGGRLISTVSQQKTRDRRRFDLSTMQRVGEREVIRTKP 124

Query: 134 FAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVTTQKINFPT 193
           F + RM  A  +P  + +P F+ + IFSEG                   EV+ + ++FP 
Sbjct: 125 FEFVRMALAVDHPTNRKYPPFNAMTIFSEGPAAPQPSDAGQIYGAKVESEVSLRMVDFPI 184

Query: 194 DITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLD-QRHDHPITYSKKI 252
                        +E++  + +   LL +   Q  +L+Y DP           ++    +
Sbjct: 185 STATFDASSDLTVDEVEKVVRDTGGLLTDGDVQVASLHYVDPARFGGNDSPFALSPPLGV 244

Query: 253 KIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEV 312
           KI +EN +I            F+++LIP +    I  A+  AGY+  D++ +A+AL   +
Sbjct: 245 KITQENVSIAPRSDDEQVNEGFSEELIPFRQTADIAQALEDAGYTGEDASNMAEALAKLM 304

Query: 313 RVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINH 372
              +L +  +LR+G    D    IVR SIY++  HL+T+ALND  +YV   EP +  +  
Sbjct: 305 NSPRLKQGSVLRVGTESHDGIDRIVRASIYNRTTHLVTVALNDRQQYVPSDEPEETPLLQ 364

Query: 373 QMDY-----MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFL 427
                           P++YDGI  A    GM   + + +++ LAS V+LQ  L P+D +
Sbjct: 365 TAFDGNAAPAAIRGNLPSVYDGISHAALAYGMTETMREQLVKMLASDVDLQARLSPSDAI 424

Query: 428 ETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLR 487
           + FFS+     +  +DS+LLY+ A FG T  +FYR+  P   SV+Y+NE+GKS++ FLLR
Sbjct: 425 DAFFSLPDDPEKPENDSQLLYVAATFGGTTRKFYRYQAPDG-SVDYYNEDGKSAKQFLLR 483

Query: 488 TPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQT 547
            PVP G   S FGMR HPILGY+RMHTGVDWAAPRGTPI+A G+G+VEKA W+ GYG QT
Sbjct: 484 NPVPNGIFRSPFGMRRHPILGYTRMHTGVDWAAPRGTPIIAAGNGVVEKAGWSNGYGNQT 543

Query: 548 LIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVD 607
           LI H NGYV+SY+HQ+AIA+ I  G  V+QGQ+IG++G+TGLSTGPHLHYELIVNG KVD
Sbjct: 544 LIRHANGYVTSYSHQNAIARGITPGARVRQGQVIGYVGSTGLSTGPHLHYELIVNGTKVD 603

Query: 608 STKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
           + ++R+P+ + LKG   + F  E+ RI++LLN+ EN  K    S+
Sbjct: 604 ALRIRLPDNKALKGKEFEAFKQERDRIDTLLNSDENGTK--LASN 646


>gi|39937491|ref|NP_949767.1| peptidase M23B [Rhodopseudomonas palustris CGA009]
 gi|192293278|ref|YP_001993883.1| peptidase M23 [Rhodopseudomonas palustris TIE-1]
 gi|39651350|emb|CAE29872.1| Peptidase M23/M37 [Rhodopseudomonas palustris CGA009]
 gi|192287027|gb|ACF03408.1| Peptidase M23 [Rhodopseudomonas palustris TIE-1]
          Length = 676

 Score =  582 bits (1501), Expect = e-164,   Method: Composition-based stats.
 Identities = 169/642 (26%), Positives = 294/642 (45%), Gaps = 16/642 (2%)

Query: 7   SNKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALD 66
           + +       G  PP+  +      + +RR+VS++W S T   G+    +IGG++  +LD
Sbjct: 7   TGREVGYIDLGHEPPLSVDGSEAAVI-DRRRVSVQWFSGTILTGLCGAALIGGAVFASLD 65

Query: 67  GHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNK 126
           G    A   +L  Q +   A   + K +++ ++   P        + +I V T+ +   +
Sbjct: 66  GETTFAKAPEL-VQAALRGAFG-ADKNAALHKSDRLPPPSEAALARSVIRVSTVSRVGQR 123

Query: 127 DIIKKIPFAYARMTFATPYPKVKD-HPKFDPLKIFSE-GKIESSSQMLMDTIHNVDSFEV 184
           D+++  PF       +     +    P F+  ++ S+ G    +++   +        EV
Sbjct: 124 DVVRVRPFVKISGNLSLTTSDLSAKIPAFNAQRMLSDVGGPTQTAEDAQNPDAVEPDAEV 183

Query: 185 TTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQT-----LD 239
           +    +  T + R ++      +EI   + +      N   +  +               
Sbjct: 184 SFVTRDLGTVLPRAKIAGQIPPDEILMRVRDAAHWKGNSGVRYASAAGDFGGDVKLAYAP 243

Query: 240 QRHDHPITYSKKIKIIEENRTITSPQVLI-DKIPEFADDLIPIQHNTTIFDAMVHAGYSN 298
           +          + +I+ EN T+               +    ++   ++   +   G + 
Sbjct: 244 EGPSADPYAGFETRIVPENVTLLPKTKEQVTGGNPTGERTHIVKKGDSVVSVLRDQGAAE 303

Query: 299 GDSAKIAKALKNEVRVDQLTKDEILRIGVVQ--KDDKFTIVRFSIYHKQKHLLTIALNDN 356
            D+  +A AL    R   L + + LRI +            R  + +        AL+D 
Sbjct: 304 EDARAVAAALGARGRDGGLKEGQKLRILMESSGPGKAPQPFRVIVANDSAVEAVAALSDL 363

Query: 357 NEYVLGVEPVKMDINHQMDYMRTSEESPN---IYDGIWRATSFNGMNSNLVKLIMRTLAS 413
             YV         ++   D     E+      +Y  I+     N +  +++  ++R  + 
Sbjct: 364 GRYVAVDVQSLNTVSETADNSDEDEDDGTGVRLYQSIYETALRNKVPQSVIDDMIRIYSY 423

Query: 414 SVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEY 473
            V+ Q  ++  D  E F++ +       + +++L+     G    ++YRF  P D +V++
Sbjct: 424 DVDFQRKVQAGDSFEVFYAGDDETTATVEKNDVLFASLTVGGETKKYYRFQTPDDAAVDF 483

Query: 474 FNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGI 533
           ++E GKS++ FL+R PV    M SGFG R HPILGY +MHTGVDW+ P GTPI A G+G+
Sbjct: 484 YDETGKSAKKFLVRKPVNQAIMRSGFGARRHPILGYVKMHTGVDWSTPYGTPIFASGNGV 543

Query: 534 VEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGP 593
           VEKA W GGYGK   I H NGY ++Y H  A AK ++ G  V+QGQ+IG++G+TGLSTG 
Sbjct: 544 VEKAGWEGGYGKYIRIKHANGYETAYGHMSAFAKGMEPGKRVRQGQVIGFVGSTGLSTGA 603

Query: 594 HLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRIN 635
           H+HYE+IVNG  VD  +VR+P   +L+G LL  F  E+ R++
Sbjct: 604 HVHYEIIVNGRFVDPMRVRLPRGRSLEGPLLAGFEKERDRLD 645


>gi|256059843|ref|ZP_05450031.1| peptidase M23B [Brucella neotomae 5K33]
 gi|261323813|ref|ZP_05963010.1| peptidase M23B [Brucella neotomae 5K33]
 gi|261299793|gb|EEY03290.1| peptidase M23B [Brucella neotomae 5K33]
          Length = 651

 Score =  582 bits (1500), Expect = e-164,   Method: Composition-based stats.
 Identities = 240/645 (37%), Positives = 362/645 (56%), Gaps = 13/645 (2%)

Query: 14  FSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIAI 73
              GD PP+      +       +VS RWL+ TF  G+TS ++IG +L  ALDG +++A 
Sbjct: 9   LDPGDEPPLSVGGRRRPPDRR--EVSARWLAGTFLTGVTSCMLIGIALFAALDGREQLAT 66

Query: 74  PAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKIP 133
           P ++  +             ++     +S  ++ K  ++   ++ T+ +   +++I+  P
Sbjct: 67  PPEILARNEMPGI--TEDDTATKGGRLISTVSQQKTRDRRRFDLSTMQRVGEREVIRTKP 124

Query: 134 FAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVTTQKINFPT 193
           F + RM  A  +P  + +P F+ + IFSEG                   EV+ + ++FP 
Sbjct: 125 FEFVRMALAVDHPTNRKYPPFNAMTIFSEGPAAPQPSDAGQIYGAKVESEVSLRMVDFPI 184

Query: 194 DITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLD-QRHDHPITYSKKI 252
                        +E++  + +   LL +   Q  +L+Y DP           ++    +
Sbjct: 185 STATFDASSDLTVDEVEKVVRDTGGLLTDGDVQVASLHYVDPARFGGNDSPFALSPPLGV 244

Query: 253 KIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEV 312
           KI +EN +I            F++ LIP +    I  A+  AGY+  D++ +A+AL   +
Sbjct: 245 KITQENVSIAPRSDDEQVNEGFSEGLIPFRQTADIAQALEDAGYTGEDASNMAEALAKLM 304

Query: 313 RVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINH 372
              +L +  +LR+G    D    IVR SIY++  HL+T+ALND  +YV   EP +  +  
Sbjct: 305 NSPRLKQGSVLRVGTESHDGIDRIVRASIYNRTTHLVTVALNDRQQYVPSDEPEETPLLQ 364

Query: 373 QMDY-----MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFL 427
                           P++YDGI  A    GM   + + +++ LAS V+LQ  L P+D +
Sbjct: 365 TAFDGNAAPAAIRGNLPSVYDGISHAALAYGMTETMREQLVKMLASDVDLQARLSPSDAI 424

Query: 428 ETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLR 487
           + FFS+     +  +DS+LLY+ A FG T  +FYR+  P   SV+Y+NE+GKS++ FLLR
Sbjct: 425 DAFFSLPDDPEKPENDSQLLYVAATFGGTTRKFYRYQAPDG-SVDYYNEDGKSAKQFLLR 483

Query: 488 TPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQT 547
            PVP G   S FGMR HPILGY+RMHTGVDWAAPRGTPI+A G+G+VEKA W+ GYG QT
Sbjct: 484 NPVPNGIFRSPFGMRRHPILGYTRMHTGVDWAAPRGTPIIAAGNGVVEKAGWSNGYGNQT 543

Query: 548 LIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVD 607
           LI H NGYV+SY+HQ+AIA+ I  G  V+QGQ+IG++G+TGLSTGPHLHYELIVNG KVD
Sbjct: 544 LIRHANGYVTSYSHQNAIARGITPGARVRQGQVIGYVGSTGLSTGPHLHYELIVNGTKVD 603

Query: 608 STKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
           + ++R+P+ + LKG   + F  E+ RI++LLN+ EN  K    S+
Sbjct: 604 ALRIRLPDNKALKGKEFEAFKQERDRIDTLLNSDENGTK--LASN 646


>gi|62290722|ref|YP_222515.1| M24/M37 family peptidase [Brucella abortus bv. 1 str. 9-941]
 gi|254696127|ref|ZP_05157955.1| M24/M37 family peptidase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254731045|ref|ZP_05189623.1| M24/M37 family peptidase [Brucella abortus bv. 4 str. 292]
 gi|260758770|ref|ZP_05871118.1| peptidase M23B [Brucella abortus bv. 4 str. 292]
 gi|260760494|ref|ZP_05872837.1| peptidase M23B [Brucella abortus bv. 2 str. 86/8/59]
 gi|62196854|gb|AAX75154.1| peptidase, M23/M37 family [Brucella abortus bv. 1 str. 9-941]
 gi|260669088|gb|EEX56028.1| peptidase M23B [Brucella abortus bv. 4 str. 292]
 gi|260670926|gb|EEX57747.1| peptidase M23B [Brucella abortus bv. 2 str. 86/8/59]
          Length = 651

 Score =  582 bits (1499), Expect = e-164,   Method: Composition-based stats.
 Identities = 240/645 (37%), Positives = 363/645 (56%), Gaps = 13/645 (2%)

Query: 14  FSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIAI 73
              GD PP+      +       +VS RWL+ TF  G+TS ++IG +L  ALDG +++A 
Sbjct: 9   LDPGDEPPLSVGGRRRPPDRR--EVSARWLAGTFLTGVTSCMLIGIALFAALDGREQLAT 66

Query: 74  PAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKIP 133
           P ++  +             ++     +S  ++ K  ++   ++ T+ +   +++I+  P
Sbjct: 67  PPEILARNEMPGI--TEDDTATKGGRLISTVSQQKTRDRRRFDLSTMQRVGEREVIRTKP 124

Query: 134 FAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVTTQKINFPT 193
           F + RM  A  +P  + +P F+ + IFSEG                   EV+ + ++FP 
Sbjct: 125 FEFVRMALAVDHPTNRKYPPFNAMTIFSEGPAAPQPSDAGQIYGAKVESEVSLRMVDFPI 184

Query: 194 DITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLD-QRHDHPITYSKKI 252
                        +E++  + +   LL +   Q  +L+Y DP           ++    +
Sbjct: 185 STATFDASSDLTVDEVEKVVRDTGGLLTDGDVQVASLHYVDPARFGGNDSPFALSPPLGV 244

Query: 253 KIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEV 312
           KI +EN +I            F+++LIP +    I  A+  AGY+  D++ +A+AL   +
Sbjct: 245 KITQENVSIAPRSDDEQVNEGFSEELIPFRQTADIAQALEDAGYTGEDASNMAEALAKLM 304

Query: 313 RVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINH 372
              +L +  +LR+G    D    IVR SIY++  HL+T+ALND  +YV   EP +  +  
Sbjct: 305 NSPRLKQGGVLRVGTESHDGIDRIVRASIYNRTTHLVTVALNDRQQYVPSDEPEETPLLQ 364

Query: 373 QMDY-----MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFL 427
                           P++YDGI  A    GM   + + +++ LAS V+LQ  L P+D +
Sbjct: 365 TAFDGNAAPAAIRGNLPSVYDGISHAALAYGMTETMREQLVKMLASDVDLQARLSPSDAI 424

Query: 428 ETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLR 487
           + FFS+     +  +DS+LLY+ A FG T  +FYR+  P   SV+Y+NE+GKS++ FLLR
Sbjct: 425 DAFFSLPDDPEKPENDSQLLYVAATFGGTTRKFYRYQAPDG-SVDYYNEDGKSAKQFLLR 483

Query: 488 TPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQT 547
            PVP G   S FGMR HPILGY+RMHTGVDWAAPRGTPI+A G+G+VEKA W+ GYG QT
Sbjct: 484 NPVPNGIFRSPFGMRRHPILGYTRMHTGVDWAAPRGTPIIAAGNGVVEKAGWSNGYGNQT 543

Query: 548 LIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVD 607
           LI H NGYV+SY+HQ+AIA+ I  G  V+QGQ+IG++G+TGLSTGPHLHYELIVNG KVD
Sbjct: 544 LIRHANGYVTSYSHQNAIARGITPGARVRQGQVIGYVGSTGLSTGPHLHYELIVNGTKVD 603

Query: 608 STKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
           + ++R+P+ + LKG   + F  E+ RI++LLN+ EN  K    S+
Sbjct: 604 ALRIRLPDNKALKGKEFEAFKQERDRIDTLLNSDENGTK--LASN 646


>gi|254717933|ref|ZP_05179744.1| peptidase M23B [Brucella sp. 83/13]
 gi|265982875|ref|ZP_06095610.1| peptidase M23B [Brucella sp. 83/13]
 gi|306839070|ref|ZP_07471889.1| peptidase M23B [Brucella sp. NF 2653]
 gi|264661467|gb|EEZ31728.1| peptidase M23B [Brucella sp. 83/13]
 gi|306405848|gb|EFM62108.1| peptidase M23B [Brucella sp. NF 2653]
          Length = 651

 Score =  582 bits (1499), Expect = e-164,   Method: Composition-based stats.
 Identities = 239/645 (37%), Positives = 363/645 (56%), Gaps = 13/645 (2%)

Query: 14  FSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIAI 73
              GD PP+      +       +VS RWL+ TF  G+TS ++IG +L  AL+G +++A 
Sbjct: 9   LDPGDEPPLSVGGRRRPPDRR--EVSARWLAGTFLTGVTSCMLIGIALFAALNGREQLAT 66

Query: 74  PAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKIP 133
           P ++  +             ++     +S  ++ K  ++   ++ T+ +   +++I+  P
Sbjct: 67  PPEILARNEMPGI--TEDDTATKGGRLISTVSQQKTRDRRRFDLSTMQRVGEREVIRTKP 124

Query: 134 FAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVTTQKINFPT 193
           F + RM  A  +P  + +P F+ + IFSEG                   EV+ + ++FP 
Sbjct: 125 FEFVRMALAVDHPTNRKYPPFNAMTIFSEGPAAPQPSDAGQIYGAKVESEVSLRVVDFPI 184

Query: 194 DITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLD-QRHDHPITYSKKI 252
                        +E++  + +   LL +   Q  +L+Y DP           ++    +
Sbjct: 185 STATFDASSDLTVDEVEKVVRDTGGLLTDGDVQVASLHYVDPARFGGNDSPFALSPPLGV 244

Query: 253 KIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEV 312
           KI +EN +I            F+++LIP +    I  A+  AGY+  D++ +A+AL   +
Sbjct: 245 KITQENVSIAPRSDDEQVNEGFSEELIPFRQTKDIAQALEDAGYTGEDASNMAEALAKLM 304

Query: 313 RVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINH 372
              +L +  +LR+G    D    IVR SIY++  HL+T+ALND  +YV   EP +  +  
Sbjct: 305 NSPRLKQGSVLRVGTESHDGNDRIVRASIYNRTTHLVTVALNDRQQYVPSDEPEETPLLQ 364

Query: 373 QMDY-----MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFL 427
                           P++YDGI  A    GM   + + +++ LAS V+LQ  L P+D +
Sbjct: 365 TAFDGNAAPAAIRGNLPSVYDGISHAALAYGMTETMREQLVKMLASDVDLQARLSPSDAI 424

Query: 428 ETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLR 487
           + FFS+     +  +DS+LLY+ A FG T  +FYR+  P   SV+Y+NE+GKS++ FLLR
Sbjct: 425 DAFFSLPDDPEKPENDSQLLYVAATFGGTTRKFYRYQAPDG-SVDYYNEDGKSAKQFLLR 483

Query: 488 TPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQT 547
            PVP G   S FGMR HPILGY+RMHTGVDWAAPRGTPI+A G+G+VEKA W+ GYG QT
Sbjct: 484 NPVPNGIFRSPFGMRRHPILGYTRMHTGVDWAAPRGTPIIAAGNGVVEKAGWSNGYGNQT 543

Query: 548 LIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVD 607
           LI H NGYV+SY+HQ+AIA+ I  G  V+QGQ+IG++G+TGLSTGPHLHYELIVNG KVD
Sbjct: 544 LIRHANGYVTSYSHQNAIARGITPGARVRQGQVIGYVGSTGLSTGPHLHYELIVNGTKVD 603

Query: 608 STKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
           + ++R+P+ + LKG   + F  E+ RI++LLN+ EN  K    S+
Sbjct: 604 ALRIRLPDNKALKGKEFEAFKQERDRIDTLLNSDENGTK--LASN 646


>gi|148559209|ref|YP_001259692.1| M24/M37 family peptidase [Brucella ovis ATCC 25840]
 gi|148370466|gb|ABQ60445.1| peptidase, M23/M37 family [Brucella ovis ATCC 25840]
          Length = 651

 Score =  581 bits (1498), Expect = e-163,   Method: Composition-based stats.
 Identities = 240/645 (37%), Positives = 363/645 (56%), Gaps = 13/645 (2%)

Query: 14  FSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIAI 73
              GD PP+      +       +VS RWL+ TF  G+TS ++IG +L  ALDG +++A 
Sbjct: 9   LDPGDEPPLSVGGRRRPPDRR--EVSARWLAGTFLTGVTSCMLIGIALFAALDGREQLAT 66

Query: 74  PAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKIP 133
           P ++  +             ++     +S  ++ K  ++   ++ T+ +   +++I+  P
Sbjct: 67  PPEILARNEMPGI--TEDDTATKGGRLISTVSQQKTRDRRRFDLSTMQRVGEREVIRTKP 124

Query: 134 FAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVTTQKINFPT 193
           F + RM  A  +P  + +P F+ + IFSEG                   EV+ + ++FP 
Sbjct: 125 FEFVRMALAVDHPTNRKYPPFNAMTIFSEGPAAPQPSDAGQIYGAKVESEVSLRMVDFPI 184

Query: 194 DITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLD-QRHDHPITYSKKI 252
                        +E++  + +   LL +   Q  +L+Y DP           ++    +
Sbjct: 185 STATFDASSDLTVDEVEKVVRDTGGLLTDGDIQVASLHYVDPARFGGNDSPFALSPPLGV 244

Query: 253 KIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEV 312
           KI +EN +I            F+++LIP +    I  A+  AGY+  D++ +A+AL   +
Sbjct: 245 KITQENVSIAPRSDDEQVNEGFSEELIPFRQTADIAQALEDAGYTGEDASNMAEALAKLM 304

Query: 313 RVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINH 372
              +L +  +LR+G    D    IVR SIY++  HL+T+ALND  +YV   EP +  +  
Sbjct: 305 NSPRLKQGSVLRVGTESHDGIDRIVRASIYNRTTHLVTVALNDRQQYVPSDEPEETPLLQ 364

Query: 373 QMDY-----MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFL 427
                           P++YDGI  A    GM   + + +++ LAS V+LQ  L P+D +
Sbjct: 365 TAFDGNAAPAAIRGNLPSVYDGISHAALAYGMTETMREQLVKMLASDVDLQARLSPSDAI 424

Query: 428 ETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLR 487
           + FFS+     +  +DS+LLY+ A FG T  +FYR+  P   SV+Y+NE+GKS++ FLLR
Sbjct: 425 DAFFSLPDDPEKPENDSQLLYVAATFGGTTRKFYRYQVPDG-SVDYYNEDGKSAKQFLLR 483

Query: 488 TPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQT 547
            PVP G   S FGMR HPILGY+RMHTGVDWAAPRGTPI+A G+G+VEKA W+ GYG QT
Sbjct: 484 NPVPNGIFRSPFGMRRHPILGYTRMHTGVDWAAPRGTPIIAAGNGVVEKAGWSNGYGNQT 543

Query: 548 LIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVD 607
           LI H NGYV+SY+HQ+AIA+ I  G  V+QGQ+IG++G+TGLSTGPHLHYELIVNG KVD
Sbjct: 544 LIRHANGYVTSYSHQNAIARGITPGARVRQGQVIGYVGSTGLSTGPHLHYELIVNGTKVD 603

Query: 608 STKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
           + ++R+P+ + LKG   + F  E+ RI++LLN+ EN  K    S+
Sbjct: 604 ALRIRLPDNKALKGKEFEAFKQERDRIDTLLNSDENGTK--LASN 646


>gi|225628067|ref|ZP_03786102.1| lysostaphin [Brucella ceti str. Cudo]
 gi|254707603|ref|ZP_05169431.1| peptidase M23B [Brucella pinnipedialis M163/99/10]
 gi|254708859|ref|ZP_05170670.1| peptidase M23B [Brucella pinnipedialis B2/94]
 gi|254713718|ref|ZP_05175529.1| peptidase M23B [Brucella ceti M644/93/1]
 gi|254715933|ref|ZP_05177744.1| peptidase M23B [Brucella ceti M13/05/1]
 gi|256030386|ref|ZP_05444000.1| peptidase M23B [Brucella pinnipedialis M292/94/1]
 gi|256158369|ref|ZP_05456267.1| peptidase M23B [Brucella ceti M490/95/1]
 gi|256253787|ref|ZP_05459323.1| peptidase M23B [Brucella ceti B1/94]
 gi|260169295|ref|ZP_05756106.1| peptidase M23B [Brucella sp. F5/99]
 gi|261217695|ref|ZP_05931976.1| peptidase M23B [Brucella ceti M13/05/1]
 gi|261220920|ref|ZP_05935201.1| peptidase M23B [Brucella ceti B1/94]
 gi|261315091|ref|ZP_05954288.1| peptidase M23B [Brucella pinnipedialis M163/99/10]
 gi|261316352|ref|ZP_05955549.1| peptidase M23B [Brucella pinnipedialis B2/94]
 gi|261321458|ref|ZP_05960655.1| peptidase M23B [Brucella ceti M644/93/1]
 gi|261758807|ref|ZP_06002516.1| peptidase M23/M37 [Brucella sp. F5/99]
 gi|265987424|ref|ZP_06099981.1| peptidase M23B [Brucella pinnipedialis M292/94/1]
 gi|265996880|ref|ZP_06109437.1| peptidase M23B [Brucella ceti M490/95/1]
 gi|225616892|gb|EEH13939.1| lysostaphin [Brucella ceti str. Cudo]
 gi|260919504|gb|EEX86157.1| peptidase M23B [Brucella ceti B1/94]
 gi|260922784|gb|EEX89352.1| peptidase M23B [Brucella ceti M13/05/1]
 gi|261294148|gb|EEX97644.1| peptidase M23B [Brucella ceti M644/93/1]
 gi|261295575|gb|EEX99071.1| peptidase M23B [Brucella pinnipedialis B2/94]
 gi|261304117|gb|EEY07614.1| peptidase M23B [Brucella pinnipedialis M163/99/10]
 gi|261738791|gb|EEY26787.1| peptidase M23/M37 [Brucella sp. F5/99]
 gi|262551348|gb|EEZ07338.1| peptidase M23B [Brucella ceti M490/95/1]
 gi|264659621|gb|EEZ29882.1| peptidase M23B [Brucella pinnipedialis M292/94/1]
          Length = 651

 Score =  581 bits (1498), Expect = e-163,   Method: Composition-based stats.
 Identities = 240/645 (37%), Positives = 363/645 (56%), Gaps = 13/645 (2%)

Query: 14  FSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIAI 73
              GD PP+      +       +VS RWL+ TF  G+TS ++IG +L  ALDG +++A 
Sbjct: 9   LDSGDEPPLSVGGRRRPPDRR--EVSARWLAGTFLTGVTSCMLIGIALFAALDGREQLAT 66

Query: 74  PAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKIP 133
           P ++  +             ++     +S  ++ K  ++   ++ T+ +   +++I+  P
Sbjct: 67  PPEILARNEMPGI--TEDDTATKGGRLISTVSQQKTRDRRRFDLSTMQRVGEREVIRTKP 124

Query: 134 FAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVTTQKINFPT 193
           F + RM  A  +P  + +P F+ + IFSEG                   EV+ + ++FP 
Sbjct: 125 FEFVRMALAVDHPTNRKYPPFNAMTIFSEGPAAPQPSDAGQIYGAKVESEVSLRMVDFPI 184

Query: 194 DITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLD-QRHDHPITYSKKI 252
                        +E++  + +   LL +   Q  +L+Y DP           ++    +
Sbjct: 185 STATFDASSDLTVDEVEKVVRDTGGLLTDGDVQVASLHYVDPARFGGNDSPFALSPPLGV 244

Query: 253 KIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEV 312
           KI +EN +I            F+++LIP +    I  A+  AGY+  D++ +A+AL   +
Sbjct: 245 KITQENVSIAPRSDDEQVNEGFSEELIPFRQTADIAQALEDAGYTGEDASNMAEALAKLM 304

Query: 313 RVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINH 372
              +L +  +LR+G    D    IVR SIY++  HL+T+ALND  +YV   EP +  +  
Sbjct: 305 NSPRLKQGSVLRVGTESHDGIDRIVRASIYNRTTHLVTVALNDRQQYVPSDEPEETPLLQ 364

Query: 373 QMDY-----MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFL 427
                           P++YDGI  A    GM   + + +++ LAS V+LQ  L P+D +
Sbjct: 365 TAFDGNAAPAAIRGNLPSVYDGISHAALAYGMTETMREQLVKMLASDVDLQARLSPSDAI 424

Query: 428 ETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLR 487
           + FFS+     +  +DS+LLY+ A FG T  +FYR+  P   SV+Y+NE+GKS++ FLLR
Sbjct: 425 DAFFSLPDDPEKPENDSQLLYVAATFGGTTRKFYRYQAPDG-SVDYYNEDGKSAKQFLLR 483

Query: 488 TPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQT 547
            PVP G   S FGMR HPILGY+RMHTGVDWAAPRGTPI+A G+G+VEKA W+ GYG QT
Sbjct: 484 NPVPNGIFRSPFGMRRHPILGYTRMHTGVDWAAPRGTPIIAAGNGVVEKAGWSNGYGNQT 543

Query: 548 LIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVD 607
           LI H NGYV+SY+HQ+AIA+ I  G  V+QGQ+IG++G+TGLSTGPHLHYELIVNG KVD
Sbjct: 544 LIRHANGYVTSYSHQNAIARGITPGARVRQGQVIGYVGSTGLSTGPHLHYELIVNGTKVD 603

Query: 608 STKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
           + ++R+P+ + LKG   + F  E+ RI++LLN+ EN  K    S+
Sbjct: 604 ALRIRLPDNKALKGKEFEAFKQERDRIDTLLNSDENGTK--LASN 646


>gi|256370262|ref|YP_003107773.1| peptidase, M23/M37 family [Brucella microti CCM 4915]
 gi|256000425|gb|ACU48824.1| peptidase, M23/M37 family [Brucella microti CCM 4915]
          Length = 651

 Score =  581 bits (1497), Expect = e-163,   Method: Composition-based stats.
 Identities = 239/645 (37%), Positives = 363/645 (56%), Gaps = 13/645 (2%)

Query: 14  FSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIAI 73
              GD PP+      +       +VS RWL+ TF  G+TS ++IG +L  ALDG +++A 
Sbjct: 9   LDPGDEPPLSVGGRRRPPDRR--EVSARWLAGTFLTGVTSCMLIGIALFAALDGREQLAT 66

Query: 74  PAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKIP 133
           P ++  +             ++     +S  ++ K  ++   ++ T+ +   +++I+  P
Sbjct: 67  PPEILARNEMPGI--TEDDTATKGGRLISTVSQQKTRDRRRFDLSTMQRVGEREVIRTKP 124

Query: 134 FAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVTTQKINFPT 193
           F + RM  A  +P  + +P F+ + IFSEG                   EV+ + ++FP 
Sbjct: 125 FEFVRMALAVDHPTNRKYPPFNAMTIFSEGPAAPQPSDAGQIYGAKVESEVSLRMVDFPI 184

Query: 194 DITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLD-QRHDHPITYSKKI 252
                        +E++  + +   LL +   Q  +L+Y DP           ++    +
Sbjct: 185 STATFDASSDLTVDEVEKVVRDTGGLLTDGDVQVASLHYVDPARFGGNDSPFALSPPLGV 244

Query: 253 KIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEV 312
           KI +EN +I            F+++LIP +    I  A+  AGY+  D++ +A+AL   +
Sbjct: 245 KITQENVSIAPRSDDEQVNEGFSEELIPFRQTADIAQALEDAGYTGEDASNMAEALAKLM 304

Query: 313 RVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINH 372
              +L +  +LR+G    D    IVR SIY++  HL+T+ALND  +YV   EP +  +  
Sbjct: 305 NSPRLKQGSVLRVGTESHDGIDRIVRASIYNRTTHLVTVALNDRQQYVPSDEPEETPLLQ 364

Query: 373 QMDY-----MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFL 427
                           P++YDGI  A    GM   + + +++ LAS V+LQ  L P+D +
Sbjct: 365 TAFDGNAAPAAIRGNLPSVYDGISHAALAYGMTETMREQLVKMLASDVDLQARLSPSDAI 424

Query: 428 ETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLR 487
           + FFS+     +  +DS+LLY+ A FG T  +FYR+  P   SV+Y+NE+GKS++ FLLR
Sbjct: 425 DAFFSLPDDPEKPENDSQLLYVAATFGGTTRKFYRYQAPDG-SVDYYNEDGKSAKQFLLR 483

Query: 488 TPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQT 547
            PVP G   S FGMR HPILGY++MHTGVDWAAPRGTPI+A G+G+VEKA W+ GYG QT
Sbjct: 484 NPVPNGIFRSPFGMRRHPILGYTQMHTGVDWAAPRGTPIIAAGNGVVEKAGWSNGYGNQT 543

Query: 548 LIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVD 607
           LI H NGYV+SY+HQ+AIA+ I  G  V+QGQ+IG++G+TGLSTGPHLHYELIVNG KVD
Sbjct: 544 LIRHANGYVTSYSHQNAIARGITPGARVRQGQVIGYVGSTGLSTGPHLHYELIVNGTKVD 603

Query: 608 STKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
           + ++R+P+ + LKG   + F  E+ RI++LLN+ EN  K    S+
Sbjct: 604 ALRIRLPDNKALKGKEFEAFKQERDRIDTLLNSDENGTK--LASN 646


>gi|110635322|ref|YP_675530.1| peptidase M23B [Mesorhizobium sp. BNC1]
 gi|110286306|gb|ABG64365.1| peptidase M23B [Chelativorans sp. BNC1]
          Length = 645

 Score =  581 bits (1497), Expect = e-163,   Method: Composition-based stats.
 Identities = 244/650 (37%), Positives = 370/650 (56%), Gaps = 17/650 (2%)

Query: 6   ISNKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTAL 65
           + +K       GD PP++ +        +RR++S RWL+ T   G+TS V++G +L  AL
Sbjct: 1   MDDKAGAKPPLGDEPPLIADGR--SGPPDRREISGRWLAGTVLTGLTSTVLMGVALSAAL 58

Query: 66  DGHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHN 125
           DG +++A P +++             + ++     +  +  ++  ++  +EV T++K+ +
Sbjct: 59  DGREQLATPPEIALLPK-----APDGEEAAKTSRLIPARLLARQDDRRRMEVSTILKEGD 113

Query: 126 KDIIKKIPFAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVD-SFEV 184
           +++++ +PF + RM  A  +   KD+P FDPL +F+E    +++ M    I+      EV
Sbjct: 114 REVVRTLPFVHVRMNLAAGHRTHKDYPPFDPLTVFAEDGAAATASM--GVIYGAKVESEV 171

Query: 185 TTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDH 244
             + + FP        +     EE++  + N   +L +   Q   L+Y DPQ        
Sbjct: 172 RLRTLPFPFGQNVFDENSDLSAEEVEQVVRNTGAILTDGDVQVAALHYVDPQRFGDTLAT 231

Query: 245 PITYSKKIKII-EENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAK 303
                   +I+ EEN +I S  +       FA+D+I   H+  IF+A   AGY   D+  
Sbjct: 232 QALAQFSARIVQEENVSIASRDLPEGPSIGFAEDIIVFSHDEEIFEAFKDAGYDGADARG 291

Query: 304 IAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGV 363
           +A A+   +    L    IL +G+  + +   IVR SIY  ++H++TIAL+D ++YV   
Sbjct: 292 MALAIGKLLNAQALKAGTILCLGIEAEGETRRIVRTSIYEGKQHVVTIALDDRDQYVPAN 351

Query: 364 EP-----VKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQ 418
           EP     +   ++ +        + P  YDGI+ A    G+ S + + ++R LA+ V+ Q
Sbjct: 352 EPEHGPELLAALDTEPQQAPVRADLPRAYDGIYNAAYSYGLTSQMTQKLIRLLAADVDFQ 411

Query: 419 EHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENG 478
             L  TD LE FFS  + +  ASD+SE+LY+ A FGE    +YRF  P   SV+YF+  G
Sbjct: 412 SRLTTTDKLEVFFSQPNEDGSASDNSEILYVSASFGEKHRAYYRFELPDG-SVDYFDREG 470

Query: 479 KSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKAN 538
           +S+RPFLLR PVP GR TSGFGMR HPILGYSR+HTGVDWAAPRGTPI++ GDG+VE A 
Sbjct: 471 RSARPFLLRVPVPNGRFTSGFGMRRHPILGYSRLHTGVDWAAPRGTPIISSGDGVVESAG 530

Query: 539 WAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYE 598
           W+ GYG+QT+I H NGY +SYNHQ AIAK I  G  V+QGQ+IG++G TG +TG HLHYE
Sbjct: 531 WSSGYGRQTVIRHANGYETSYNHQSAIAKGIVPGAKVRQGQVIGYVGATGQATGNHLHYE 590

Query: 599 LIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPL 648
           L+VNG KVD  +VR+P+ + L+G+ L+ F  E+ RI  LL        P+
Sbjct: 591 LMVNGRKVDPMRVRLPDSKVLEGETLEVFMRERDRIEDLLEENFTSPTPV 640


>gi|299132194|ref|ZP_07025389.1| Peptidase M23 [Afipia sp. 1NLS2]
 gi|298592331|gb|EFI52531.1| Peptidase M23 [Afipia sp. 1NLS2]
          Length = 756

 Score =  581 bits (1496), Expect = e-163,   Method: Composition-based stats.
 Identities = 173/649 (26%), Positives = 290/649 (44%), Gaps = 15/649 (2%)

Query: 10  RDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQ 69
           R      G  PP+  +      + +RR VS++W S T   G+    +IGG++  +LDG  
Sbjct: 81  RSAPIDLGHEPPLSVDGTEAAVI-DRRSVSVQWFSGTILTGLCGAALIGGAVFASLDGET 139

Query: 70  KIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDII 129
             A   +   +T+   A   + K +  +++   P        + +I+V  + K  N++++
Sbjct: 140 TFAKVPE-RVETALRGAFGGADKNAVARKSDRLPPPSEAAAARQVIKVSMVAKVGNREVV 198

Query: 130 KKIPFAYARMTFATPYPK-VKDHPKFDPLKIFSEGK--IESSSQMLMDTIHNVDSFEVTT 186
           +  PF                  P FD  ++ ++       S              EV+ 
Sbjct: 199 RVRPFVRIAGNLTLSSTDLASKVPPFDAQRMLTDVGRTASDSDDSRNPGAAAEPDAEVSF 258

Query: 187 QKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSF-TLYYADPQTLDQRHDHP 245
              +  + +   ++  T   EE+ N + N      N   +                    
Sbjct: 259 VMRDLGSVLPHAKIAATVPAEEVLNQVRNASNWRGNSGVRYAYNGSSGLKMAYASEGSID 318

Query: 246 ITYSKKIKIIEENRTITSPQVL-IDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKI 304
                + +++ EN T+ +          + A+ +  ++   T+   +   G S  D+  I
Sbjct: 319 PYRGFEARLVPENVTLLAKTRAQATGGSDAAERVRVVKKGETVESILRDEGASASDAHAI 378

Query: 305 AKALKNEVRVDQLTKDEILRIGVVQKDD--KFTIVRFSIYHKQKHLLTIALNDNNEYVLG 362
           A  L    R   L +   LRI +           VR  + ++       AL+D  +YV  
Sbjct: 379 ASQLGARGRDGGLREGLKLRILMAPAGPNLPLQPVRVIVANETAIEAVAALSDLGKYVAV 438

Query: 363 ------VEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVN 416
                             D          +Y  I+     + +   ++  ++R  +  V+
Sbjct: 439 DVQSFNASTETASNASDEDDEDDDGTGVRLYQSIYETALRDKVPQQVIDDMVRIYSYDVD 498

Query: 417 LQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNE 476
            Q  ++  D  E FF+       A +  E+LY     G    ++YRF  P DG V+Y+++
Sbjct: 499 FQRKVQAGDSFEVFFAGEDETPAAGEKPEILYAALTTGGETKKYYRFQTPDDGGVDYYDD 558

Query: 477 NGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEK 536
            GKS++ FL+R PV    M SGFG R HPILG+++MHTGVDWA   GTPI A G+G++EK
Sbjct: 559 TGKSAKKFLVRKPVNNAIMRSGFGGRRHPILGFTKMHTGVDWATAYGTPIFASGNGVIEK 618

Query: 537 ANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLH 596
           A W GGYGK   I H NGY ++Y H  A AK ++ G  V+QGQ+IG++G+TG+STG H+H
Sbjct: 619 AEWEGGYGKYIRIKHPNGYETAYGHMSAFAKGMEPGKRVRQGQVIGFVGSTGMSTGAHVH 678

Query: 597 YELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPK 645
           YE++VNG  VD  +V++P   +L+G +L  F  E+ RI++++ +   PK
Sbjct: 679 YEILVNGRFVDPMRVKLPRGRSLEGGMLTAFESERDRIDAMMASRSAPK 727


>gi|254694502|ref|ZP_05156330.1| peptidase M23B [Brucella abortus bv. 3 str. Tulya]
 gi|261214818|ref|ZP_05929099.1| peptidase M23B [Brucella abortus bv. 3 str. Tulya]
 gi|260916425|gb|EEX83286.1| peptidase M23B [Brucella abortus bv. 3 str. Tulya]
          Length = 651

 Score =  581 bits (1496), Expect = e-163,   Method: Composition-based stats.
 Identities = 240/645 (37%), Positives = 363/645 (56%), Gaps = 13/645 (2%)

Query: 14  FSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIAI 73
              GD PP+      +       +VS RWL+ TF  G+TS ++IG +L  ALDG +++A 
Sbjct: 9   LDPGDEPPLSVGGRRRPPDRR--EVSARWLAGTFLTGVTSCMLIGIALFAALDGREQLAT 66

Query: 74  PAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKIP 133
           P ++  +             ++     +S  ++ K  ++   ++ T+ +   +++I+  P
Sbjct: 67  PPEILARNEMPGI--TEDDTATKGGRLISTVSQQKTRDRRRFDLSTMQRVGEREVIRTKP 124

Query: 134 FAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVTTQKINFPT 193
           F + RM  A  +P  + +P F+ + IFSEG                   EV+ + ++FP 
Sbjct: 125 FEFVRMALAVDHPTNRKYPPFNAMTIFSEGPAAPQPSDAGQIYGAKVESEVSLRMVDFPI 184

Query: 194 DITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLD-QRHDHPITYSKKI 252
                        +E++  + +   LL +   Q  +L+Y DP           ++    +
Sbjct: 185 STATFDASSDLTVDEVEKVVRDTGGLLTDGDVQVASLHYVDPARFGGNDSPFALSPPLGV 244

Query: 253 KIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEV 312
           KI +EN +I            F+++LIP +    I  A+  AGY+  D++ +A+AL   +
Sbjct: 245 KITQENVSIAPRSDDEQVNEGFSEELIPFRQTADIAQALEDAGYTGEDASNMAEALAKLM 304

Query: 313 RVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINH 372
              +L +  +LR+G    D    IVR SIY++  HL+T+ALND  +YV   EP +  +  
Sbjct: 305 NSPRLKQGSVLRVGTESHDGIDRIVRASIYNRTTHLVTVALNDRQQYVPSDEPEETPLLQ 364

Query: 373 QMDY-----MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFL 427
                           P++YDGI  A    GM   + + +++ LAS V+LQ  L P+D +
Sbjct: 365 TAFDGNAAPAAIRGNLPSVYDGISHAALAYGMTETMREQLVKMLASDVDLQARLSPSDAI 424

Query: 428 ETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLR 487
           + FFS+     +  +DS+LLY+ A FG T  +FYR+  P   SV+Y+NE+GKS++ FLLR
Sbjct: 425 DAFFSLPDDPEKPENDSQLLYVAATFGGTTRKFYRYQAPDG-SVDYYNEDGKSAKQFLLR 483

Query: 488 TPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQT 547
            PVP G   S FGMR HPILGY+RMHTGVDWAAPRGTPI+A G+G+VEKA W+ GYG QT
Sbjct: 484 NPVPNGIFRSPFGMRRHPILGYTRMHTGVDWAAPRGTPIIAAGNGVVEKAGWSNGYGNQT 543

Query: 548 LIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVD 607
           LI H NGYV+SY+HQ+AIA+ I  G  V+QGQ+IG++G+TGLSTGPHLHYELIVNG KVD
Sbjct: 544 LIRHANGYVTSYSHQNAIARAITPGARVRQGQVIGYVGSTGLSTGPHLHYELIVNGTKVD 603

Query: 608 STKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
           + ++R+P+ + LKG   + F  E+ RI++LLN+ EN  K    S+
Sbjct: 604 ALRIRLPDNKALKGKEFEAFKQERDRIDTLLNSDENGTK--LASN 646


>gi|294851104|ref|ZP_06791777.1| M23/M37 family Peptidase [Brucella sp. NVSL 07-0026]
 gi|294819693|gb|EFG36692.1| M23/M37 family Peptidase [Brucella sp. NVSL 07-0026]
          Length = 651

 Score =  579 bits (1493), Expect = e-163,   Method: Composition-based stats.
 Identities = 239/645 (37%), Positives = 362/645 (56%), Gaps = 13/645 (2%)

Query: 14  FSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIAI 73
              GD PP+      +       +VS RWL+ TF  G+TS ++IG +L  ALDG +++A 
Sbjct: 9   LDPGDEPPLSVGGRRRPPDRR--EVSARWLAGTFLTGVTSCMLIGIALFAALDGREQLAT 66

Query: 74  PAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKIP 133
           P ++  +             ++     +S  ++ K  ++   ++ T+ +   +++I+  P
Sbjct: 67  PPEILARNEMPGI--TEDDTATKGGRLISTVSQQKTRDRRRFDLSTMQRVGEREVIRTKP 124

Query: 134 FAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVTTQKINFPT 193
           F + RM  A  +P  + +P F+ + IFSEG                   EV+ + ++FP 
Sbjct: 125 FEFVRMALAVDHPTNRKYPPFNAMTIFSEGPAAPQPSDAGQIYGAKVESEVSLRMVDFPI 184

Query: 194 DITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLD-QRHDHPITYSKKI 252
                        +E++  + +   LL +   Q  +L+Y DP           ++    +
Sbjct: 185 STATFDASSDLTVDEVEKVVRDTGGLLTDGDVQVASLHYVDPARFGGNDSPFALSPPLGV 244

Query: 253 KIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEV 312
           KI +EN +I            F+++LIP +    I  A+  AGY+  D++ +A+AL   +
Sbjct: 245 KITQENVSIAPRSDDEQVNEGFSEELIPFRQTADIAQALEDAGYTGEDASNMAEALAKLM 304

Query: 313 RVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINH 372
              +L +  +LR+G    D    IVR SIY++  HL+T+ALND  +YV   EP +  +  
Sbjct: 305 NSPRLKQGSVLRVGTESHDGIDRIVRASIYNRTTHLVTVALNDRQQYVPSDEPEETPLLQ 364

Query: 373 QMDY-----MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFL 427
                           P++YDGI  A    GM   + + +++ LAS V+LQ  L P+D +
Sbjct: 365 TAFDGNAAPAAIRGNLPSVYDGISHAALAYGMTETMREQLVKMLASDVDLQARLSPSDAI 424

Query: 428 ETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLR 487
           + FFS+     +  +DS+LLY+ A FG T  +FYR+  P   SV+Y+NE+GKS++ FLLR
Sbjct: 425 DAFFSLPDDPEKPENDSQLLYVAATFGGTTRKFYRYQAPDG-SVDYYNEDGKSAKQFLLR 483

Query: 488 TPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQT 547
            PVP G   S FGMR HPILGY+RMHTGVDWAAPRGTPI+A G+G+VEKA W+ GYG QT
Sbjct: 484 NPVPNGIFRSPFGMRRHPILGYTRMHTGVDWAAPRGTPIIAAGNGVVEKAGWSNGYGNQT 543

Query: 548 LIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVD 607
           LI H N YV+SY+HQ+AIA+ I  G  V+QGQ+IG++G+TGLSTGPHLHYELIVNG KVD
Sbjct: 544 LIRHANAYVTSYSHQNAIARGITPGARVRQGQVIGYVGSTGLSTGPHLHYELIVNGTKVD 603

Query: 608 STKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
           + ++R+P+ + LKG   + F  E+ RI++LLN+ EN  K    S+
Sbjct: 604 ALRIRLPDNKALKGKEFEAFKQERDRIDTLLNSDENGTK--LASN 646


>gi|163759873|ref|ZP_02166957.1| hypothetical protein HPDFL43_16621 [Hoeflea phototrophica DFL-43]
 gi|162282831|gb|EDQ33118.1| hypothetical protein HPDFL43_16621 [Hoeflea phototrophica DFL-43]
          Length = 649

 Score =  578 bits (1489), Expect = e-162,   Method: Composition-based stats.
 Identities = 256/644 (39%), Positives = 403/644 (62%), Gaps = 16/644 (2%)

Query: 6   ISNKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTAL 65
           + N   +    GD PP+L          ++R++SLRWLS TF  GITS +++G +L  AL
Sbjct: 1   MPNDEFLARQMGDQPPLLAAGRK---PPDKREISLRWLSGTFMTGITSSLLMGVALFGAL 57

Query: 66  DGHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHN 125
           +G +++AIPA+    T  E+    + +  S     +     +K  ++ I+EV T+++D +
Sbjct: 58  EGREQLAIPAEALASTDFESPGTAAVEKGSR---LIQSVVTAKPADREIMEVSTMVRDGD 114

Query: 126 KDIIKKIPFAYARMTFATPYPK--VKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVD-SF 182
           +D++++ PFA+ ++  A  +P    K +P+FDPLKIFS G+ E ++ +    I+  +   
Sbjct: 115 RDVVRRRPFAHVKIALAANHPAAANKSYPRFDPLKIFSAGEAEVATSVRTGVIYGAEVDS 174

Query: 183 EVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRH 242
           E++ +  +FP +        +   +E +  +     +L +   Q  +L Y DP+      
Sbjct: 175 EISLRTFDFPLETPGRPYAASMSIDEAEETVRTNGSVLTDGSVQLASLNYVDPRRFGSNP 234

Query: 243 -DHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDS 301
            D  ++ S   ++I EN ++ +   L  +  E+ DD+IP++   ++ D +  AGY+    
Sbjct: 235 LDVDLSASLNARVITENVSVAAYSALPGQRTEYIDDIIPVREAASLEDILTDAGYTENHY 294

Query: 302 AKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVL 361
            +   AL  ++++D++    ++R+GV Q  ++  +VR S+Y    H +T+AL+D + +V+
Sbjct: 295 GEAIAALGKQIKIDEIRDMSVVRMGVEQTGERARVVRISLYRNASHQITVALSDRSGFVI 354

Query: 362 GVEPVKMDIN-----HQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVN 416
           G EP +              + T+ + PNIYDGI+RA    GM++++V  I+R LAS+V+
Sbjct: 355 GNEPPETPAIRSAFDESAPPVATNRDLPNIYDGIYRAGLAYGMSADMVAQIIRMLASNVD 414

Query: 417 LQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNE 476
            Q  LKP D LE FFSV      ASD+SELL+++A+FG  + R YRF +P D S++Y+++
Sbjct: 415 FQTKLKPADSLEAFFSVTDETGTASDESELLFVNAKFGGNQIRLYRFQHPEDNSIDYYDQ 474

Query: 477 NGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEK 536
           +G+S+R FLLR PVP G+  SGFGMR HPIL YSRMHTGVDW+APRGTPI+A G+G+VE+
Sbjct: 475 DGRSARQFLLRNPVPNGKFRSGFGMRRHPILKYSRMHTGVDWSAPRGTPIIASGNGVVEE 534

Query: 537 ANW-AGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHL 595
           A W  GGYG+QT+I H NGYVSSY+HQ++IAK +K G  V+QGQ+IG +G+TGLSTGPHL
Sbjct: 535 AGWDKGGYGRQTIIRHANGYVSSYSHQNSIAKGVKPGARVRQGQVIGTVGSTGLSTGPHL 594

Query: 596 HYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLN 639
           HYELIVNG KVD  ++R+P+ ++L+GD L  F  E+ RIN+LL+
Sbjct: 595 HYELIVNGTKVDPLRIRLPDGKSLEGDALAMFVRERDRINALLD 638


>gi|82700636|ref|YP_415210.1| peptidase M23/M37 [Brucella melitensis biovar Abortus 2308]
 gi|189024935|ref|YP_001935703.1| peptidase M23/M37 [Brucella abortus S19]
 gi|237816229|ref|ZP_04595222.1| peptidase M23/M37 [Brucella abortus str. 2308 A]
 gi|260545986|ref|ZP_05821726.1| peptidase M23/M37 [Brucella abortus NCTC 8038]
 gi|82616737|emb|CAJ11822.1| Peptidase M23/M37 [Brucella melitensis biovar Abortus 2308]
 gi|189020507|gb|ACD73229.1| Peptidase M23/M37 [Brucella abortus S19]
 gi|237788296|gb|EEP62511.1| peptidase M23/M37 [Brucella abortus str. 2308 A]
 gi|260096093|gb|EEW79969.1| peptidase M23/M37 [Brucella abortus NCTC 8038]
          Length = 651

 Score =  578 bits (1489), Expect = e-162,   Method: Composition-based stats.
 Identities = 239/645 (37%), Positives = 362/645 (56%), Gaps = 13/645 (2%)

Query: 14  FSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIAI 73
              GD  P+      +       +VS RWL+ TF  G+TS ++IG +L  ALDG +++A 
Sbjct: 9   LDPGDETPLSVGGRRRPPDRR--EVSARWLAGTFLTGVTSCMLIGIALFAALDGREQLAT 66

Query: 74  PAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKIP 133
           P ++  +             ++     +S  ++ K  ++   ++ T+ +   +++I+  P
Sbjct: 67  PPEILARNEMPGI--TEDDTATKGGRLISTVSQQKTRDRRRFDLSTMQRVGEREVIRTKP 124

Query: 134 FAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVTTQKINFPT 193
           F + RM  A  +P  + +P F+ + IFSEG                   EV+ + ++FP 
Sbjct: 125 FEFVRMALAVDHPTNRKYPPFNAMTIFSEGPAAPQPSDAGQIYGAKVESEVSLRMVDFPI 184

Query: 194 DITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLD-QRHDHPITYSKKI 252
                        +E++  + +   LL +   Q  +L+Y DP           ++    +
Sbjct: 185 STATFDASSDLTVDEVEKVVRDTGGLLTDGDVQVASLHYVDPARFGGNDSPFALSPPLGV 244

Query: 253 KIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEV 312
           KI +EN +I            F+++LIP +    I  A+  AGY+  D++ +A+AL   +
Sbjct: 245 KITQENVSIAPRSDDEQVNEGFSEELIPFRQTADIAQALEDAGYTGEDASNMAEALAKLM 304

Query: 313 RVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINH 372
              +L +  +LR+G    D    IVR SIY++  HL+T+ALND  +YV   EP +  +  
Sbjct: 305 NSPRLKQGGVLRVGTESHDGIDRIVRASIYNRTTHLVTVALNDRQQYVPSDEPEETPLLQ 364

Query: 373 QMDY-----MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFL 427
                           P++YDGI  A    GM   + + +++ LAS V+LQ  L P+D +
Sbjct: 365 TAFDGNAAPAAIRGNLPSVYDGISHAALAYGMTETMREQLVKMLASDVDLQARLSPSDAI 424

Query: 428 ETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLR 487
           + FFS+     +  +DS+LLY+ A FG T  +FYR+  P   SV+Y+NE+GKS++ FLLR
Sbjct: 425 DAFFSLPDDPEKPENDSQLLYVAATFGGTTRKFYRYQAPDG-SVDYYNEDGKSAKQFLLR 483

Query: 488 TPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQT 547
            PVP G   S FGMR HPILGY+RMHTGVDWAAPRGTPI+A G+G+VEKA W+ GYG QT
Sbjct: 484 NPVPNGIFRSPFGMRRHPILGYTRMHTGVDWAAPRGTPIIAAGNGVVEKAGWSNGYGNQT 543

Query: 548 LIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVD 607
           LI H NGYV+SY+HQ+AIA+ I  G  V+QGQ+IG++G+TGLSTGPHLHYELIVNG KVD
Sbjct: 544 LIRHANGYVTSYSHQNAIARGITPGARVRQGQVIGYVGSTGLSTGPHLHYELIVNGTKVD 603

Query: 608 STKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
           + ++R+P+ + LKG   + F  E+ RI++LLN+ EN  K    S+
Sbjct: 604 ALRIRLPDNKALKGKEFEAFKQERDRIDTLLNSDENGTK--LASN 646


>gi|118588507|ref|ZP_01545916.1| peptidase, M23/M37 family protein [Stappia aggregata IAM 12614]
 gi|118439213|gb|EAV45845.1| peptidase, M23/M37 family protein [Stappia aggregata IAM 12614]
          Length = 642

 Score =  571 bits (1471), Expect = e-160,   Method: Composition-based stats.
 Identities = 195/648 (30%), Positives = 326/648 (50%), Gaps = 28/648 (4%)

Query: 16  FGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIAIPA 75
            G+ PP+ G  + +  + +RR+VSLRW + T   G+TS V++GG+L+ ALDG   +    
Sbjct: 1   MGEEPPLRG-YEGRSGMSDRRQVSLRWFAGTVLTGVTSLVLMGGALMAALDGQYSVEAAP 59

Query: 76  KLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKIPFA 135
                 +  N  +LS+      +     +T +++  K +I+V  + ++ ++D I+  P  
Sbjct: 60  S---SDAFMNGFSLSSGG---TKGDRVLRTAAEYSSKHVIDVNVVTREGDRDHIRVQPHT 113

Query: 136 YARMTFATPY--PKVKDHPKFDPLKIFSEGK--------IESSSQMLMDTIHNVD-SFEV 184
           +   T AT       +  P F+PL +F++           E+ + +  D+I+      EV
Sbjct: 114 FVSATLATRKDPELAERIPPFNPLNMFADNNDDDGGTNIAETGTPLPADSIYGAKLESEV 173

Query: 185 TTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLD-QRHD 243
           +     FP+    I LD T  + E++ A+      L     +       DP   D     
Sbjct: 174 SISLAPFPSSSADIDLDRTPSETEVELAVRETARTLSIDAVEMAAKSLVDPGRFDFNLAL 233

Query: 244 HPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAK 303
            P      ++I  EN +  S Q    +     + ++P+  +  + D M+    +  ++  
Sbjct: 234 QPDLERYAVRITPENVSFVSKQDEEIRFAGMDESIVPVTKDQDLVDVMMDYDATEYEAVA 293

Query: 304 IAKALKNEVRVDQLTKDEILRIGVVQKDDKF---TIVRFSIYHKQKHLLTIALNDNNEYV 360
           I+ A  N   +  LT+ + LRI      D        R S+Y   +H  T+A +D+  Y+
Sbjct: 294 ISAAFSNLFGITDLTEGQRLRIAYAPSPDDLERMRPERVSLYENTEHRATVARSDSGAYI 353

Query: 361 LGVEPVKM--DINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQ 418
              EP     D   + D +     +P IYD +++      M   ++  ++R  +  V+  
Sbjct: 354 EAKEPSTFLADAFEEADRVSYGGPTPAIYDSLYQTALEQDMPEEIINDLVRMFSFDVDFN 413

Query: 419 EHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENG 478
             ++P D LE FF+    N       ++LY     G T   FYRF  P DG  ++++E G
Sbjct: 414 ARVQPGDALELFFTDGDDNT----PPKILYAALNTGNTTREFYRFRTPDDGVTDFYDETG 469

Query: 479 KSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKAN 538
           +S++ FL+R P+  G+  SGFGMR HPI GY++MH GVDW+A RGTPI+A G+G + KA 
Sbjct: 470 QSAKKFLIRKPLNGGKFRSGFGMRRHPIHGYTKMHRGVDWSASRGTPIMAAGNGTIVKAG 529

Query: 539 WAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYE 598
           W+ GYG++  + H NGY ++YNH       I+ G  V QGQIIG++G+TGLSTGPHLHYE
Sbjct: 530 WSSGYGRRIELQHTNGYTTTYNHMSGFGSGIREGVKVSQGQIIGYVGSTGLSTGPHLHYE 589

Query: 599 LIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKK 646
           ++VNG  +D  ++++P+   L G++   F  E+ R+++LL+    P +
Sbjct: 590 VLVNGRYMDPMRIKLPKGRTLDGEMRTVFEAERYRVDTLLDRVRKPSR 637


>gi|209883929|ref|YP_002287786.1| peptidase M23B [Oligotropha carboxidovorans OM5]
 gi|209872125|gb|ACI91921.1| peptidase M23B [Oligotropha carboxidovorans OM5]
          Length = 680

 Score =  569 bits (1467), Expect = e-160,   Method: Composition-based stats.
 Identities = 173/658 (26%), Positives = 296/658 (44%), Gaps = 21/658 (3%)

Query: 13  LFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIA 72
           +   G  PP+  +      + +RR VS++W S T   G+    +IGG++  +LDG    A
Sbjct: 1   MIDLGHEPPLSVDGTEAAVI-DRRSVSVQWFSGTILTGLCGAALIGGAVFASLDGETTFA 59

Query: 73  IPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKI 132
              +   +T+   A   + K +  +++   P        + +I+V  + K  N+++++  
Sbjct: 60  KVPE-RMETALRGAFGGADKNAIARKSDRLPPASDTAAARQVIKVSMVSKFGNREVVRVR 118

Query: 133 PFAYARMTFATPYPK-VKDHPKFDPLKIFSEGKIESSSQMLMDTIHNV---DSFEVTTQK 188
           PF       +    +     P F+  ++ ++    SS++               EV+   
Sbjct: 119 PFVRIAGNLSLSSGELASKVPPFNAQRLLTDTSSSSSAESDSANNPGAAAEPDAEVSFVM 178

Query: 189 INFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSF-TLYYADPQTLDQRHDHPIT 247
            +    +   ++  T   EE+   + N      N   +                      
Sbjct: 179 RDLGGVLPHAKIAATVPAEEVLIQVRNASNWRGNSGVRYAYNGSSGLKMAYASEGGIDPY 238

Query: 248 YSKKIKIIEENRTITSPQVLIDKIPEFADDLIPI-QHNTTIFDAMVHAGYSNGDSAKIAK 306
              + +++ EN T+ +           A + + + +   TI   +   G    D+  IA 
Sbjct: 239 RGFEARLVPENVTLLAKTRDQATGGATAPERVRVAKKGETIESILREEGAPPSDARAIAT 298

Query: 307 ALKNEVRVDQLTKDEILRIGVVQ--KDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLG-- 362
            L    R   L +   LRI +           VR  + ++       AL+D  +YV    
Sbjct: 299 QLGQRGRDGGLREGMKLRILMAPAAPGLPLQPVRVIVANETAIEAVAALSDLGKYVAVDV 358

Query: 363 -----VEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNL 417
                      + N   D          +Y  I+     + +  +++  ++R  +  V+ 
Sbjct: 359 QSFNASAGTAANANDDDDDEEDDGTGIRLYQSIYETAMRDKVPQSVIDDMIRIYSYDVDF 418

Query: 418 QEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNEN 477
           Q+ ++  D  E FF+        ++  E+LY     G    ++YRF  P D  V+Y+++ 
Sbjct: 419 QKRVQAGDSFEVFFAGEDEAPSPTEKPEVLYAALTTGGETKKYYRFQTPDDAVVDYYDDT 478

Query: 478 GKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKA 537
           GKS++ FL+R PV    M SGFG R HPILGY++MHTGVDWA   GTPI A G+G++EKA
Sbjct: 479 GKSAKKFLVRKPVNNAIMRSGFGGRRHPILGYTKMHTGVDWATAYGTPIFASGNGVIEKA 538

Query: 538 NWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHY 597
            W GGYGK   I H NGY ++Y H  A AK I+ G  V+QGQ+IG++G+TG+STG H+HY
Sbjct: 539 EWEGGYGKYIRIRHPNGYQTAYGHMSAYAKGIEPGKRVRQGQVIGFVGSTGMSTGAHVHY 598

Query: 598 ELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENP----KKPLFTS 651
           E++VNG  VD  +V++P   +L+G LL  F  E+ RI++++ +   P     +P+   
Sbjct: 599 EILVNGRFVDPMRVKLPRGRSLEGGLLTAFESERDRIDAMMASRSAPKVAQTQPVAAP 656


>gi|163868948|ref|YP_001610177.1| membrane protein related to metalloendopeptidases [Bartonella
           tribocorum CIP 105476]
 gi|161018624|emb|CAK02182.1| membrane protein related to metalloendopeptidases [Bartonella
           tribocorum CIP 105476]
          Length = 662

 Score =  569 bits (1466), Expect = e-160,   Method: Composition-based stats.
 Identities = 227/667 (34%), Positives = 339/667 (50%), Gaps = 33/667 (4%)

Query: 6   ISNKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTAL 65
           + +        G  P ++     K     RR+VS+RWL+ T   GITS +++G +L TAL
Sbjct: 1   MWDNEQQKNDPGQDPALVV----KRLRPARRQVSVRWLTGTVLTGITSCILMGIALFTAL 56

Query: 66  DGHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPK-TKSKHPEKIIIEVPTLIKDH 124
           D  Q++  P +     +   A N  A     +  R+SP   +     K   E+  L K  
Sbjct: 57  DEQQRLVTPPQWFTTENLSQAQNPEANGY--KGDRISPTHARQSFDSKREFELSILQKKG 114

Query: 125 NKDIIKKIPFAYARMTFATPYPKVKDHPKFDPLKIFSEGKIES--SSQMLMDTIHNVD-S 181
           ++ +I+   F + RM  A   P+   +PKFD L I +    +   + Q     I+     
Sbjct: 115 DEKVIQTQHFEWIRMALAEKRPQKYSYPKFDSLSIMASDSNKQNIAPQEDSGQIYGAKIE 174

Query: 182 FEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTL-DQ 240
            ++T +  +F  D        T  DEE +  +    F L         L   DP  L D 
Sbjct: 175 TKLTLRSYDFKIDQFDFDDSDTLTDEEAQQEVQKAGFTLEKSTELLSVLTLIDPLKLEDV 234

Query: 241 RHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGD 300
                 T S +++I++EN TI+     ID    + +D+IPI+   TI DA     Y+   
Sbjct: 235 SSPSQETESPEVRIVQENVTISPQSHRIDLTKNYVEDIIPIRKKQTIADAFKKTSYTKNQ 294

Query: 301 SAKIAKALKNEVRVDQLTKDEILRIGV-VQKDDKFTIVRFSIYHKQKHLLTIALNDNNEY 359
             ++ K L+     D L +  +LRIG+  Q  ++  +VR SIY    H+LTIALND  ++
Sbjct: 295 VEQVVKTLEKFNLSDTLKEGSLLRIGIVTQAGEEDHLVRASIYQGMYHVLTIALNDKGQF 354

Query: 360 VLGVEPVKMDINH------QMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLAS 413
           +   EP                    S + P  YD ++ A   + ++ +L   ++R LA+
Sbjct: 355 IESTEPKMSKALKTAFQNGIPHSYINSAQLPTAYDALYSALLSHNISQSLSHRLIRLLAT 414

Query: 414 SVNLQEHLKPTDFLETFFSVNHANNQAS--------------DDSELLYIHARFGETRTR 459
           +++++  + P D +E F+++  ++ +                 D E+ YI A FG    +
Sbjct: 415 NIDMKSPITPNDQIEIFYALPQSDKETKNGKKNLKVKESLKNADPEIRYISATFGNATYK 474

Query: 460 FYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWA 519
           +YR+      SV+Y++  GKSS+PFLLR P P G   S FG R HPILGY RMHTGVDW 
Sbjct: 475 YYRYQLKDG-SVDYYDSEGKSSKPFLLRKPTPNGVFGSPFGPRKHPILGYVRMHTGVDWV 533

Query: 520 APRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQ 579
           AP+G+PI+A+GDGIV K    GGYG  T I H NGYVSSY+HQ   A +IK G  V+QGQ
Sbjct: 534 APKGSPIIAIGDGIVTKVGVTGGYGNHTEIQHANGYVSSYSHQSRYAPDIKPGVKVRQGQ 593

Query: 580 IIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLN 639
           IIG++G+TG++TGPH H+E+IVNG+KVD  ++RIP  + L    LQ F  EK  I+SL+N
Sbjct: 594 IIGYVGSTGMATGPHCHFEIIVNGVKVDPMRIRIPNSKALTHQDLQTFLQEKNNIDSLIN 653

Query: 640 NGENPKK 646
           +   P  
Sbjct: 654 SPITPSN 660


>gi|49476047|ref|YP_034088.1| hypothetical protein BH13810 [Bartonella henselae str. Houston-1]
 gi|49238855|emb|CAF28146.1| hypothetical protein BH13810 [Bartonella henselae str. Houston-1]
          Length = 668

 Score =  568 bits (1463), Expect = e-159,   Method: Composition-based stats.
 Identities = 232/672 (34%), Positives = 348/672 (51%), Gaps = 38/672 (5%)

Query: 6   ISNKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTAL 65
           + + +      G  P ++     K FL + R+VS+RWL+ T   GITS +++G +L  AL
Sbjct: 1   MWDNKQQKNDPGLDPALVV----KRFLPDHRQVSIRWLTGTILTGITSCLLMGIALFAAL 56

Query: 66  DGHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPK-TKSKHPEKIIIEVPTLIKDH 124
           D  Q++  P +    T+     N        +  R++    +     K   E+  L K  
Sbjct: 57  DEQQRLVTPPQWFTPTNLPQTQNSDTNG--HKGDRIAQTHARQSFDSKRQFELSILQKKG 114

Query: 125 NKDIIKKIPFAYARMTFATPYPKVKDHPKFDPLKIFS-EGKIESSSQMLMDTIHNVD-SF 182
           ++ +I+   F + RM  A   P+   +PKFD L IF+ + K +++       I+      
Sbjct: 115 DQKVIQTQNFEWIRMALAEERPQKYSYPKFDALNIFATDSKNQTAPPQDTGEIYGAKVET 174

Query: 183 EVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTL-DQR 241
           ++T +  NF  D        T  ++E++  +    F L         L   DP  L D  
Sbjct: 175 KITLRNHNFILDQVNFDGADTLTEDEVQQELQKAGFTLEKNHELLSILTLVDPLKLEDLS 234

Query: 242 HDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDS 301
                T + +++II+EN T++S    ID    +A+D+IPI     I +A     Y+    
Sbjct: 235 SSSQFTDTPEVRIIQENVTVSSQNHRIDLTKNYAEDIIPIHKKQKIIEAFRETNYTKEQI 294

Query: 302 AKIAKALKNEVRVDQLTKDEILRIGV-VQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYV 360
            ++AK L      + L    +LRIG+  Q  ++  +VR SIY    H+LT+ALND  ++V
Sbjct: 295 EQVAKTLAFFNHSETLKAGSLLRIGIVTQAGEEDHLVRASIYQGMYHVLTVALNDEGQFV 354

Query: 361 LGVEPVKMDINH------QMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASS 414
              EP                    + + P +YD ++ A   + M+ +L + I+R LA++
Sbjct: 355 ESTEPQMSQALKTAFQNGIPHSYVNTTQLPTVYDALYNAILSHNMSQSLSQRIIRLLATN 414

Query: 415 VNLQEHLKPTDFLETFF-----------SVNHANNQAS---------DDSELLYIHARFG 454
           V+++  + PTD LE F+           +    N Q S          D E+ YI A FG
Sbjct: 415 VDMKSRITPTDQLEIFYAVPQQSEIEKNNKETLNGQKSQKAKEYPTNADPEIRYISATFG 474

Query: 455 ETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHT 514
               ++YR+ +    SV+Y++  GKSS+PFLLR P P G   S FG R HPILGY RMHT
Sbjct: 475 NATYKYYRYQSKDG-SVDYYDSEGKSSKPFLLRKPTPNGIFGSPFGPRKHPILGYVRMHT 533

Query: 515 GVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTA 574
           GVDW AP+G+PI+AVGDGIV K   +GGYG  T I H NGY+SSY+HQ   A +IK G  
Sbjct: 534 GVDWVAPKGSPIIAVGDGIVIKMGVSGGYGNHTEIQHPNGYISSYSHQSRYAPDIKPGVK 593

Query: 575 VKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRI 634
           V+QGQIIG++GTTG++TGPH H+E+IVNG+KVD  ++RIP+ + L    LQ F  EK  I
Sbjct: 594 VRQGQIIGYVGTTGMATGPHCHFEIIVNGVKVDPMRIRIPDSKTLTNQDLQAFLREKNNI 653

Query: 635 NSLLNNGENPKK 646
           +SLLN+   P +
Sbjct: 654 DSLLNSPMKPSE 665


>gi|49474605|ref|YP_032647.1| hypothetical protein BQ10930 [Bartonella quintana str. Toulouse]
 gi|49240109|emb|CAF26554.1| hypothetical protein BQ10930 [Bartonella quintana str. Toulouse]
          Length = 668

 Score =  566 bits (1458), Expect = e-159,   Method: Composition-based stats.
 Identities = 229/672 (34%), Positives = 349/672 (51%), Gaps = 38/672 (5%)

Query: 6   ISNKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTAL 65
           + +        G  P ++     K FL  RR+VS+RWL+ T   GITS +++G +L  AL
Sbjct: 1   MWDNEQQKNDPGLDPALVV----KRFLPARRQVSIRWLTGTVLTGITSCILMGIALFAAL 56

Query: 66  DGHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPK-TKSKHPEKIIIEVPTLIKDH 124
           D  Q++  P +   +++     N +A     +  R+SP   +     K   E+  L K  
Sbjct: 57  DEQQRLVTPPQWFTRSNLSETPNPNANG--QKGDRISPTHARKSFDSKREFELSILQKKG 114

Query: 125 NKDIIKKIPFAYARMTFATPYPKVKDHPKFDPLKIF-SEGKIESSSQMLMDTIHNVD-SF 182
           ++ +I+   F + RM  A   P    +PKFD L IF S+ + +  +      I+ V    
Sbjct: 115 DEKVIQTQHFKWIRMALAKERPHQYTYPKFDALSIFESDSQNQGGTPQTSGEIYGVKVET 174

Query: 183 EVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRH 242
           ++T +  NF  D        T  D   +  +    F L         L   DP  LD   
Sbjct: 175 KITLRNYNFIIDQVNFDGADTLTDNAAQQELQKAGFTLEKTSELLSILTLIDPLKLDDLS 234

Query: 243 D-HPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDS 301
                T + ++++++EN TI+     ID    +A+D+IPIQ    + DA     Y+    
Sbjct: 235 SSAQFTDAPEVRMVQENVTISPQNHRIDLTKNYAEDIIPIQKKQKLIDAFKKTNYTKEQI 294

Query: 302 AKIAKALKNEVRVDQLTKDEILRIGV-VQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYV 360
            +IAK L      D L +  +LRIG+  Q  ++  +VR SIY    H+LTIALND   +V
Sbjct: 295 EQIAKTLIFFYHSDTLKEGSLLRIGIVTQAGEEDHLVRASIYQGMYHILTIALNDEGRFV 354

Query: 361 LGVEPVKMDINH------QMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASS 414
              EP                    + + P +YD ++ A   + M++ L + I+R LA++
Sbjct: 355 KSAEPQMSQALKTAFQNGIPHSHVNTAQLPTVYDALYNAILSHNMSNALSQRIIRLLATN 414

Query: 415 VNLQEHLKPTDFLETFFSVNHA-----NNQASDDS---------------ELLYIHARFG 454
           ++++  + PTD LE F++V        +N+ + +                E+ YI A FG
Sbjct: 415 IDMKSQITPTDQLEIFYTVPQESETERDNKETQNGKKSPQAKKTPTNADPEIRYISATFG 474

Query: 455 ETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHT 514
               ++YR+ +    +++Y++  GKS++PFLLR P P G  +S FG R HPILGY RMHT
Sbjct: 475 NATYKYYRYQSKDG-TIDYYDSEGKSAKPFLLRNPTPNGIFSSPFGPRKHPILGYVRMHT 533

Query: 515 GVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTA 574
           GVDW AP+G+PI+A+GDG+V K   AGGYG  T I H NGYVSSY+HQ   A +IK G  
Sbjct: 534 GVDWVAPKGSPIIAIGDGVVIKMGVAGGYGNHTEIQHTNGYVSSYSHQSRYAPDIKPGVK 593

Query: 575 VKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRI 634
           V+QGQIIG++G+TG++TGPH H+E+IVNG+KVD  ++R+P  + L    LQ F  EK  I
Sbjct: 594 VRQGQIIGYVGSTGMATGPHCHFEIIVNGVKVDPMRIRLPNSKALTNQDLQTFLREKYNI 653

Query: 635 NSLLNNGENPKK 646
           +SL+N+   P +
Sbjct: 654 DSLINSPVTPSE 665


>gi|240851085|ref|YP_002972486.1| peptidase, M23/M37 family [Bartonella grahamii as4aup]
 gi|240268208|gb|ACS51796.1| peptidase, M23/M37 family [Bartonella grahamii as4aup]
          Length = 661

 Score =  561 bits (1446), Expect = e-157,   Method: Composition-based stats.
 Identities = 225/666 (33%), Positives = 346/666 (51%), Gaps = 32/666 (4%)

Query: 6   ISNKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTAL 65
           + +        G  P ++     K     RR+VS RWL+ T   GITS +++G +L TAL
Sbjct: 1   MWDNEQQKNDPGQDPALVV----KRLRPARRQVSARWLTGTVLTGITSCILMGIALFTAL 56

Query: 66  DGHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPK-TKSKHPEKIIIEVPTLIKDH 124
           D  Q++  P +   + +  +A +  A     +  R+SP   +     K   E+  L K  
Sbjct: 57  DEQQRLVTPPQWFTKENLSHAQDPEANGY--KGDRISPTHARQSFDSKRQFELSILQKKG 114

Query: 125 NKDIIKKIPFAYARMTFATPYPKVKDHPKFDPLKIFS-EGKIESSSQMLMDTIHNVD-SF 182
           ++ +I+   F + RM  A   P+   +PKFD L I + +   +S+       I+      
Sbjct: 115 DEQVIQTQHFEWIRMALAEKRPQKYSYPKFDSLSILASDSNNQSAKPQDSGQIYGAKVET 174

Query: 183 EVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTL-DQR 241
           ++T +  +F  +      + T  DEE +  +    F L         L   DP  L D  
Sbjct: 175 KITLRSYDFKVNQFDFDDNDTLTDEEAQQEVQKAGFTLEKSTELLSVLTLIDPLKLEDAS 234

Query: 242 HDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDS 301
            D   T S +++I++EN T++     ID    + +D+IPI+    I DA     Y+    
Sbjct: 235 TDSQGTESPEVRIVQENVTVSPQSHRIDLTKNYVEDIIPIRKKQKIADAFKKTSYTKKQI 294

Query: 302 AKIAKALKNEVRVDQLTKDEILRIGV-VQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYV 360
            ++ K L+     D L +  +LRIG+  Q  ++  +VR SIY    H+LTIALND  +++
Sbjct: 295 EQVVKTLEKMSLSDTLKEGSLLRIGIVTQAGEEDHLVRASIYQGMYHVLTIALNDKGQFI 354

Query: 361 LGVEPVKMDINH------QMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASS 414
              EP                    S + P  YD ++ A   + ++ +L   ++R LA++
Sbjct: 355 ESTEPKMSKALKTAFQNGIPHSYINSAQLPTAYDALYNALLSHNISQSLSHRLIRLLATN 414

Query: 415 VNLQEHLKPTDFLETFFSVNHANNQASD--------------DSELLYIHARFGETRTRF 460
           ++++  + P D +E F++V  ++ +  +              D E+ YI A FG T  ++
Sbjct: 415 IDMKSPITPNDQIEIFYAVPQSDKENQNGKKNLKAKEASKNTDPEIRYISATFGNTTYKY 474

Query: 461 YRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAA 520
           YR+      SV+Y++  G+SS+PFLLR P P G   S FG R HPILGY RMHTGVDW A
Sbjct: 475 YRYQLKDG-SVDYYDSEGRSSKPFLLRKPTPNGIFGSPFGPRKHPILGYVRMHTGVDWVA 533

Query: 521 PRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQI 580
           P+G+PI+AVGDGIV +    GGYG  T I H NGYVSSY+HQ   A +IK G  V+QGQI
Sbjct: 534 PKGSPIIAVGDGIVTRVGVTGGYGNHTEIQHANGYVSSYSHQSRYAPDIKPGVKVRQGQI 593

Query: 581 IGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNN 640
           IG++GTTG++TGPH H+E+IVNG+KVD  ++RIP+ + L    LQ F  EK  I++L+N+
Sbjct: 594 IGYVGTTGMATGPHCHFEIIVNGVKVDPMRIRIPDSKALTNQDLQTFLQEKNNIDALINS 653

Query: 641 GENPKK 646
              P +
Sbjct: 654 PITPSE 659


>gi|298293276|ref|YP_003695215.1| peptidase M23 [Starkeya novella DSM 506]
 gi|296929787|gb|ADH90596.1| Peptidase M23 [Starkeya novella DSM 506]
          Length = 646

 Score =  549 bits (1414), Expect = e-154,   Method: Composition-based stats.
 Identities = 171/640 (26%), Positives = 300/640 (46%), Gaps = 16/640 (2%)

Query: 6   ISNKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTAL 65
           +       F  GD PP+  + DA+  + NRR++S+RWL  T   GI    ++GG++  AL
Sbjct: 1   MRRSHVAAFDLGDEPPLGVDGDAEEPI-NRRRISIRWLMATLLTGICGAALMGGAVYAAL 59

Query: 66  DGHQKIA-IPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDH 124
           DG  + A  P  +        A        + +  R+S  ++S    K  + + T  K+ 
Sbjct: 60  DGEYRFAQTPETVRSALRGALAAGERPSNVARKGDRMSILSES-FSAKQTLRLSTTAKEG 118

Query: 125 NKDIIKKIPFAYARMTFATPYPKVK-DHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFE 183
           ++++I+           A        D P+F+P K+ +E  ++  +    +      + E
Sbjct: 119 DREVIRVRAVTKVATNLAQSVTSASVDVPRFNPAKLIAESSVDEDADAQAE-----PTGE 173

Query: 184 VTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHD 243
           +T    +  +     +       E++   +           +     +      +     
Sbjct: 174 LTIVMRDLASLPPSTKFAAELPMEDVLMKVRETAEFSMPTADARAPAFAGIGGVMAYAPA 233

Query: 244 HPITYSKKIKIIEENRT-ITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSA 302
                        EN + I           ++++  +  +   TI   ++  G +   + 
Sbjct: 234 GAADPLNGALQQPENVSSIDKSAEDASGGNDWSERTVVAKSGDTIASILMDLGVAEVSAR 293

Query: 303 KIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLG 362
             + A  +      LT    L++ +         +R +++    +  T+AL+D  +++  
Sbjct: 294 AASTAFASRELQGALTPGLRLKVLLDNAGGGVVPLRVAVFGDSGNQGTVALSDIGKFLPV 353

Query: 363 VEPVKMDINHQMDYMRTSEESPNI--YDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEH 420
            EP  M +          E +  I  YD IW     + +   +++ ++R  +  V+ Q  
Sbjct: 354 QEPADMQVADVTPEDGDDEGNGRITLYDSIWETALRHEVPRPVIENMIRVYSFDVDFQRR 413

Query: 421 LKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKS 480
           ++  D  E  +  + A         +LY     G    R+YR+  P DG +++++++GKS
Sbjct: 414 VRAGDSFEVLYEPDEAGGA----GGVLYAGLTVGGEERRYYRYQTPDDGLIDFYDDDGKS 469

Query: 481 SRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWA 540
           ++ FL+R P+  G++ SGFGMR HPILGYSR+H+GVDWA   GTPI A G+G ++KA W 
Sbjct: 470 AKKFLVRKPISAGQLRSGFGMRRHPILGYSRLHSGVDWADRTGTPIYAAGNGTIKKAAWT 529

Query: 541 GGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELI 600
            GYG++  I H NGYV++Y+HQ   AK I+ G  V+QGQ+IG+IG+TGLSTG HLHYE++
Sbjct: 530 SGYGRRIEIQHANGYVTTYSHQSGFAKGIREGMRVRQGQLIGYIGSTGLSTGAHLHYEVL 589

Query: 601 VNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNN 640
           VNG  VD  ++R+P    L G +L  F  E++R++ LLN+
Sbjct: 590 VNGRFVDPMRIRLPRGRALDGRILAGFEDERERVDQLLNH 629


>gi|121601904|ref|YP_988588.1| M23 peptidase domain-containing protein [Bartonella bacilliformis
           KC583]
 gi|120614081|gb|ABM44682.1| M23 peptidase domain protein [Bartonella bacilliformis KC583]
          Length = 646

 Score =  547 bits (1409), Expect = e-153,   Method: Composition-based stats.
 Identities = 218/655 (33%), Positives = 341/655 (52%), Gaps = 30/655 (4%)

Query: 6   ISNKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTAL 65
           + + +      G  P ++ +          R+VS+RWL+ T   G+T+  ++G +L TAL
Sbjct: 1   MWDNQYQKNDPGQEPALVLSRSK----PEHRQVSIRWLTGTALTGVTACFLMGIALFTAL 56

Query: 66  DGHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSP-KTKSKHPEKIIIEVPTLIKDH 124
           DG Q++  PA+               + +  +  R++P + +     K   EV  L    
Sbjct: 57  DGQQRLVTPAQWFDLAYFP------DEKTPDKGDRIAPTRARQSFDSKRQFEVSILQHQG 110

Query: 125 NKDIIKKIPFAYARMTFATPYPKVKDHPKFDPLKIFSEG-KIESSSQMLMDTIHNVD-SF 182
           +K +++   F + RM  A        +PKFD L IF++  K ++        I+      
Sbjct: 111 DKKVVQTQNFEWIRMALAEERLHKYTYPKFDALSIFADDSKNQAIKLQTGGQIYGTKTQT 170

Query: 183 EVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQR- 241
           ++T +     T I +         +E++  I    F L         L + DP  LD   
Sbjct: 171 KMTLRSRPLNTYIEKFNQGDVLTADEVQQEIRKAGFDLEYNNEYFPILPFIDPLQLDDLF 230

Query: 242 HDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDS 301
                +   ++++ +EN TI+     I+    +A+D+IPI    TI +A+    Y+    
Sbjct: 231 SSLEFSELPEVRVFQENVTISPQNHRIEVAHNYAEDIIPIHKKQTILEALKDLKYTEEQI 290

Query: 302 AKIAKALKNEVRVDQLTKDEILRIGVVQK-DDKFTIVRFSIYHKQKHLLTIALNDNNEYV 360
             +A+ L      + L +  +LRIGVV    ++ TIVR SIY    H +TIAL+D N++V
Sbjct: 291 QLVAETLATFHNSNWLNEGNLLRIGVVTHLGEEDTIVRVSIYKGMSHKITIALDDYNQFV 350

Query: 361 LGVEPVKMDINHQMDYM------RTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASS 414
              EP                   ++ + P +YD I+ A   + +++ L + ++R LA+ 
Sbjct: 351 ESTEPEMSHALKTAFQKGIPHPYVSTAKLPTVYDAIYHAILSHNLSNTLSQHLVRLLATD 410

Query: 415 VNLQEHLKPTDFLETFF---SVNHANNQASD-----DSELLYIHARFGETRTRFYRFLNP 466
           ++++  + PTD LE F+     N  + Q +D     D E+ Y+ A FG    ++YR+   
Sbjct: 411 IDMKSRITPTDQLEIFYAVPEQNDTDGQNADAPMNPDPEIRYVSATFGNVTYKYYRYQAE 470

Query: 467 VDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPI 526
              +++Y+N  GKSS+PFLLR PVP G   S FG R HPILGY RMHTGVDW+AP+G+PI
Sbjct: 471 DG-TIDYYNFEGKSSKPFLLRKPVPNGAFVSPFGPRKHPILGYVRMHTGVDWSAPKGSPI 529

Query: 527 VAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGT 586
           +AVGDG+V++     GYG QT+I H NGYVSSY HQ A A  IK G  V+QGQIIG++G+
Sbjct: 530 IAVGDGVVKQMKGTRGYGNQTVIQHANGYVSSYAHQQAYAPGIKPGVKVRQGQIIGYVGS 589

Query: 587 TGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNG 641
           TGL+TGPH H+E+IVNG +VD  ++R+P+   L    LQ F  EK+ I+SL+ + 
Sbjct: 590 TGLATGPHCHFEIIVNGTQVDPMRIRLPDSRILTNQDLQAFLREKQNIDSLVASP 644


>gi|297171769|gb|ADI22760.1| membrane proteins related to metalloendopeptidases [uncultured
           Rhizobium sp. HF0500_29J11]
          Length = 642

 Score =  546 bits (1407), Expect = e-153,   Method: Composition-based stats.
 Identities = 224/647 (34%), Positives = 344/647 (53%), Gaps = 24/647 (3%)

Query: 16  FGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIAIPA 75
           FGD PP++ +   K    +RR+VS RWL+ T   G+TS  ++G +L  ALDGH+  A PA
Sbjct: 8   FGDEPPLISDRRRK---PDRRQVSARWLAGTLLTGLTSTALMGIALSAALDGHRGAARPA 64

Query: 76  KLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKIPFA 135
            L+   +    +N        +  R+          + ++E+ T+ ++ ++++I+ +PF 
Sbjct: 65  GLAAAFAPSEDLNE-------KGERVVATALPVARSRQVVELSTMTREGDREVIRTLPFG 117

Query: 136 YARMTFATPYPKVKDHPKFDPLKIFSE---GKIESSSQMLMDTIHNVD-SFEVTTQKINF 191
           Y  M     +    D+P FDPL IF++    + ES  +     ++      EV  +   F
Sbjct: 118 YVNMLLGARHQTSIDYPAFDPLNIFADPDADEPESGDEGQAAQLYGARVEAEVRLKVEPF 177

Query: 192 PTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHP-ITYSK 250
             D    +        E +  +      L     Q  +L   DP   +   D        
Sbjct: 178 DFDSDSYERVDDIGTSEAERLVRQVSPSLAYAPVQVASLNTVDPLRFNLTSDAAEYEPGS 237

Query: 251 KIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKN 310
             ++IEEN ++       D+ PEF +++IP++    I   +   GY    S K  +AL  
Sbjct: 238 AFRVIEENVSLAPSDTGSDR-PEFHEEVIPLREAAKIAAVLDANGYDESKSGKAVEALAA 296

Query: 311 EVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEP----- 365
            +  D L   + LR+GV    +  T+VR S Y   +HL T+A  ++  +     P     
Sbjct: 297 RLEADALKPGDALRVGVETIGEAATVVRLSAYRGTRHLGTVAETEDGPFEPAQAPEMGGS 356

Query: 366 VKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTD 425
           V    +          + P +YDG+++A    G+N  L + +++ LA+ V+LQ  L PTD
Sbjct: 357 VAAAFDSSESEAPLRAKMPTVYDGLYQAALAYGLNDRLCQQLVQMLATEVDLQSRLSPTD 416

Query: 426 FLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFL 485
            +  F+S+     +A+D+SE+L++  RFGET  RFYRF      S +YF+ +G+S++ FL
Sbjct: 417 RIAVFYSMEEGKEEATDESEMLFVDVRFGETSRRFYRFRPKDAESADYFDADGRSAKQFL 476

Query: 486 LRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYG 544
           LR PVP GR +S F     HP+LGY R H GVDWAAP GTPI+A GDG+V+KA W  GYG
Sbjct: 477 LRKPVPRGRFSSAFSTGRKHPVLGYVRPHWGVDWAAPGGTPILASGDGVVKKAGWVSGYG 536

Query: 545 KQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGI 604
           +QT++ H NGY +SY+HQ  IAK +K G+ V+QGQ+IG++G+TGLSTG HLHYEL VNG 
Sbjct: 537 RQTIVRHANGYETSYSHQSGIAKGVKVGSRVRQGQVIGYVGSTGLSTGNHLHYELAVNGQ 596

Query: 605 KVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTS 651
           KVD  ++++P    L+G+ L  F  E+ RI+ LL   E  + PL  +
Sbjct: 597 KVDPMRIKLPSGRVLEGEELATFQRERDRIDELL--RERVETPLLAA 641


>gi|297170630|gb|ADI21655.1| membrane proteins related to metalloendopeptidases [uncultured
           Rhizobium sp. HF0130_09F11]
 gi|297171580|gb|ADI22577.1| membrane proteins related to metalloendopeptidases [uncultured
           Rhizobium sp. HF0500_10F10]
          Length = 642

 Score =  546 bits (1406), Expect = e-153,   Method: Composition-based stats.
 Identities = 224/647 (34%), Positives = 344/647 (53%), Gaps = 24/647 (3%)

Query: 16  FGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIAIPA 75
           FGD PP++ +   K    +RR+VS RWL+ T   G+TS  ++G +L  ALDGH+  A PA
Sbjct: 8   FGDEPPLISDRRRK---PDRRQVSARWLAGTLLTGLTSTALMGIALSAALDGHRGAARPA 64

Query: 76  KLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKIPFA 135
            L+   +    +N        +  R+          + ++E+ T+ ++ ++++I+ +PF 
Sbjct: 65  GLAAAFAPSEDLNE-------KGERVVATALPVARSRQVVELSTMTREGDREVIRTLPFG 117

Query: 136 YARMTFATPYPKVKDHPKFDPLKIFSE---GKIESSSQMLMDTIHNVD-SFEVTTQKINF 191
           Y  M     +    D+P FDPL IF++    + ES  +     ++      EV  +   F
Sbjct: 118 YVNMLLGARHQTSIDYPAFDPLNIFADPDADEPESGDEGQAAQLYGARVEAEVRLKVEPF 177

Query: 192 PTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHP-ITYSK 250
             D    +        E +  +      L     Q  +L   DP   +   D        
Sbjct: 178 DFDPDSYERVDDIGTSEAERLVRQVSPSLAYAPVQVASLNTVDPLRFNLTSDAAEYEPGS 237

Query: 251 KIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKN 310
             ++IEEN ++       D+ PEF +++IP++    I   +   GY    S K  +AL  
Sbjct: 238 AFRVIEENVSLAPSDTGSDR-PEFHEEVIPLREAAKIAAVLDANGYDERKSGKAVEALAA 296

Query: 311 EVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEP----- 365
            +  D L   + LR+GV    +  T+VR S Y   +HL T+A  ++  +     P     
Sbjct: 297 RLEADALKPGDALRVGVETIGEAATVVRLSAYRGTRHLGTVAETEDGPFEPAQAPEMGGS 356

Query: 366 VKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTD 425
           V    +          + P +YDG+++A    G+N  L + +++ LA+ V+LQ  L PTD
Sbjct: 357 VAAAFDSSESEAPLRAKMPTVYDGLYQAALAYGLNDRLCQQLVQMLATEVDLQSRLSPTD 416

Query: 426 FLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFL 485
            +  F+S+     +A+D+SE+L++  RFGET  RFYRF      S +YF+ +G+S++ FL
Sbjct: 417 RIAVFYSMEEGKEEATDESEMLFVDVRFGETSRRFYRFRPKDAESADYFDADGRSAKQFL 476

Query: 486 LRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYG 544
           LR PVP GR +S F     HP+LGY R H GVDWAAP GTPI+A GDG+V+KA W  GYG
Sbjct: 477 LRKPVPRGRFSSAFSTGRKHPVLGYVRPHWGVDWAAPGGTPILASGDGVVKKAGWVSGYG 536

Query: 545 KQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGI 604
           +QT++ H NGY +SY+HQ  IAK +K G+ V+QGQ+IG++G+TGLSTG HLHYEL VNG 
Sbjct: 537 RQTIVRHANGYETSYSHQSGIAKGVKVGSRVRQGQVIGYVGSTGLSTGNHLHYELAVNGQ 596

Query: 605 KVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTS 651
           KVD  ++++P    L+G+ L  F  E+ RI+ LL   E  + PL  +
Sbjct: 597 KVDPMRIKLPSGRVLEGEELATFQRERDRIDELL--RERVETPLLAA 641


>gi|315122700|ref|YP_004063189.1| hypothetical protein CKC_04760 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496102|gb|ADR52701.1| hypothetical protein CKC_04760 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 660

 Score =  545 bits (1405), Expect = e-153,   Method: Composition-based stats.
 Identities = 452/642 (70%), Positives = 542/642 (84%), Gaps = 9/642 (1%)

Query: 1   MTLCTISNKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGS 60
           MTL +  NK++ILFSFG+ PPILG+N+ KIFL NRRKVSLRW+ TTFFAG+TSGV++GG+
Sbjct: 1   MTLYSTLNKKEILFSFGNNPPILGDNNEKIFL-NRRKVSLRWVYTTFFAGVTSGVLMGGA 59

Query: 61  LLTALDGHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPK-TKSKHPEKIIIEVPT 119
           LLTALDGHQK+AIPAKLS QT + N+ + +    SM++ARLS K TKSK+PEKIII+VPT
Sbjct: 60  LLTALDGHQKVAIPAKLSRQTLDLNSAHFNPNPFSMRKARLSTKNTKSKNPEKIIIDVPT 119

Query: 120 LIKDHNKDIIKKIPFAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNV 179
           LIK H+KDIIKKIPFAYARMTF TPY  ++D+PKFDPLKIFS G+IES+SQMLMDTI+N+
Sbjct: 120 LIKSHDKDIIKKIPFAYARMTFTTPYQNLRDYPKFDPLKIFSGGRIESTSQMLMDTINNI 179

Query: 180 D-------SFEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYY 232
           D         E+TT+K NFPTDIT I+ D   +D+ IK AI+NQ+F L+  KNQS+ LYY
Sbjct: 180 DTLYDTKSKLEITTKKFNFPTDITNIKKDIIEKDDTIKKAIINQYFPLNYDKNQSYNLYY 239

Query: 233 ADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMV 292
           AD Q L +   +    S  +K+IEENRTIT+PQ+  +  PEFADDLI IQHNTT+F AM+
Sbjct: 240 ADDQPLYKEQYNSTINSTTVKVIEENRTITTPQLSTNISPEFADDLIVIQHNTTVFKAMI 299

Query: 293 HAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIA 352
            AGYSN +S+KI KALK+++ VD+LTKDE +RIG++QK+ + TI+RFSIYHK++H+LTIA
Sbjct: 300 QAGYSNSESSKIVKALKDKIHVDKLTKDETIRIGMLQKEAESTIIRFSIYHKKEHILTIA 359

Query: 353 LNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLA 412
           LNDNNEYVLG EP K+DI+   D +RTSE  P+IYDGIWRATSFNGMN NLV+L++R LA
Sbjct: 360 LNDNNEYVLGAEPAKIDIDSYTDNIRTSESFPSIYDGIWRATSFNGMNKNLVQLVIRILA 419

Query: 413 SSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVE 472
           +++NLQEHLKPTDFLETFFSV+   NQ+++DSELLYIHARFGETRTRFYRF NP+DGSVE
Sbjct: 420 NNLNLQEHLKPTDFLETFFSVDPVKNQSTNDSELLYIHARFGETRTRFYRFQNPLDGSVE 479

Query: 473 YFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDG 532
           YFNENGKSSRPFLLRTPVPFGR+TSGFGMR HPILGY+RMHTGVDWAAPRGTPI+AV DG
Sbjct: 480 YFNENGKSSRPFLLRTPVPFGRITSGFGMRRHPILGYTRMHTGVDWAAPRGTPIIAVSDG 539

Query: 533 IVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTG 592
           IVEK+ WAGGYGKQT+I H NG+VSSYNHQDAI+KN+   T VKQGQIIGWIG TGL+TG
Sbjct: 540 IVEKSGWAGGYGKQTIIRHANGFVSSYNHQDAISKNVTEKTTVKQGQIIGWIGATGLATG 599

Query: 593 PHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRI 634
           PHLHYELIVNGIKV+  K+RIPE E LKG++LQRF ME K +
Sbjct: 600 PHLHYELIVNGIKVNPMKIRIPEGETLKGEMLQRFLMETKEL 641


>gi|90419848|ref|ZP_01227757.1| putative peptidase, M23 family [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335889|gb|EAS49637.1| putative peptidase, M23 family [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 661

 Score =  545 bits (1404), Expect = e-153,   Method: Composition-based stats.
 Identities = 221/647 (34%), Positives = 343/647 (53%), Gaps = 24/647 (3%)

Query: 16  FGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIAIPA 75
           FGD PP++ +   K    +RR+VS RWL+ T   G+TS  ++G +L  ALDGH+  A PA
Sbjct: 27  FGDEPPLISDRRRK---PDRRQVSARWLAGTLLTGLTSTALMGIALSAALDGHRGAARPA 83

Query: 76  KLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKIPFA 135
            L+   +    +N        +  R+          + ++E+ T+ ++ ++++I+ +PF 
Sbjct: 84  GLAAAFAPSEDLNE-------KGERVVATALPVARSRQVVELSTMTREGDREVIRTLPFG 136

Query: 136 YARMTFATPYPKVKDHPKFDPLKIFSE---GKIESSSQMLMDTIHNVD-SFEVTTQKINF 191
           Y  M     +    D+P FDPL IF++    + ES  +     ++      EV  +   F
Sbjct: 137 YVNMLLGARHQTSIDYPAFDPLNIFADPDADEPESGDEGQAAQLYGARVEAEVRLKVEPF 196

Query: 192 PTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHP-ITYSK 250
             D    +        E +  +      L     Q  +L   DP   +   D        
Sbjct: 197 DFDPDSYERVDDIGTSEAERLVRQVSPSLAYAPVQVASLNTVDPLRFNLTSDAAEYEPGS 256

Query: 251 KIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKN 310
             ++IEEN ++       D+ PEF +++IP++    +   +   GY    S K  +AL  
Sbjct: 257 AFRVIEENVSLAPSDTGNDR-PEFHEEVIPLREAAKMAAVLDANGYDESKSGKAVEALAA 315

Query: 311 EVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEP----- 365
            +  D L   + LR+GV    +  T+VR S Y   +HL T+A  ++  +     P     
Sbjct: 316 RLEADALKPGDALRVGVETIGEAATVVRLSAYRGTRHLGTVAETEDGPFEPAQAPEMGGS 375

Query: 366 VKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTD 425
           V    +          + P +YDG+++A    G+N  L + +++ LA+ V+LQ  L PTD
Sbjct: 376 VAAAFDSSESEAPLRAKMPTVYDGLYQAALAYGLNDRLCQQLVQMLATEVDLQSRLGPTD 435

Query: 426 FLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFL 485
            +  F+S+     +A+D+SE+L++  RFGET  RFYRF      + +YF+ +G+S++ FL
Sbjct: 436 RVAVFYSMEEGKEEATDESEMLFVDVRFGETSRRFYRFRPKDAENADYFDADGRSAKQFL 495

Query: 486 LRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYG 544
           LR PVP GR +S F     HP+LGY R H GVDWAAP GTPI A GDG+V+KA W  GYG
Sbjct: 496 LRKPVPRGRFSSAFSTGRKHPVLGYVRPHWGVDWAAPGGTPIFASGDGVVKKAGWVSGYG 555

Query: 545 KQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGI 604
           +QT++ H NGY +SY+HQ  IAK +K G+ V+QGQ+IG++G+TGLSTG HLHYE+ VNG 
Sbjct: 556 RQTIVRHANGYETSYSHQSGIAKGVKVGSRVRQGQVIGYVGSTGLSTGNHLHYEISVNGQ 615

Query: 605 KVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTS 651
           KVD  ++++P    L+G+ L  F  E+ RI+ LL   E  + PL  +
Sbjct: 616 KVDPMRIKLPSGRVLEGEELATFQRERDRIDELL--RERVETPLLAA 660


>gi|182677415|ref|YP_001831561.1| peptidase M23 [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182633298|gb|ACB94072.1| Peptidase M23 [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 695

 Score =  545 bits (1403), Expect = e-152,   Method: Composition-based stats.
 Identities = 179/679 (26%), Positives = 294/679 (43%), Gaps = 48/679 (7%)

Query: 7   SNKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALD 66
           +++R      G+ P I  + +      +RR+VSLRWL+ T   G++   +IG ++  A D
Sbjct: 19  TDRRGGAVELGNEPAIDTDGEQHDIF-DRRQVSLRWLAGTILTGLSGAGLIGAAIYAAFD 77

Query: 67  GHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNK 126
                A    L+     E A        + ++     K+      K     P  +K   K
Sbjct: 78  HQSHFAEAPMLAAPPHRETAQES---GINGRKGDRLVKSVDIVAAKQSFRAPMTLKIGEK 134

Query: 127 DIIKKIPFAYARMTFATPYPKVKD-HPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVT 185
           +++K   F     T         D  P F+PLK+ ++ +               D  EV+
Sbjct: 135 EVVKTHSFTRVETTLLQASAGYGDDIPPFNPLKLLADARNPVDVPQEPVQ----DDAEVS 190

Query: 186 TQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYY------------- 232
               +        Q       +E++  +  Q     N   +  TL               
Sbjct: 191 WALRDLVGQPVSTQ--AVLSGDEVQAQLAEQIKNPMNAGTKLLTLPPQMLLMKTSRANPL 248

Query: 233 -------------ADPQTLDQRHD---HPITYSKKIKIIEENRTITSPQVLIDKIPEFAD 276
                        A         D   +    S  ++++ EN T+ +      +  +  +
Sbjct: 249 GNGIGHNFGRSGAAAVLAYANPEDTGLNAPFSSIDVRMVPENVTVVARSSASPQSTQSGE 308

Query: 277 DLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGV---VQKDDK 333
            L+ ++H   + D + +AG S    A I +A         + +   L++          +
Sbjct: 309 KLVVLRHGEAVEDILRNAGLSKDRIAAIIQAFGARRGEAAVAEGRKLKLQFADFDGSGGE 368

Query: 334 FTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESP--NIYDGIW 391
             + R S+Y  +    TIA+ D   Y+  +   +  +  +       +++    +Y+ ++
Sbjct: 369 AILARLSVYADETLETTIAMTDQGRYMRVISRNEEPVARRRSEDTDDDDAGGMRLYESLY 428

Query: 392 RATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHA 451
                  +   +V  ++R  A+ V+ Q  +   D    F+      +      ELLY   
Sbjct: 429 ETALKQDIPRRIVDELVRIFANDVDFQRTVAAGDSFSAFYDEAEEGDHL---PELLYATV 485

Query: 452 RFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSR 511
                  R+YRF  P D  V++++ NG+S+R FL+R P+   +MTSGFG R+HPILGYSR
Sbjct: 486 TTRNETFRYYRFQTPDDNGVDFYDPNGRSTRKFLVRVPLAAEKMTSGFGTRFHPILGYSR 545

Query: 512 MHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKA 571
            HTGVDWAAP GTPI A G+G V KA W  GYG++  I H NGY+++YNH    AK +  
Sbjct: 546 PHTGVDWAAPIGTPIFAAGNGTVLKAGWDSGYGRRVEIQHANGYITTYNHMSGFAKGMSE 605

Query: 572 GTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEK 631
           G  V+QGQ+IG++G TGL+TGPHLHYE+IVNG  VD  +V++ +     G +L  F  E+
Sbjct: 606 GMRVRQGQVIGYLGQTGLATGPHLHYEVIVNGHFVDPLRVKLAQTREFDGPMLATFKRER 665

Query: 632 KRINSLLNNGENPKKPLFT 650
           +RI+ LL    N    +  
Sbjct: 666 ERIDGLLALAPNATSSIVA 684


>gi|328542102|ref|YP_004302211.1| peptidase, M23/M37 family protein [polymorphum gilvum SL003B-26A1]
 gi|326411852|gb|ADZ68915.1| Peptidase, M23/M37 family protein [Polymorphum gilvum SL003B-26A1]
          Length = 652

 Score =  544 bits (1402), Expect = e-152,   Method: Composition-based stats.
 Identities = 197/647 (30%), Positives = 321/647 (49%), Gaps = 15/647 (2%)

Query: 13  LFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIA 72
               G+ PP++   D +  L +RR+VS+RWL+ T   G+TS V++GG+L+ ALDG  ++A
Sbjct: 13  AVDLGEEPPLVV-YDERNVLPDRRRVSVRWLTGTILTGVTSIVLMGGALMAALDGQYRVA 71

Query: 73  IPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKI 132
                  +   ++A     + +S  +     +  ++   + +I V  + +  ++D IK  
Sbjct: 72  AATNPDPEAWMQDA----GRQASGSKGDRISRKAAQFANRQVIPVNVVTRVGDRDHIKAR 127

Query: 133 PFAYARMTFATPYPKV--KDHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVTTQKIN 190
           P+ +   + AT          P F+PL++FS+G++                 EV+    +
Sbjct: 128 PYVFVTSSLATRKSADIEGRIPPFNPLQMFSDGQVVPDRAASDAIYSARVDGEVSISMTD 187

Query: 191 FPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLD-QRHDHPITYS 249
           FP D   + +  T  + EI+  + +    L +           DP   D           
Sbjct: 188 FPVDSALVDIALTPGEAEIEREVRHAAQFLSDPSINMAARAIVDPGRFDFNLARLSDFSR 247

Query: 250 KKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALK 309
             ++I +EN +  S Q          + +IPI     + D ++    S  ++  I  A +
Sbjct: 248 LSVRITQENVSFVSKQDEETTAAGLDEKIIPISEEADLRDLLLDNDASEDEADAILAAFR 307

Query: 310 NEVRVDQLTKDEILRIGVVQKDDKF---TIVRFSIYHKQKHLLTIALNDNNEYVLGVEPV 366
               ++ L+  E +R+ +    D+       R S+Y    H  T+A  D   YV+   P 
Sbjct: 308 AGYGIESLSGGERVRLALAPSFDEAGRMRPERISLYADTVHKATVARADTGSYVVASAPA 367

Query: 367 KM--DINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPT 424
               D   + D +     +P +YD I++      +   L+  ++R  +  V+    ++P 
Sbjct: 368 SFLPDAFAEADRISYGGPTPALYDSIYQTALEQDVPEPLIGELVRAFSYDVDFNARVQPG 427

Query: 425 DFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPF 484
           D LE F+ +   + Q     E+LY     G  + RFYRF  P DG+V+Y++ENG+S++ F
Sbjct: 428 DSLEVFYGLEGEDAQTPA--EILYAALNTGSAQRRFYRFRTPDDGAVDYYDENGRSAKKF 485

Query: 485 LLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYG 544
           L+R P+  GR  SGFGMR HPI G+ +MHTGVDW+A  GTPI+A G G V +A W  GYG
Sbjct: 486 LMRKPLSGGRFRSGFGMRRHPIHGFQKMHTGVDWSATSGTPIMASGAGTVIQAKWVSGYG 545

Query: 545 KQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGI 604
           ++  + H NGYV++Y+H    A  I  G  V QGQ+IG++G+TGLSTGPHLHYE+ VN  
Sbjct: 546 RRVELRHANGYVTTYSHMTGFAPGIAEGVKVNQGQVIGYVGSTGLSTGPHLHYEVKVNDH 605

Query: 605 KVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTS 651
            VD  ++R+P    L+GD+L  F  E+ RI++LL+ G  P +     
Sbjct: 606 YVDPMRIRLPRGRVLEGDMLVAFERERDRIDALLDRGLKPSRLASAR 652


>gi|254500055|ref|ZP_05112208.1| M23 peptidase domain protein [Labrenzia alexandrii DFL-11]
 gi|222441522|gb|EEE48199.1| M23 peptidase domain protein [Labrenzia alexandrii DFL-11]
          Length = 667

 Score =  544 bits (1400), Expect = e-152,   Method: Composition-based stats.
 Identities = 197/655 (30%), Positives = 324/655 (49%), Gaps = 27/655 (4%)

Query: 8   NKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDG 67
           N +      G  PP+LG  +    + +RR VSLRW + +   G+TS  ++GG+L  A DG
Sbjct: 8   NPQSSKIELGQEPPLLG-YEGVYGMSDRRGVSLRWFAGSALTGVTSLFLMGGALFAAFDG 66

Query: 68  HQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKD 127
             ++    +    ++  N +++S    S  +     ++ +++  K +I+V  + ++ ++D
Sbjct: 67  QYEV---ERAKSSSALLNELSISNNGYS--KEDRFLRSATEYSSKQLIDVNIVSREGDRD 121

Query: 128 IIKKIPFAYARMTFATPY--PKVKDHPKFDPLKIFS--------EGKIESSSQMLMDTIH 177
            I+  P  +   T AT          P F  L IFS              ++ +L D+++
Sbjct: 122 NIRAQPHIFISATLATKKDPSLASQIPAFSTLNIFSRSAEKEATGATEGVATSLLADSLY 181

Query: 178 NVDSF-EVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQ 236
            V    +V+     FP+  T   LD T  + EI+  +                    DP 
Sbjct: 182 GVKLANDVSISLTPFPSSNTDFDLDKTLSESEIELKVRKFIRTRSVDATNMDYEAVIDPG 241

Query: 237 TLD-QRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAG 295
             D      P      ++I  EN +  S +    ++    + ++P+     +   +++  
Sbjct: 242 RFDFNLALQPDLERYAVRITPENVSFVSKRDDDIRLAGMDESIVPVAQGQNLTGTLLNQQ 301

Query: 296 YSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFT---IVRFSIYHKQKHLLTIA 352
               ++A I  A +    + +L   + LRI      D       VR S+Y   KH  T+A
Sbjct: 302 VPEVEAASITLAFQRLYGISKLEDGQRLRIAYAPSQDDPERKLPVRISLYSDTKHEATVA 361

Query: 353 LNDNNEYVLGVEPVKMDINHQMDYMRTSEESPN--IYDGIWRATSFNGMNSNLVKLIMRT 410
            +D  +Y+    P         D  R S   P   +YD +++      +  N+V  ++R 
Sbjct: 362 QSDGGDYIKARPPSTFPAAAFADADRVSHSGPTPALYDSLYQTALEQDIPKNVVNELVRM 421

Query: 411 LASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGS 470
           L+ S++ +  ++P   +E  +S +  N      S++ +     G+T   FYRF  P DG+
Sbjct: 422 LSFSIDFKASIRPGATIELLYSRDDRNFG----SKIHFAALSNGKTTLEFYRFRTPDDGA 477

Query: 471 VEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVG 530
            ++++  G+S++ FLLR P+  G+  SGFGMR HP+  YSRMH GVDW+APRGTPI+A G
Sbjct: 478 TDFYDAFGQSAKKFLLRKPIDGGKFRSGFGMRRHPVYKYSRMHKGVDWSAPRGTPIMAAG 537

Query: 531 DGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLS 590
           DG V KA W+ GYGK+T + H NGY ++YNHQ   AK IK G  VKQGQIIG++G+TGLS
Sbjct: 538 DGTVIKAGWSSGYGKRTELRHTNGYTTTYNHQTGFAKGIKEGVRVKQGQIIGYVGSTGLS 597

Query: 591 TGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPK 645
           TGPHLH+E++ NG  +D  + R+PE   L  ++ +RF  E+  I++LL +   P+
Sbjct: 598 TGPHLHFEMLANGQPLDPMRARLPEGRVLDREMRERFESERSAIDNLLRDARRPR 652


>gi|217979406|ref|YP_002363553.1| Peptidase M23 [Methylocella silvestris BL2]
 gi|217504782|gb|ACK52191.1| Peptidase M23 [Methylocella silvestris BL2]
          Length = 665

 Score =  541 bits (1393), Expect = e-151,   Method: Composition-based stats.
 Identities = 186/653 (28%), Positives = 303/653 (46%), Gaps = 36/653 (5%)

Query: 14  FSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIAI 73
              G  P I  +        +RR++S RWLS T   G++ G +IG ++  +L  H  I  
Sbjct: 25  VDLGHEPAIEADGKRHSSF-DRRRISFRWLSGTILTGVSGGALIGAAIYASLGNHAFIPE 83

Query: 74  PAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKIP 133
           P  L+        IN      +  +A    K       K     PT IK  +K+++K   
Sbjct: 84  PPSLAP----RKEIN-VDFGVNQHKADRLVKAVDIVAAKQSFRAPTTIKVGDKEVMKTHT 138

Query: 134 FAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVTTQKINFPT 193
           F     T  T      D P F+PLKI ++ +               D  EV+    +   
Sbjct: 139 FTRVETTLLTSSSGFADVPAFNPLKILADARNPIDVAPEPVQ----DDAEVSWTMRDVSV 194

Query: 194 DITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYAD----------PQTLDQRHD 243
           +        +  DEE++  +           ++   L              P  L   + 
Sbjct: 195 ENLA---ATSLSDEEVRAQVAEHVKNSATAGSRQIALPPQLLLMRTARANLPGMLAYANP 251

Query: 244 HP-----ITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSN 298
                     + +++++ EN T  +      K  +  + L+ ++H  T+ D +  AG S 
Sbjct: 252 AEQIKTTPFSAIEVRMVPENVTNVARAPQPAKPAQTEERLVVVRHGETLDDVLRAAGLSR 311

Query: 299 GDSAKIAKALKNEVRVDQLTKDEILRIGV---VQKDDKFTIVRFSIYHKQKHLLTIALND 355
             +A +  A K +       +   +++        ++K T+ R S+Y ++     +A+ND
Sbjct: 312 DKAALVIAAFKLKAGESAAPEGRRIKLLFADLEGAEEKTTLARLSVYQEESLESAVAIND 371

Query: 356 NNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSV 415
             +YV    P +       D     E+   +YD ++       +   ++  ++R  A+ V
Sbjct: 372 RGDYVRVTAPARPAKRQTDDS--EDEDGLRLYDSLYETALKQEIPRPIIDDLVRVFANDV 429

Query: 416 NLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFN 475
           + Q  +   D  E F+     +++    ++LLY          R+YR+  P DG V++++
Sbjct: 430 DFQRSVSGGDSFEAFY---DESDEGEARNQLLYATITARGETYRYYRYQTPDDGVVDFYD 486

Query: 476 ENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVE 535
           ++G+S+R FL+RTP+   + TSGFG R+HPILGY+R HTGVDWAAP GTPIVA G+G++ 
Sbjct: 487 QDGRSTRKFLVRTPILNAKFTSGFGSRFHPILGYTRPHTGVDWAAPIGTPIVAAGNGVIV 546

Query: 536 KANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHL 595
           KA W  GYG++  I H NGYV++YNH    A+    G  VKQGQ+IG++G TGL+TGPHL
Sbjct: 547 KAGWDSGYGRRVEIEHANGYVTTYNHMSGFARGAGEGARVKQGQVIGYLGQTGLATGPHL 606

Query: 596 HYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPL 648
           HYE++VNG  VD  KV++       G +L  F  E+ RI+SLL      ++ +
Sbjct: 607 HYEVLVNGHFVDPMKVKLSRTREFDGRMLANFKRERDRIDSLLAEAPAAERVV 659


>gi|254472211|ref|ZP_05085611.1| peptidase M23B [Pseudovibrio sp. JE062]
 gi|211958494|gb|EEA93694.1| peptidase M23B [Pseudovibrio sp. JE062]
          Length = 652

 Score =  539 bits (1387), Expect = e-151,   Method: Composition-based stats.
 Identities = 197/642 (30%), Positives = 324/642 (50%), Gaps = 18/642 (2%)

Query: 14  FSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIAI 73
            + G+ P ++ +       D   +++ RWL  T   G+TS V++GG+L+ ALDG      
Sbjct: 14  VNLGNEPALMVD-SLASSSDQPARLNGRWLIGTILTGMTSMVLMGGALMAALDGQYTYKT 72

Query: 74  PAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKIP 133
                 +    NA +L+ + ++  +             + IIEV T+ +   +D +K  P
Sbjct: 73  -----AKAPASNAADLTPQRNTSGKGDRLTSATDGFSNRQIIEVNTVTRSEGRDHVKAKP 127

Query: 134 FAYARMTFAT--PYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVD-SFEVTTQKIN 190
           +A    +           D P FDP+ ++ +G+  +  Q+  D I+  D   EV+  + +
Sbjct: 128 YALVSASLENFKKQETAADIPPFDPITMY-QGEQVAPLQVASDAIYGADIEGEVSISQRD 186

Query: 191 FPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYA-DPQTLDQRHDHPITYS 249
           FP +   +      ++E ++  +      + +       +    D              +
Sbjct: 187 FPLEAMSMVALPDHKEEAVQQQVKKAAMFMLDNSTDIAAIPSVEDINAGFAPLSEQSFEN 246

Query: 250 KKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALK 309
            +++I EEN +         +  +  + ++PI   T   D ++    S  ++    KA  
Sbjct: 247 IEVRITEENVSFQPKSRKTTQANQIEERIVPILTQTDFIDILLDGEASETEAEGYIKAFT 306

Query: 310 NEVRVDQLTKDEILRIGVVQKD---DKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPV 366
           +   +D +   +I R+ +       D   +VR SIY  Q+H+ TIA ND  E+V+  EP 
Sbjct: 307 DNFGIDTIKAGQIFRLSLNTDQIEEDDGILVRVSIYEDQRHVGTIARNDEGEFVVAPEPT 366

Query: 367 KMDINHQMDYMRTSEESP--NIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPT 424
                   +  + +   P    YD I++    N + S+L+K ++R  + SV+    +K  
Sbjct: 367 TQMAADAFNSQQQNSVGPRATYYDSIYQTGLDNEVPSSLIKELIRIYSYSVDFNASVKSG 426

Query: 425 DFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPF 484
           D +  F+      +Q +  SE+LY          RFYRF  P DG V+Y++ENG+S++ F
Sbjct: 427 DEMSVFYG--LDADQTTGASEILYTSITVNGRSHRFYRFRTPDDGVVDYYDENGQSAKQF 484

Query: 485 LLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYG 544
           LLR P+  GR TSGFGMR HP+L   R+HTG DWAAPRGT I A GDG+++KA W+GGYG
Sbjct: 485 LLRKPIAAGRFTSGFGMRRHPVLKTRRLHTGTDWAAPRGTAIFAAGDGVIQKAAWSGGYG 544

Query: 545 KQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGI 604
           K+  I H NGYV++YNH    A  I+ G  ++QG +IG++GTTGLSTG HLHYE+ VNG 
Sbjct: 545 KRVEIKHANGYVTTYNHMTRFATGIQKGQRIRQGTVIGYVGTTGLSTGNHLHYEVKVNGR 604

Query: 605 KVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKK 646
            V+S K+++P+   L+  +L+ F  E+ RIN+L+  G   ++
Sbjct: 605 FVNSLKIKVPQGRVLEAQVLENFKRERDRINALMETGRPSQR 646


>gi|307942494|ref|ZP_07657843.1| M24/M37 family peptidase [Roseibium sp. TrichSKD4]
 gi|307774315|gb|EFO33527.1| M24/M37 family peptidase [Roseibium sp. TrichSKD4]
          Length = 635

 Score =  537 bits (1382), Expect = e-150,   Method: Composition-based stats.
 Identities = 204/635 (32%), Positives = 328/635 (51%), Gaps = 22/635 (3%)

Query: 27  DAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIAIPAKLSHQTSEENA 86
             +  L ++R+VSLRWLS T   G+TS +++GG+L+TA+DG   ++       Q  E  A
Sbjct: 3   GDQHVLKDKRQVSLRWLSGTVLTGLTSIILMGGALMTAIDGQYSVSAA--TGVQAIETKA 60

Query: 87  INLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKIPFAYARMTFATPY- 145
               +K     +     +T +++  K II+V  + ++ +++ I+  P+A+   T AT   
Sbjct: 61  QKSGSKGG---KGDRITQTATEYSNKQIIDVNVVTREGDREYIRMKPYAFITSTLATRKD 117

Query: 146 -PKVKDHPKFDPLKIFSEGKIES----SSQMLMDTIHNVD-SFEVTTQKINFPTDITRIQ 199
               ++ P ++PL +FSE   ++     + +  D+ + V    E++     FP +   I 
Sbjct: 118 PKLSQEIPPYNPLTLFSENHSDTLGSEVASIFADSSYGVKVEGEISIALTRFPANNPDIS 177

Query: 200 LDHTAQDEEIKNAIMNQFFLLHNKKNQ--SFTLYYADPQTLD-QRHDHPITYSKKIKIIE 256
                ++++++  +      L          T    DP   D      P      ++I  
Sbjct: 178 NGIEPKEQDVERVVRESARFLTAADQSFDVATKAIVDPARFDFNLARQPDLARYAVRITP 237

Query: 257 ENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQ 316
           EN +  S      +     + ++PI     I DA+     +  D+ +I  A     ++D 
Sbjct: 238 ENVSFVSKTDEETRYAGMEEKIVPITDEIEIVDALHEHSITPEDAVQIQSAFSQNYKLDM 297

Query: 317 LTKDEILRIGVVQKDDKFT---IVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQ 373
           L+    LRI      D  +     R S+Y   +H  T+A +D   YV    P     +  
Sbjct: 298 LSNGHRLRIAYAPAFDGTSRMLPERVSLYVDTEHKATVARSDTGTYVKAKAPATFLASAF 357

Query: 374 MDYMRTSEESPN--IYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFF 431
            +  R S   P   IYD +++      +  +++  ++R  +  V+    ++P D LE FF
Sbjct: 358 AEADRVSYGGPTPVIYDSLYQTALEQELPDHIIDELIRIFSFDVDYNARVQPGDSLELFF 417

Query: 432 SVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVP 491
           + N   ++A+   E+LY     G T  RFYRF  P DG V+Y++ NG+S++ FL+R P+ 
Sbjct: 418 AEN--TDEAAAPQEVLYAALTTGATSRRFYRFRTPDDGIVDYYDSNGQSAKKFLMRKPLS 475

Query: 492 FGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHH 551
            GR  SGFGMR HPIL Y RMHTGVDW+A RGTPI+A G+G + KA W+ GYG++  I H
Sbjct: 476 SGRFRSGFGMRRHPILKYRRMHTGVDWSASRGTPIMAAGNGEIIKAGWSSGYGRRIEIQH 535

Query: 552 GNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKV 611
            NGYV++Y+H +  ++ I+ G  V QGQIIG +G+TGLSTGPHLHYE+ VNG  VD  ++
Sbjct: 536 TNGYVTTYSHMNGFSRGIRKGARVNQGQIIGSVGSTGLSTGPHLHYEVKVNGNFVDPMRI 595

Query: 612 RIPERENLKGDLLQRFAMEKKRINSLLNNGENPKK 646
           R+P    L GD+L  F  E+ RI++LL +G+ P +
Sbjct: 596 RLPRGRVLDGDMLAEFVKERDRIDALLEDGKRPSR 630


>gi|319899302|ref|YP_004159399.1| hypothetical protein BARCL_1157 [Bartonella clarridgeiae 73]
 gi|319403270|emb|CBI76829.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 662

 Score =  536 bits (1381), Expect = e-150,   Method: Composition-based stats.
 Identities = 223/671 (33%), Positives = 348/671 (51%), Gaps = 41/671 (6%)

Query: 6   ISNKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTAL 65
           + + +      G  P ++            R+VS+RWL+ T   G+TS +++G +L  AL
Sbjct: 1   MWDNQHQTNDPGQDPALVIQRSK----PASRQVSVRWLTGTILTGVTSCILMGIALFAAL 56

Query: 66  DGHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPK-TKSKHPEKIIIEVPTLIKDH 124
           +G   +  PA+           + S +    +  R++P   +    +K   E+ TL K  
Sbjct: 57  EGKHTLITPAQWFLL------EDHSREDYDKKGDRIAPTHARQSFDKKKQFELSTLQKKG 110

Query: 125 NKDIIKKIPFAYARMTFATPYPKVKDHPKFDPLKIFS-EGKIESSSQMLMDTIHNVD-SF 182
           +K +++   F + RM  A        +P FD L IFS +   + +  +    I+      
Sbjct: 111 DKQVVETQNFEWIRMALAEERRNKYTYPPFDALSIFSNDSNNQIAQSLEGGQIYGAKVET 170

Query: 183 EVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLD-QR 241
           ++T    +F  + T         D+E++  I    F L           + DP  LD   
Sbjct: 171 KMTLHSRDFIIEQTHFDETDILTDDEVEKEIQKSGFFLDKNNENLSLFPFLDPAQLDISS 230

Query: 242 HDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDS 301
               I     +++++EN T+T+    ID    +A+D+IPI+   TI +A+  + YS    
Sbjct: 231 SSLKIPKIPNVRLVQENVTVTAQNQRIDLTKNYAEDIIPIRKKQTILEALQKSDYSQEQM 290

Query: 302 AKIAKALKNEVRVDQLTKDEILRIGV-VQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYV 360
            +IAK L    R D L    +LRIG+  Q+ ++  +VR SIY    H+LTIALND+N++V
Sbjct: 291 ERIAKILAQLNRSDTLKAGNLLRIGIVTQQGEEDHLVRASIYQGMSHILTIALNDDNQFV 350

Query: 361 LGVEPVKMDINHQMDYM------RTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASS 414
           +  EP    +                 + P +YD I++A   + M+ +L + ++R LA +
Sbjct: 351 VSTEPEMSHVLKTAFQNGQPHSYVNISQLPTVYDAIYQAVLSHNMSQSLSQHLIRLLAMN 410

Query: 415 VNLQEHLKPTDFLETFF-----SVNHANNQASDDS--------------ELLYIHARFGE 455
           ++++  + PTD LE F+          N++++ +               E+ YI A FG 
Sbjct: 411 IDMKSRITPTDQLEIFYALPKQQNAEKNSKSAKNGMPLQTASSPTNADPEIRYISATFGS 470

Query: 456 TRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTG 515
              ++Y + +      +Y++  GKSS+PFLLR P+P G   S FG R HPILGY RMHTG
Sbjct: 471 VTYKYYHYQSKNG-GADYYDSEGKSSKPFLLRKPIPNGIFGSPFGPRKHPILGYVRMHTG 529

Query: 516 VDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAV 575
           VDW AP+G+PI+AVGDG+V K     GYG  T I H NGYVSSY+HQ+  A NIK G  V
Sbjct: 530 VDWVAPKGSPIIAVGDGVVTKVGKVSGYGNHTEIKHANGYVSSYSHQNNYAANIKPGVKV 589

Query: 576 KQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRIN 635
           +QGQIIG++G+TGL+TGPH H+E+IVNG KVD  ++R+P+ ++LK   LQ F  EKK I+
Sbjct: 590 RQGQIIGYVGSTGLATGPHCHFEIIVNGKKVDPMRIRLPDSKSLKDQDLQVFLKEKKNID 649

Query: 636 SLLNNGENPKK 646
           SL+ +   P+ 
Sbjct: 650 SLIYSVIQPEN 660


>gi|158425820|ref|YP_001527112.1| hypothetical protein AZC_4196 [Azorhizobium caulinodans ORS 571]
 gi|158332709|dbj|BAF90194.1| conserved hypothetical protein [Azorhizobium caulinodans ORS 571]
          Length = 673

 Score =  535 bits (1379), Expect = e-150,   Method: Composition-based stats.
 Identities = 186/662 (28%), Positives = 310/662 (46%), Gaps = 40/662 (6%)

Query: 16  FGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIA-IP 74
            G+ PP+  + D ++   +RR++S+RWL+ T   G+    ++GG++  ALDG  + A +P
Sbjct: 19  LGEDPPLGVDGDEEVI--DRRRLSVRWLAATLLTGLCGSFLMGGAVYAALDGDHRFASMP 76

Query: 75  AKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKIPF 134
             + +      A+   A  ++ +  R+S   ++    +    V T  K  +K+II+  PF
Sbjct: 77  ETVRNALRGALAVGEKASNAARKGDRMSLLAEAN-SARQTFRVSTTTKVGDKEIIRVRPF 135

Query: 135 AYARMTFATPYPKVK-DHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVTTQKINFPT 193
                  A     V  + P+F+P +I +    +S+            + EVT    +   
Sbjct: 136 TRVAANLAMNVTSVSTNIPRFNPAQIVA----QSADNTPDAAPQAEPTGEVTLVMRDLAG 191

Query: 194 DITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQS-----------------FTLYYADPQ 236
             T +        EE+   +     L  ++                      +L YA   
Sbjct: 192 -QTNLHYGSAVPMEEVLGKVREVAELARSQMPVPLPTAITGQPPSGPVGGSPSLAYATDG 250

Query: 237 TLDQRHDHPITYSKKIKI-IEENRT-ITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHA 294
                       +  I+  + EN + +           ++ D  + ++   TI   +   
Sbjct: 251 RYGLPSGLGTAGAPAIRPDLVENMSYLGKTSAETSGGNDWTDTTVVVKKGDTIVSILTDN 310

Query: 295 GYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKD-DKFTIVRFSIYHKQKHLLTIAL 353
           G S  ++  +A A +       +     LR+ +      +   +R SI+    H  T+A 
Sbjct: 311 GVSVQEAKALAAAFR-RGSDGTVKDGLRLRLLLQSDAAKQVHPLRVSIFSDAGHEGTVAA 369

Query: 354 NDNNEYVLGVEPVKMDI----NHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMR 409
           +D   +V   EP + DI     +  D          +Y+ ++     N M  +++  ++R
Sbjct: 370 SDTGSFVSVAEPTESDIGGVSENVSDDEDDDGPGIRLYESLYETALRNDMPRSVIADLVR 429

Query: 410 TLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDG 469
             +  V+ Q  +KP D  E  +S ++  +      E+LY          R+YRF  P DG
Sbjct: 430 IYSFDVDFQRRVKPGDSFEVLYSEDNPTD-----PEVLYATLTTAGETRRYYRFQTPDDG 484

Query: 470 SVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAV 529
            V+Y++E+GKS++ FL+R P+  G M S FG R HPILG S++HTGVDW+   GTPI A 
Sbjct: 485 LVDYYDEDGKSAKKFLVRKPIAGGIMRSPFGYRRHPILGISKLHTGVDWSDAVGTPIYAA 544

Query: 530 GDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGL 589
           G+G V  ANW  GYG+ T I H NGYV++Y+HQ   AK +K G  V+QGQ+IG++G++GL
Sbjct: 545 GNGTVIYANWKSGYGRHTEIQHANGYVTTYSHQSGFAKGLKEGQQVRQGQLIGYLGSSGL 604

Query: 590 STGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLF 649
           STGPHLHYE+ +NG  VD  +V++P    L G +L  F  E++RI +LL++   P K   
Sbjct: 605 STGPHLHYEVKINGSFVDPLRVKLPRGRALDGRILADFRKERERIEALLSHAPVPPKVAS 664

Query: 650 TS 651
            +
Sbjct: 665 AA 666


>gi|319407652|emb|CBI81300.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 662

 Score =  532 bits (1371), Expect = e-149,   Method: Composition-based stats.
 Identities = 226/671 (33%), Positives = 345/671 (51%), Gaps = 41/671 (6%)

Query: 6   ISNK-RDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTA 64
           + +  +      G  P ++  +        RR+VS+RWL+ T   G+TS +++G +L  A
Sbjct: 1   MWDNNQYQKNDPGQDPALVIQHSK----PARRQVSVRWLTGTILTGVTSCILMGIALFAA 56

Query: 65  LDGHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPK-TKSKHPEKIIIEVPTLIKD 123
           L+G   +  PA+           + S +    +  R+ P   +     +   E+ TL K 
Sbjct: 57  LEGKHTLITPAQWFLL------EDHSLEDYDKKGDRIVPTHARQSFDRRRQFELSTLQKK 110

Query: 124 HNKDIIKKIPFAYARMTFATPYPKVKDHPKFDPLKIFS-EGKIESSSQMLMDTIHNVD-S 181
            N+ +++   F + RM  A        +P FD L IFS +   + S  +    I+     
Sbjct: 111 GNEKVVETQSFEWIRMALAEERRNKYTYPPFDALSIFSNDSNNQISQTLEGGQIYGAKVE 170

Query: 182 FEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLD-Q 240
            ++T +  +F  + T          EE +  I    F L     +   L + DP  LD  
Sbjct: 171 TKMTLRSRDFIIEQTHFDEMDILTAEEAQKEIQKSGFALDKNNEKLSLLPFLDPAQLDIS 230

Query: 241 RHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGD 300
                +  +  +++ +EN TIT+    ID    +A+D+IPI+   TI +A+  + Y    
Sbjct: 231 TSSLKVPKTPNVRLTQENVTITARNHRIDLTKNYAEDIIPIRKKKTILEALKKSDYPQEQ 290

Query: 301 SAKIAKALKNEVRVDQLTKDEILRIGV-VQKDDKFTIVRFSIYHKQKHLLTIALNDNNEY 359
             +IA+ L    R D L    +LRIG+  Q  ++  +VR SIY    H+LTIALNDNN++
Sbjct: 291 MERIAQILAQLNRSDTLKAGNLLRIGIVTQHGEEDHLVRASIYQGMNHILTIALNDNNQF 350

Query: 360 VLGVEPVKMDINHQMDYM------RTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLAS 413
           V   EP                   +  + P +YD I++A   + M+ +L + ++R LA 
Sbjct: 351 VASTEPEMSHALKTAFQNGQPHSYVSVAQLPTVYDAIYQAVLSHNMSQSLSQHLIRLLAM 410

Query: 414 SVNLQEHLKPTDFLETFF----------SVNHANNQAS--------DDSELLYIHARFGE 455
           +++++  + PTD LE F+          S N  N             D E+ YI A FG 
Sbjct: 411 NIDMKSRITPTDQLEIFYALPKQQAEKNSKNTKNGTQLQTASSPTNGDPEIRYISATFGS 470

Query: 456 TRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTG 515
              ++Y + +    S +Y++  GKSS+PFLLR P+P G   S +G R HPILGY RMHTG
Sbjct: 471 VTYKYYHYQSTNG-SADYYDSEGKSSKPFLLRKPIPNGIFGSPYGPRKHPILGYVRMHTG 529

Query: 516 VDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAV 575
           VDW AP+G+PI+AVGDG+V +     GYG  T I H NGYVSSY+HQ+  A NIK G  +
Sbjct: 530 VDWIAPKGSPIIAVGDGVVTRVGVVSGYGNHTEIKHANGYVSSYSHQNNYAPNIKPGVKI 589

Query: 576 KQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRIN 635
           KQGQIIG++G+TGL+TGPH H+E+IVNG KVD  ++R+P+ ++LK   LQ F  EKK I+
Sbjct: 590 KQGQIIGYVGSTGLATGPHCHFEIIVNGKKVDPMRIRLPDSKSLKDKDLQAFLKEKKNID 649

Query: 636 SLLNNGENPKK 646
           SL+ +   P+ 
Sbjct: 650 SLIYSVTQPEN 660


>gi|220925653|ref|YP_002500955.1| peptidase M23 [Methylobacterium nodulans ORS 2060]
 gi|219950260|gb|ACL60652.1| Peptidase M23 [Methylobacterium nodulans ORS 2060]
          Length = 681

 Score =  531 bits (1367), Expect = e-148,   Method: Composition-based stats.
 Identities = 173/664 (26%), Positives = 294/664 (44%), Gaps = 25/664 (3%)

Query: 5   TISNKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTA 64
           T +++       G  PP+  +        +RR V+LRWL+     G+    +IG ++  +
Sbjct: 13  TPTSRAGRAADPGHEPPLDLSGAD-SPQADRRGVNLRWLAACVLTGMAGTGLIGSAIWVS 71

Query: 65  LDGHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDH 124
           L G    A   + +   +     +      + +  RL          K     P  I+  
Sbjct: 72  LQGELSFAQLPQ-AVAIAARPQPSDGGSNVARKGDRLVRNPMVALA-KQSFRAPVTIRSG 129

Query: 125 NKDIIKKIPFAYARMTF-ATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFE 183
            ++II+  PF        AT      D P FDP++ F+E   E + ++      + D   
Sbjct: 130 EREIIRVRPFVRIATALSATAGLAATDIPPFDPMRFFTEPGAERAPEVAPTDTPDADVSV 189

Query: 184 VT---TQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNK-------KNQSFTLYYA 233
           V     +    P        D  AQ EE +        L                +    
Sbjct: 190 VKRDLAEVTVGPGAPALTDDDVAAQIEEERRLAAEAGRLAALPIAPQLMLSRALRSFPAL 249

Query: 234 DPQTLDQRHDHPITYSKKIKIIEENRTITSP-QVLIDKIPEFADDLIPIQHNTTIFDAMV 292
                D   D     S +++++ EN T  +  +    ++P   +  + I+   T+   + 
Sbjct: 250 PALDADLGRDSGPFKSIEVRVLRENVTDLAKIETRPREVPLVEERDVTIKRGETLESVLR 309

Query: 293 HAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQ---KDDKFTIVRFSIYHKQKHLL 349
                +     I  AL    R   + + + +R+ +       D   + R  +Y +     
Sbjct: 310 ANAGLDEQIRPILTALGGFARATTVGEGQQMRLLIGPGPRPGDPRQLNRVILYGESGIEA 369

Query: 350 TIALNDNNEYVLGVEPVKMDINHQMDY-------MRTSEESPNIYDGIWRATSFNGMNSN 402
             A+ND  ++V    P +     +                   +Y  ++   + + +  +
Sbjct: 370 IAAMNDRGQFVSVTPPAQEGAAPKAARSAGSDDGDDEGGSGARLYASLYETAARHDLPRS 429

Query: 403 LVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYR 462
           +V+ ++R     V+ Q  +   D LE  ++ +  +  +++  ++LY     G    R YR
Sbjct: 430 MVEDLVRIFGYDVDFQRRVASGDNLELLYTYDEESGGSAERPDMLYAALTVGGEARRVYR 489

Query: 463 FLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPR 522
           F +P DG+VEYF++ G+S + FL+R PV  G M+SGFG R HP+LGY+++HTGVDW+ P 
Sbjct: 490 FQSPDDGTVEYFDDMGRSLKKFLIRKPVADGNMSSGFGYRRHPVLGYAKLHTGVDWSVPI 549

Query: 523 GTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIG 582
           GTPIVA G+G V KA W  GYG++  + H NGYV++YNH     + I AG  V+QGQ+IG
Sbjct: 550 GTPIVAAGNGTVLKAEWDSGYGRRVELQHANGYVTTYNHMSRFGRGIAAGARVRQGQVIG 609

Query: 583 WIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGE 642
           ++G+TGLSTG HLHYE+I+NG  VD  K+R+P    L G LL  F  ++++++ L+    
Sbjct: 610 YVGSTGLSTGAHLHYEVIINGHFVDPMKIRVPRGRELDGRLLAEFRRQREQVDGLIQKST 669

Query: 643 NPKK 646
           +   
Sbjct: 670 SGPT 673


>gi|319406175|emb|CBI79812.1| membrane protein related to metalloendopeptidases [Bartonella sp.
           AR 15-3]
          Length = 662

 Score =  530 bits (1366), Expect = e-148,   Method: Composition-based stats.
 Identities = 222/671 (33%), Positives = 345/671 (51%), Gaps = 41/671 (6%)

Query: 6   ISNK-RDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTA 64
           + +  +   +  G  P ++           RR+VS+RWL+ T   G+TS +++G +L  A
Sbjct: 1   MWDNNQYQQYDPGQDPALVIQRSK----PARRQVSVRWLTGTILTGVTSCILMGIALFAA 56

Query: 65  LDGHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPK-TKSKHPEKIIIEVPTLIKD 123
           L+G   +  PA+           + S +    +  R++P   +    +K   E+ TL K 
Sbjct: 57  LEGKHTLITPAQWFLL------EDHSLEDYDKKGDRIAPTHARQSFDKKRQFELSTLQKK 110

Query: 124 HNKDIIKKIPFAYARMTFATPYPKVKDHPKFDPLKIFS-EGKIESSSQMLMDTIHNVD-S 181
            ++ +++   F + RM  A        +P FD L IFS +   + S  +    I+     
Sbjct: 111 GDEKVVEAQNFEWIRMALAEERHNKYTYPPFDALSIFSHDSNNQISQTLERGQIYGAKIE 170

Query: 182 FEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLD-Q 240
            ++T +  +F  +            +E++  +    F L     +   L + DP  LD  
Sbjct: 171 TKMTLRSRDFIIEQMHFDETDILTADEVQKEVQKSGFALDKNNEKLSLLPFLDPAQLDIS 230

Query: 241 RHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGD 300
                I     +++++EN TIT+    ID    +A+D+IPI+   TI  A+  + Y    
Sbjct: 231 TSSLKIPKIPNVRLVQENVTITARNHRIDLSKNYAEDIIPIRKKQTILGALQKSDYPQEQ 290

Query: 301 SAKIAKALKNEVRVDQLTKDEILRIGV-VQKDDKFTIVRFSIYHKQKHLLTIALNDNNEY 359
             KIA+ L    R D L    +LRIG+  Q  ++  +VR SIY    H+LTIALND+N++
Sbjct: 291 MEKIAQILAELNRSDTLKAGSLLRIGIVTQHGEEDQLVRASIYQGMSHILTIALNDDNQF 350

Query: 360 VLGVEPVKMDINHQMDYM------RTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLAS 413
           V   EP                      + P +YD I++A   + M+ +L K ++  LA 
Sbjct: 351 VASTEPEMSHALKTAFQNGQPHSYVNVTQLPTVYDAIYQAVLSHNMSQSLSKHLIHLLAM 410

Query: 414 SVNLQEHLKPTDFLETFF----SVNHANNQASDDS--------------ELLYIHARFGE 455
           +++++  + PTD LE F+         NN++                  E+ YI A FG 
Sbjct: 411 NIDMKSRITPTDQLEIFYALPKQHTEKNNKSIKSGTQLQTASSSINKDPEIRYISATFGS 470

Query: 456 TRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTG 515
              ++Y + +    S +Y++  GKSS+PFLLR P P G   S FG+R HPILGY RMHTG
Sbjct: 471 VTYKYYHYQSTDG-STDYYDSEGKSSKPFLLRKPTPNGIFGSPFGLRKHPILGYVRMHTG 529

Query: 516 VDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAV 575
           VDW AP+G+PI+AVGDG+V K     GYG  T I H NGYVSSY+HQ++ A +IK G  +
Sbjct: 530 VDWVAPKGSPIIAVGDGVVTKVGVVSGYGNHTEIKHANGYVSSYSHQNSYAPDIKPGVKI 589

Query: 576 KQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRIN 635
           +QGQIIG++G+TGL+TGPH H+E+IVNG KVD  ++R P+ ++LK   LQ F  EKK I+
Sbjct: 590 RQGQIIGYVGSTGLATGPHCHFEIIVNGKKVDPMRIRFPDSKSLKDKDLQAFLKEKKNID 649

Query: 636 SLLNNGENPKK 646
           SL+++   P+ 
Sbjct: 650 SLIHSVTQPEN 660


>gi|319404687|emb|CBI78289.1| conserved hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 662

 Score =  529 bits (1362), Expect = e-148,   Method: Composition-based stats.
 Identities = 226/671 (33%), Positives = 343/671 (51%), Gaps = 41/671 (6%)

Query: 6   ISNK-RDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTA 64
           + +  +      G  P ++  +        +R+VS+RWL+ T   G+TS +++G +L  A
Sbjct: 1   MWDNNQYQKNDPGQDPALVIQHSK----PAKRQVSVRWLTGTILTGVTSCILMGIALFAA 56

Query: 65  LDGHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPK-TKSKHPEKIIIEVPTLIKD 123
           L+G   +  PA+           + S +    +  R++P   +     K   E+ TL K 
Sbjct: 57  LEGKHTLITPAQWFLL------EDHSLEDYDKKGDRITPTHARQSFDRKRQFELSTLQKK 110

Query: 124 HNKDIIKKIPFAYARMTFATPYPKVKDHPKFDPLKIFS-EGKIESSSQMLMDTIHNVD-S 181
            N+ +++   F + RM  A        +P FD L IFS +   + S  +    I+     
Sbjct: 111 GNEKVVETQNFEWIRMALAEERRHKYTYPPFDALSIFSNDSNNQISQTLEGGQIYGAKVE 170

Query: 182 FEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQR 241
            ++T +  +F  +            EE +  I    F L     +   L + DP  LD  
Sbjct: 171 TKMTLRSHDFIIEQAHFDETDILTAEEAQKEIQKSGFALDKNNEKLSLLPFLDPAQLDIS 230

Query: 242 HDH-PITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGD 300
                +     +++ +EN TIT+    ID    +A+D+IPI+   TI +A+  + Y    
Sbjct: 231 TPSLKVPKIPNVRLTQENVTITASNHRIDLTKNYAEDIIPIRKKKTILEALQKSDYPQEQ 290

Query: 301 SAKIAKALKNEVRVDQLTKDEILRIGV-VQKDDKFTIVRFSIYHKQKHLLTIALNDNNEY 359
             KIA+ L    R D L    +LRIG+  Q  ++  +VR SIY    H+LTIALNDNNE+
Sbjct: 291 MEKIAQTLAKLNRSDTLKAGNLLRIGIVTQHGEEDHLVRASIYQGMNHILTIALNDNNEF 350

Query: 360 VLGVEPVKMDINHQMDYM------RTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLAS 413
           V   EP                   +  + P +YD I++A   + M+ +L + ++R LA 
Sbjct: 351 VASTEPEMSHALKTAFQNGQPHSYVSVAQLPTVYDAIYQAVLSHNMSQSLSQHLIRLLAM 410

Query: 414 SVNLQEHLKPTDFLETFF----------SVNHANNQAS--------DDSELLYIHARFGE 455
           +++++  + PTD LE F+          S N  N             D E+ YI A FG 
Sbjct: 411 NIDMKSRITPTDQLEIFYALPKQQAEKNSKNTKNGTQLQTASSSANGDPEIRYISATFGS 470

Query: 456 TRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTG 515
              ++Y + +    S +Y++  GKSS+PFLLR P+P G   S +G R HPILGY RMHTG
Sbjct: 471 VTYKYYHYQSTNG-SADYYDSEGKSSKPFLLRKPIPNGIFGSPYGPRKHPILGYVRMHTG 529

Query: 516 VDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAV 575
           VDW AP+G+PI+AVGDG+V +     GYG  T I H NGYVSSY+HQ+  A NI  G  +
Sbjct: 530 VDWIAPKGSPIIAVGDGVVTRVGVVSGYGNHTEIKHANGYVSSYSHQNNYAPNISPGVKI 589

Query: 576 KQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRIN 635
           KQGQIIG++G+TGL+TGPH H+E+IVNG KVD  ++R+P+ ++LK   LQ F  EKK I+
Sbjct: 590 KQGQIIGYVGSTGLATGPHCHFEIIVNGKKVDPMRIRLPDSKSLKDKDLQAFLKEKKNID 649

Query: 636 SLLNNGENPKK 646
           SL+ +   P+ 
Sbjct: 650 SLIYSVTQPEN 660


>gi|154245849|ref|YP_001416807.1| peptidase M23B [Xanthobacter autotrophicus Py2]
 gi|154159934|gb|ABS67150.1| peptidase M23B [Xanthobacter autotrophicus Py2]
          Length = 683

 Score =  527 bits (1356), Expect = e-147,   Method: Composition-based stats.
 Identities = 182/674 (27%), Positives = 303/674 (44%), Gaps = 48/674 (7%)

Query: 7   SNKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALD 66
                     G+ PP+  + D +    +RR+VS+RW + T    +    ++GG++  ALD
Sbjct: 10  WRDATSAAGLGEDPPLGVDGDEEDI--DRRRVSVRWFAATLLTALCGSFLMGGAVYAALD 67

Query: 67  GHQKIA-IPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHN 125
           G  + A +P K+ +      A+      ++ +  R+S         +    V T  K  +
Sbjct: 68  GEHRFALMPEKVRNTIRGALALGERPVNAARKGDRMSLLG-DSASARQTFRVSTATKVGD 126

Query: 126 KDIIKKIPFAYARMTFATPYPK-VKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEV 184
           ++IIK  PF       A        + P+F+P ++ +E   +  +    +      + EV
Sbjct: 127 REIIKVRPFTRVAANLAMSTTSVSANIPRFNPAQVVAESVSKEEAAPQAE-----PTGEV 181

Query: 185 TTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDH 244
           T    +  +     +L      E +   +     L          L  A           
Sbjct: 182 TLVMRDLSSLPQSTKLGAATPMENVLVKVREVAELSRPGPGNPGALPPAIVGGPGFAPPA 241

Query: 245 PITY-----------------------------SKKIKIIEENRTITSPQ-VLIDKIPEF 274
             T                                  + +  N +             ++
Sbjct: 242 SPTPYLSYASVGDALGNGAGLPGSAVPGAHAPGLPAQQAMPGNISFVPKTSDETSGGNDW 301

Query: 275 ADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKF 334
           +D  + ++   TI   ++  G S  D+   A A        Q+     +R+ + +++ + 
Sbjct: 302 SDTAVVVKKGDTIASILIDNGVSKEDARAAAAAFGRGRD-GQVKDGLRMRMLLQEENKRV 360

Query: 335 TIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNI--YDGIWR 392
             +R SI+    H  T+AL+D +E+V   EP + +I    +     +  P I  Y+ ++ 
Sbjct: 361 RPLRVSIFSDLGHEGTVALSDKDEFVNVPEPSETEIAGISEDTDDDDSGPGIRLYESVYE 420

Query: 393 ATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHAR 452
               N +   ++  I+R  +  V+ Q  ++P D  E  +S     +     +++LY    
Sbjct: 421 TCLRNEVPRAVIADIIRVYSFDVDFQRRVRPGDNFEILYS-----DDPGASNDVLYAALT 475

Query: 453 FGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRM 512
             +   R+YRF    DG V+Y++++GKS++ FL+R P+  G M S FG R HPILGYS++
Sbjct: 476 VNKETRRYYRFQTADDGVVDYYDDDGKSAKKFLVRKPLAGGIMRSPFGYRRHPILGYSKL 535

Query: 513 HTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAG 572
           HTGVDWA   GTPI A G+G +  ANW  GYGK T I H NGYVS+Y+HQ   A+ I+ G
Sbjct: 536 HTGVDWADAIGTPIYAAGNGTIIYANWKSGYGKHTEIQHANGYVSTYSHQSGFARGIREG 595

Query: 573 TAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKK 632
             V+QGQ+IG+IGTTGLSTGPHLHYE+ +NG  VD  ++++P    L G  L  F  E++
Sbjct: 596 MTVRQGQLIGYIGTTGLSTGPHLHYEVKINGNFVDPMRIKLPRGRALDGRFLAEFKRERE 655

Query: 633 RINSLLNNGENPKK 646
           RI +LL++   P +
Sbjct: 656 RIEALLSHAPVPPR 669


>gi|254504905|ref|ZP_05117056.1| M23 peptidase domain protein [Labrenzia alexandrii DFL-11]
 gi|222440976|gb|EEE47655.1| M23 peptidase domain protein [Labrenzia alexandrii DFL-11]
          Length = 617

 Score =  525 bits (1353), Expect = e-147,   Method: Composition-based stats.
 Identities = 174/621 (28%), Positives = 305/621 (49%), Gaps = 26/621 (4%)

Query: 43  LSTTFFAGITSGVIIGGSLLTALDGHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLS 102
           ++ T   G+TS V++GG+L  ALDG   +A          E  A           +    
Sbjct: 1   MTGTVLTGVTSLVLMGGALTAALDGQYSVAATPSF-----ELGANGYLETGGRGSKGDRV 55

Query: 103 PKTKSKHPEKIIIEVPTLIKDHNKDIIKKIPFAYARMTFATPYP--KVKDHPKFDPLKIF 160
            ++ +++  K +++V  + +   ++ I+  P  +   + AT       +  P F+P+ +F
Sbjct: 56  LRSATEYSNKQVLDVNVVTRVGERENIRVQPHIFVSASLATRSDPDLAQLIPDFNPMAMF 115

Query: 161 SEGK--------IESSSQMLMDTIHNVD-SFEVTTQKINFPTDITRIQLDHTAQDEEIKN 211
           ++ +          + + +L D+ +      EV+     FP+    I LD T  + EI+ 
Sbjct: 116 ADNQDLNEEGGVPGAETLLLADSSYGAKLESEVSISLTAFPSQSRSIALDATPTETEIEL 175

Query: 212 AIMNQFFLLHNKKNQSFTLYYADPQTLD-QRHDHPITYSKKIKIIEENRTITSPQVLIDK 270
           ++      +     +       DP   D      P      ++I  EN +  S +    +
Sbjct: 176 SVREIARTMSIDTVEMAAKTLVDPGRFDFNLALQPDLERFAVRITPENVSFVSKREEEIR 235

Query: 271 IPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQK 330
                + +IP+     I D ++    +  ++A I  A ++     ++   + LRI     
Sbjct: 236 FAGMDEKIIPLNSGQNIADLLLDHEATETEAAIINDAFRDVFGFTEIEDGQRLRIAYAPD 295

Query: 331 DDKF---TIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPN-- 385
            +        R S+Y   +H  T+A +D+  Y+   EP     N   +  R S   P   
Sbjct: 296 PENLERMRPERISLYTDTEHQATVARSDSGSYIEAKEPDTFLANAFEEADRISYGGPTPA 355

Query: 386 IYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSE 445
           IYD +++      M   ++  ++R  +  V+    ++P D LE FF+ + A        +
Sbjct: 356 IYDSLYQTALEQEMPEAIIDDLIRMFSFDVDFNARVQPGDALELFFTESEAGG----PPK 411

Query: 446 LLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHP 505
           +LY   + G T   FYR+  P D  +++++++G+S++ FL+R P+  G+  SGFGMR HP
Sbjct: 412 ILYASLKTGNTSREFYRYRTPDDNVIDFYDDSGQSAKKFLIRKPLNGGKFRSGFGMRRHP 471

Query: 506 ILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAI 565
           I  Y++MH GVDWAAPRGTPI A G+G ++K+ W+ GYG++  + H NGYV++Y+H    
Sbjct: 472 IHRYTKMHRGVDWAAPRGTPIFAAGNGTIKKSGWSSGYGRRIELQHTNGYVTTYSHLTGF 531

Query: 566 AKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQ 625
           AK I+ G  V QG +IG++G+TGLSTGPHLHYE++VNG  +D  ++++P+   L G+L  
Sbjct: 532 AKGIREGARVNQGTVIGYVGSTGLSTGPHLHYEVLVNGRFMDPMRIKLPKGRTLDGELRT 591

Query: 626 RFAMEKKRINSLLNNGENPKK 646
            F  E+ RI++LL+    P +
Sbjct: 592 TFEAERYRIDTLLDRARKPSR 612


>gi|114706933|ref|ZP_01439832.1| peptidase, M23/M37 family protein [Fulvimarina pelagi HTCC2506]
 gi|114537483|gb|EAU40608.1| peptidase, M23/M37 family protein [Fulvimarina pelagi HTCC2506]
          Length = 646

 Score =  524 bits (1350), Expect = e-146,   Method: Composition-based stats.
 Identities = 205/657 (31%), Positives = 340/657 (51%), Gaps = 34/657 (5%)

Query: 13  LFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIA 72
             +FGD PP++ +   K    +RR+VSLRWL+ T   G+TS  ++G +L  AL+G   ++
Sbjct: 5   KPAFGDDPPLIVDRRRK---PDRRQVSLRWLTGTLLTGVTSSALMGIALSAALEGGAGVS 61

Query: 73  IPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKI 132
            P++L+ Q +E           + + AR+            I+E+ T++++ +++++   
Sbjct: 62  RPSQLATQLAEI-------ADVAEKGARVIATALPLASSHQIVELSTIVREGDREVVSTQ 114

Query: 133 PFAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQMLM------DTIHNVD-SFEVT 185
           PFA   M  A  +P  +++P F+PL I SE + +S +            I+      ++ 
Sbjct: 115 PFALVNMLLAARHPTTQEYPDFNPLAIMSETEPDSGTDDADRLSLASAQIYGERVETDIM 174

Query: 186 TQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHP 245
            +  +FP D    +       E  +  +      L  +  Q  +L   DP       +  
Sbjct: 175 LKVSDFPFDEASYENTPPLTSETAEQLVRQAMPGLSYEPVQVASLSRVDPFRFGFGSEAD 234

Query: 246 -ITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAM---VHAGYSNGDS 301
                   ++I+EN +    +   ++ P F ++++P++   +I DA+      G  + ++
Sbjct: 235 EYEPGSAFRVIQENVSFEPSET-ANERPRFYEEILPLREAQSISDALAGLKERGIESEEA 293

Query: 302 AKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVL 361
                 L  E+    L   + LR+G+    +   ++R S Y  +KHL T A   ++ +  
Sbjct: 294 GAALAVLLEEIE---LQSGDALRLGIESSGETREVIRLSAYRGKKHLGTTAKTQDDIFEE 350

Query: 362 GVEPVKMD-----INHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVN 416
           G+ P   D      + +        + P IYDGI++A    G ++ + + ++RT+AS V+
Sbjct: 351 GLAPEMADSVAAIFDERESEAPMRSDMPTIYDGIFQAGLAYGFDAIMCQELIRTIASDVD 410

Query: 417 LQEHLKPTDFLETFFSVNHA-NNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFN 475
           LQ  L PTD L  F++++ A   Q +  S++L++  + G+   R YRF         YF+
Sbjct: 411 LQSRLAPTDQLSVFYTMDDAREGQGASRSDILFVQIKLGDMEKRLYRFKPDGAEHAAYFD 470

Query: 476 ENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIV 534
             G+S+R FL+R P+P GR TS F     HP+LGY R H GVDWAAPRGTPI+A   G V
Sbjct: 471 SEGRSARQFLIRKPLPRGRFTSSFSTGRKHPVLGYVRPHWGVDWAAPRGTPILAAAGGTV 530

Query: 535 EKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPH 594
            +A W  GYG+   I H NGYV+SY+HQ   AK I AG+ V QG+++G++G+TGLSTG H
Sbjct: 531 LEAGWKSGYGRHIKIKHANGYVTSYSHQSGFAKGISAGSRVSQGEVVGYVGSTGLSTGNH 590

Query: 595 LHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTS 651
           LHYE+ VNG KVD  ++++     LKGD L  F +E++RI++L+   E  + P   S
Sbjct: 591 LHYEIEVNGKKVDPMRIKVGSETVLKGDDLSTFNLERERIDALIE--ERFEAPQIAS 645


>gi|323137279|ref|ZP_08072358.1| Peptidase M23 [Methylocystis sp. ATCC 49242]
 gi|322397637|gb|EFY00160.1| Peptidase M23 [Methylocystis sp. ATCC 49242]
          Length = 684

 Score =  518 bits (1335), Expect = e-145,   Method: Composition-based stats.
 Identities = 175/663 (26%), Positives = 290/663 (43%), Gaps = 41/663 (6%)

Query: 14  FSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIAI 73
              GD P I  +       D+RR+VS+RWLS T   G +  ++I  +  TALD   + A 
Sbjct: 20  LDIGDEPAIEIDGRRHTA-DDRRRVSVRWLSGTVLTGFSGALLISAAAYTALDQQTRFAE 78

Query: 74  PAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKIP 133
               +    +E      +++ + ++     +       K      T  +  +K++++   
Sbjct: 79  APTRAAPARQEET---DSQVVNPKKGDRLMRAVDVVAAKQTFRAATTSRSGDKEVVRTKA 135

Query: 134 FAYARMTFA-TPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVTTQKINFP 192
           F +   T    P     + P F+PLK+ ++ +   +     D+   +D  EV+    +  
Sbjct: 136 FTHVAATLTLAPTSFANEVPAFNPLKLITDAR---APDSNGDSDVALDEAEVSFVTHDLG 192

Query: 193 TDITRIQLDHTAQDE-----------EIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQR 241
                 Q    + +E            I         L         +    DP  L   
Sbjct: 193 AVGVETQSAQLSLEECQAQVIEQVKSSIAAGPKATLPLPGQALLSRTSRASIDPMALAYA 252

Query: 242 HDH-----PITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGY 296
                       S +++++ EN T+        +  +  + L  ++H   + D +   G 
Sbjct: 253 TPGSSPLTAPFSSIEVRMVPENVTVAPRDT--PQPTQMEEKLAVVRHGENLTDILAANGV 310

Query: 297 SNGDSAKIAKALKNEVRVDQLTKDEILRIGV---VQKDDKFTIVRFSIYHKQKHLLTIAL 353
                  +A A + +   D + + + +++             + R S+Y+       +A 
Sbjct: 311 PRARIDAVAAAYRGKRG-DPVREGQRVKLLFADFDGSGKNMQLARMSVYNDDVVESIVAA 369

Query: 354 NDNNEYVL---GVEPVKMDINHQM-------DYMRTSEESPNIYDGIWRATSFNGMNSNL 403
            D   +V       P+      +                +  +YD ++       +   +
Sbjct: 370 TDKGTFVQTPTAPAPIARKAPKRYIPALEDLGDEEDDSGAMRLYDSLYETALKQQVPRPI 429

Query: 404 VKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRF 463
           +  ++R  A+ V+LQ  +   D L+ F+     +        LL+          R+YRF
Sbjct: 430 INEMVRVFANDVDLQRGVSGGDTLDLFYDEPD-DGSVPGRDALLFASLTTHNETYRYYRF 488

Query: 464 LNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRG 523
               DG V+Y++ENG+SSR FL+R P+  G   SGFGMR HPILGY +MHTGVDWAAP G
Sbjct: 489 QTTDDGLVDYYDENGRSSRKFLVRKPISIGETRSGFGMRRHPILGYYKMHTGVDWAAPIG 548

Query: 524 TPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGW 583
           TPI+A G+G V KA W  GYG++  I H NGY+++YNH    A+ I  G  VKQGQ +G+
Sbjct: 549 TPILAAGNGTVIKAQWDSGYGRRVEIQHANGYITTYNHMSGFARGITEGVRVKQGQTVGF 608

Query: 584 IGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGEN 643
           +G+TGLSTGPHLHYE++VNG  VD  +V++     ++G +L  F  E+ RI+SL+    N
Sbjct: 609 LGSTGLSTGPHLHYEVMVNGHFVDPMRVKLARTREIEGRMLADFKKERDRIDSLMAKAPN 668

Query: 644 PKK 646
             K
Sbjct: 669 NSK 671


>gi|296448715|ref|ZP_06890575.1| Peptidase M23 [Methylosinus trichosporium OB3b]
 gi|296253784|gb|EFH00951.1| Peptidase M23 [Methylosinus trichosporium OB3b]
          Length = 673

 Score =  518 bits (1334), Expect = e-144,   Method: Composition-based stats.
 Identities = 174/665 (26%), Positives = 301/665 (45%), Gaps = 45/665 (6%)

Query: 14  FSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIAI 73
              GD P I  +   +  L +RR+VS+RWL+ T   G++  V+I  +  TALD   + A 
Sbjct: 18  IDIGDQPAIEADGGRRSAL-DRRRVSVRWLAGTVLTGLSGAVLISSAAYTALDHQSRFAE 76

Query: 74  PAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKIP 133
               +  +  +      +++ + ++     +       K      T  +   K++++   
Sbjct: 77  APTRAQASRRDE---RDSQVVNQKKGDRLLRAVDIVAAKQTFRTTTTARAGEKEVLRTRS 133

Query: 134 FAYARMTFA-TPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVTTQKINFP 192
           + +   T    P     D P F+PL++ ++ +  S + +  +    VD  EV+       
Sbjct: 134 YTHVATTLTLAPTSLADDVPPFNPLRLLADSRNPSDASVEPE--LAVDDAEVSFVTRELV 191

Query: 193 TDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQS--------------------FTLYY 232
           T     +       EE +  +  Q          +                      L Y
Sbjct: 192 TADLG-EQSALLTGEECRAQVAEQAKSQLEAGPNAGLTAPGQWLLSRTSRAALGSPALAY 250

Query: 233 ADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMV 292
           A P             S +++++ EN TI +P+    +  +  + LI ++   T+ DA++
Sbjct: 251 ATPGVTAL--TAAPFASIEVRMVPENVTI-APRTNPPQPTQMDEKLIVLRRGETLADALL 307

Query: 293 HAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGV---VQKDDKFTIVRFSIYHKQKHLL 349
             G      A++  A           + + +++          +  + R SIY + +   
Sbjct: 308 ANGVPKSRIAEVGAAFGGRRIETIAREGQRIKLLFADFDGSGAEMQLARISIYSEDRLET 367

Query: 350 TIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESP--------NIYDGIWRATSFNGMNS 401
            +A  D   ++    P  +    +    R  E+           +YD ++       +  
Sbjct: 368 MVAATDRGGFLQVTAPANLARAGRRGSSRLEEDGEESDDPGAMRLYDSLYETALKQDIPR 427

Query: 402 NLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFY 461
            ++  ++R  AS ++LQ  +   D L+  +     + +      LLY          R+Y
Sbjct: 428 PIINELIRIFASDLDLQRGVAAGDALDILY---DESEEGPGREALLYASITSHNETLRYY 484

Query: 462 RFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAP 521
           R+    DG V+Y++E+G+SSR FL+R P+  G   SGFGMR HPILGY +MHTGVDWAAP
Sbjct: 485 RYQTTDDGLVDYYDESGRSSRKFLVRKPIAAGETRSGFGMRRHPILGYYKMHTGVDWAAP 544

Query: 522 RGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQII 581
            GTPI+A G+G+V ++ W  GYG++  I H NGYV++Y+H    A+ I+ G  V+QGQ++
Sbjct: 545 IGTPILAAGNGLVIQSGWHSGYGRRVEIQHANGYVTAYSHMSGFARGIREGVRVRQGQLV 604

Query: 582 GWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNG 641
           G++G++GLSTGPHLHYE++VNG  VD  +VR+       G LL  F  E+ RI++L+   
Sbjct: 605 GFLGSSGLSTGPHLHYEVMVNGHFVDPMRVRLARTREFDGRLLADFKRERDRIDTLIAKA 664

Query: 642 ENPKK 646
            N  +
Sbjct: 665 PNSPR 669


>gi|188580222|ref|YP_001923667.1| peptidase M23 [Methylobacterium populi BJ001]
 gi|179343720|gb|ACB79132.1| Peptidase M23 [Methylobacterium populi BJ001]
          Length = 699

 Score =  512 bits (1317), Expect = e-142,   Method: Composition-based stats.
 Identities = 186/670 (27%), Positives = 301/670 (44%), Gaps = 39/670 (5%)

Query: 14  FSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIAI 73
           F  G  PP+         + +RR V+LRWL  +   GIT  +++G ++  +L G   +A 
Sbjct: 22  FPRGVEPPLNLLGADARQI-DRRDVNLRWLCASALTGITGVLLMGAAIHVSLQGEGSLAA 80

Query: 74  P---AKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIK 130
                 L  +   +        ++S Q+     +       K     P  ++  +++IIK
Sbjct: 81  VSDRPNLGPRPQTQLPAVEEPGIASAQKGDRLVRNLMIASAKQSFRTPVTVRLGDREIIK 140

Query: 131 KIPFAYARMTFA-TPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVT---T 186
             PF       + T      D P+FDP+K  S+   E +           +   V     
Sbjct: 141 VRPFVRISSNLSMTTGVFASDIPRFDPMKFVSDEPQERAPDPGAADAPGAEVTVVKRDLA 200

Query: 187 QKINFPTDITRIQLDHTAQDEEIKNAIMNQFF----------LLHNKKNQSFTLY-YADP 235
           +    P        D TAQ EE +                  LL     Q      + D 
Sbjct: 201 EIAVDPGAPALSDEDVTAQIEEERRLAAEAGRRTALPLAPQILLSRTLQQGSAFTGFGDG 260

Query: 236 QTLDQR-----HDHPITYSKKIKIIEENRT-ITSPQVLIDKIPEFADDLIPIQHNTTIFD 289
                       D+    S ++ ++ EN T +   ++   + P   +  + ++   T+  
Sbjct: 261 SAQGNGKGKLGEDNSPFKSIEVLVVPENVTKLAKVELRPGEAPLVEERDLALKRGETLDG 320

Query: 290 AMVHAGY-SNGDSAKIAKALKNEVRVDQLTKDEILRIGVV---QKDDKFTIVRFSIYHKQ 345
           A+   G  S+   A I  AL    +V  L++ +  R+ V    +  D   + R  ++ + 
Sbjct: 321 ALKATGLASDPAIAGIVTALGGRAKVTALSEGQQFRVQVAPGPKPGDGRQVTRVVLFGES 380

Query: 346 KHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSE---------ESPNIYDGIWRATSF 396
                 A+ND+  +V    PV        +  +T             P +Y  ++   + 
Sbjct: 381 GVQAIAAINDHGAFVPVAPPVDESRGRTREQAQTEAPDDDEEDEGSGPRLYQSLYETGAR 440

Query: 397 NGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANN-QASDDSELLYIHARFGE 455
           + +    ++ I+R  +  ++ Q  +   D ++ F++ +      ASD  ELLY     G 
Sbjct: 441 HDVPRATIEDIVRIFSYDIDFQRRISSGDGIDLFYTYDEEAGPGASDRPELLYAALNLGG 500

Query: 456 TRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTG 515
              + YRF +P DGS++Y +E G+S + FL+R P+  G M SGFG R HPILGY+++HTG
Sbjct: 501 ESRKVYRFQSPDDGSIDYLDEQGRSLKKFLIRKPIADGIMRSGFGYRRHPILGYAKLHTG 560

Query: 516 VDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAV 575
           VDWA P GTPIVA G+G V KA W  GYG++  + H NGYV++YNH    A+ I AGT V
Sbjct: 561 VDWANPIGTPIVAAGNGTVIKAEWDSGYGRRVEVQHINGYVTTYNHMSRFARGISAGTRV 620

Query: 576 KQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRIN 635
           +QGQ+IG++G+TGLSTG HLHYE+I+NG  VD  K+R+P    L G LL  F  ++ +  
Sbjct: 621 RQGQVIGYVGSTGLSTGAHLHYEVIINGHFVDPMKIRVPRGRELDGRLLAEFKRQRDQTE 680

Query: 636 SLLNNGENPK 645
           + +   +   
Sbjct: 681 ATMQKSKTAT 690


>gi|170741955|ref|YP_001770610.1| peptidase M23B [Methylobacterium sp. 4-46]
 gi|168196229|gb|ACA18176.1| peptidase M23B [Methylobacterium sp. 4-46]
          Length = 676

 Score =  509 bits (1310), Expect = e-142,   Method: Composition-based stats.
 Identities = 175/647 (27%), Positives = 284/647 (43%), Gaps = 23/647 (3%)

Query: 15  SFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIAIP 74
             G  PP+           +RR V+LRWL+     G+    +IG ++  +L G    A  
Sbjct: 23  DPGHEPPLNLAGV-ASSQTDRRDVNLRWLTACVLTGMAGTGLIGSAIWISLQGEASFAQL 81

Query: 75  AKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKIPF 134
            + +   +           ++ ++     +       K     P  I+   ++IIK  PF
Sbjct: 82  PQAAAIAARPQP--SDGGSNAARKGDRLVRNPMVALAKQSFRAPVTIRAGEREIIKVRPF 139

Query: 135 AYARMTF-ATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVT---TQKIN 190
                   AT      D P FDP++ FSE   E + +       + D   V     +   
Sbjct: 140 VRIATALSATAGLAATDIPAFDPMRFFSEPGAERAPEPPPTEAPDADVSVVKRDLAEAAV 199

Query: 191 FPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNK-------KNQSFTLYYADPQTLDQRHD 243
            P      + D  AQ EE +        L                          +   D
Sbjct: 200 GPGAPALTEEDVEAQLEEERRLAAEAGRLAALPIAPQLMLSRALRGFPALPALDSEFGRD 259

Query: 244 HPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAK 303
                S +++++ EN T  +  +     P   +  + I+   T+   +     ++     
Sbjct: 260 SGPFKSIEVRVLRENVTDLAK-LEPRGTPLVEERDVTIRRGETLESVLRANAAADDQVRP 318

Query: 304 IAKALKNEVRVDQLTKDEILRIGV---VQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYV 360
           I  AL    R     + + +R+ V    +  D   I R  +Y ++      A+ND  ++V
Sbjct: 319 IVAALGGFARTASTGEGQQMRLLVGPGAKPGDPRQINRVILYGERGIEAIAAMNDRGQFV 378

Query: 361 LGVEPVKMDINHQMD-----YMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSV 415
               P +     +                 +Y  ++   + + +  ++V+ ++R     V
Sbjct: 379 SVTPPGQEGAPAKAVPAPGADEDEEGTGARLYASLYETAARHDLPRSMVEDLVRIFGYDV 438

Query: 416 NLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFN 475
           + Q  +   D LE  ++ +     +++  +LLY     G    R YRF +P DG+VEYF+
Sbjct: 439 DFQRRVGSGDNLELVYTYDEEGGGSAERPDLLYAALTVGGEARRVYRFQSPDDGTVEYFD 498

Query: 476 ENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVE 535
           + G+S + FL+R PV  G MTSGFG R HP+LGY+++HTGVDW+ P GTPIVA G+G V 
Sbjct: 499 DMGRSLKKFLIRKPVTDGNMTSGFGYRRHPVLGYAKLHTGVDWSVPIGTPIVAAGNGTVL 558

Query: 536 KANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHL 595
           KA W  GYG++  + H NGYV++YNH     + I AG  V+QGQ+IG++G+TGLSTG HL
Sbjct: 559 KAEWDSGYGRRVELQHANGYVTTYNHMSRFGRGIAAGGRVRQGQVIGYVGSTGLSTGAHL 618

Query: 596 HYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGE 642
           HYE+I+NG  VD  K+R+P    L G LL  F  ++ + + L+    
Sbjct: 619 HYEVIINGHFVDPMKIRVPRGRELDGRLLAEFRRQRDQTDGLIQKAS 665


>gi|218529150|ref|YP_002419966.1| peptidase M23 [Methylobacterium chloromethanicum CM4]
 gi|254559989|ref|YP_003067084.1| peptidase M23B [Methylobacterium extorquens DM4]
 gi|218521453|gb|ACK82038.1| Peptidase M23 [Methylobacterium chloromethanicum CM4]
 gi|254267267|emb|CAX23099.1| Peptidase M23B [Methylobacterium extorquens DM4]
          Length = 697

 Score =  508 bits (1309), Expect = e-142,   Method: Composition-based stats.
 Identities = 177/668 (26%), Positives = 295/668 (44%), Gaps = 37/668 (5%)

Query: 14  FSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIAI 73
              G  PP+         + +RR V+LRWL  +   GIT  +++G ++  +L G   +A 
Sbjct: 22  LPRGVEPPLNLLGADARQI-DRRDVNLRWLCASALTGITGALLMGAAIHVSLQGDASLAA 80

Query: 74  P---AKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIK 130
                 L  +   +        ++S  +     +       K     P  ++  +++IIK
Sbjct: 81  VSDRPNLGPRPQTQAPAIEEPGIASAHKGDRLVRNLMIASAKQSYRTPVTVRLGDREIIK 140

Query: 131 KIPFAYARMTFATPYPK-VKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVT---T 186
             PF       +        D P+FDP+K  S+   E +           +   V     
Sbjct: 141 VRPFVRISSNLSMSTGVFASDIPRFDPMKFVSDEPQERAPDPGAADAPGAEVTVVKRDLA 200

Query: 187 QKINFPTDITRIQLDHTAQDEEIKNAIMNQFF----------LLHNKKNQSFTLYY---- 232
           +    P        D TAQ EE +                  LL     Q          
Sbjct: 201 EIAVDPGAPALSDEDVTAQIEEERRLAAEAGRRTALPLAPQILLSRTLQQGSAFAGFGEG 260

Query: 233 ADPQTLDQRHDHPITYSKKIKIIEENRT-ITSPQVLIDKIPEFADDLIPIQHNTTIFDAM 291
           A         D     S ++ ++ EN T +   ++   + P   +  + ++   T+  A+
Sbjct: 261 AGQGKGKLGEDTSPFKSIEVLVVPENVTKLAKVELRPGEAPLVEERDLALKRGETLDGAL 320

Query: 292 VHAG-YSNGDSAKIAKALKNEVRVDQLTKDEILRIGVV---QKDDKFTIVRFSIYHKQKH 347
              G  S+   A I  AL  + +V  L++ +  R+      +  D   + R  ++ +   
Sbjct: 321 KATGQASDPAIAGIVTALGGKAKVAALSEGQQFRVQFAPGPKPGDGRQVTRVVLFGETGV 380

Query: 348 LLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSE---------ESPNIYDGIWRATSFNG 398
               A+ND+  +V    PV        +  +              P +Y  ++   + + 
Sbjct: 381 QAIAAINDHGAFVPVAPPVDETRGRNREQAQAETPDDDEEDEGSGPRLYQSLYETGARHD 440

Query: 399 MNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANN-QASDDSELLYIHARFGETR 457
           +    ++ I+R  +  ++ Q  +   D ++ F++ +      A++  ELLY     G   
Sbjct: 441 VPRPTIEDIIRIFSYDIDFQRRISSGDGIDLFYTYDEEAGPSAAERPELLYAALNLGGES 500

Query: 458 TRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVD 517
            + YRF +P DGS++Y +E G+S + FL+R P+  G M SGFG R HPILGY+++HTGVD
Sbjct: 501 RKVYRFQSPDDGSIDYLDEQGRSLKKFLIRKPIADGIMRSGFGYRRHPILGYAKLHTGVD 560

Query: 518 WAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQ 577
           WA P GTPIVA G+G V KA W  GYG++  + H NGYV++YNH    A+ + AG+ V+Q
Sbjct: 561 WANPIGTPIVAAGNGTVIKAEWDSGYGRRVEVQHINGYVTTYNHMSRFARGVSAGSRVRQ 620

Query: 578 GQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSL 637
           GQ+IG++G+TGLSTG HLHYE+I+NG  VD  K+R+P    L G LL  F  ++ +  + 
Sbjct: 621 GQVIGYVGSTGLSTGAHLHYEVIINGHFVDPMKIRVPRGRELDGRLLAEFKRQRDQTEAT 680

Query: 638 LNNGENPK 645
           +   +   
Sbjct: 681 MQKSKTAT 688


>gi|240137517|ref|YP_002961988.1| Peptidase M23B [Methylobacterium extorquens AM1]
 gi|240007485|gb|ACS38711.1| Peptidase M23B [Methylobacterium extorquens AM1]
          Length = 697

 Score =  508 bits (1308), Expect = e-141,   Method: Composition-based stats.
 Identities = 177/668 (26%), Positives = 295/668 (44%), Gaps = 37/668 (5%)

Query: 14  FSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIAI 73
              G  PP+         + +RR V+LRWL  +   GIT  +++G ++  +L G   +A 
Sbjct: 22  LPRGVEPPLNLLGADARQI-DRRDVNLRWLCASALTGITGALLMGAAIHVSLQGDASLAA 80

Query: 74  P---AKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIK 130
                 L  +   +        ++S  +     +       K     P  ++  +++IIK
Sbjct: 81  VSDRPNLGPRPQTQAPAIEEPGIASAHKGDRLVRNLMIASAKQSYRTPVTVRLGDREIIK 140

Query: 131 KIPFAYARMTFATPYPK-VKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVT---T 186
             PF       +        D P+FDP+K  S+   E +           +   V     
Sbjct: 141 VRPFVRISSNLSMSTGVFASDIPRFDPMKFVSDEPQERAPDPGAADAPGAEVTVVKRDLA 200

Query: 187 QKINFPTDITRIQLDHTAQDEEIKNAIMNQFF----------LLHNKKNQSFTLYY---- 232
           +    P        D TAQ EE +                  LL     Q          
Sbjct: 201 EIAVDPGAPALSDEDVTAQIEEERRLAAEAGRRTALPLAPQILLSRTLQQGSAFAGFGEG 260

Query: 233 ADPQTLDQRHDHPITYSKKIKIIEENRT-ITSPQVLIDKIPEFADDLIPIQHNTTIFDAM 291
           A         D     S ++ ++ EN T +   ++   + P   +  + ++   T+  A+
Sbjct: 261 AGQGKGKLGEDTSPFKSIEVLVVPENVTKLAKVELRPGEAPLVEERDLALKRGETLDGAL 320

Query: 292 VHAG-YSNGDSAKIAKALKNEVRVDQLTKDEILRIGVV---QKDDKFTIVRFSIYHKQKH 347
              G  S+   A I  AL  + +V  L++ +  R+      +  D   + R  ++ +   
Sbjct: 321 KATGQASDPAIAGIVAALGGKAKVAALSEGQQFRVQFAPGPKPGDGRQVTRVVLFGETGV 380

Query: 348 LLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSE---------ESPNIYDGIWRATSFNG 398
               A+ND+  +V    PV        +  +              P +Y  ++   + + 
Sbjct: 381 QAIAAINDHGAFVPVAPPVDETRGRNREQAQAETPDDDEEDEGSGPRLYQSLYETGARHD 440

Query: 399 MNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANN-QASDDSELLYIHARFGETR 457
           +    ++ I+R  +  ++ Q  +   D ++ F++ +      A++  ELLY     G   
Sbjct: 441 VPRPTIEDIIRIFSYDIDFQRRISSGDGIDLFYTYDEEAGPAAAERPELLYAALNLGGES 500

Query: 458 TRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVD 517
            + YRF +P DGS++Y +E G+S + FL+R P+  G M SGFG R HPILGY+++HTGVD
Sbjct: 501 RKVYRFQSPDDGSIDYLDEQGRSLKKFLIRKPIADGIMRSGFGYRRHPILGYAKLHTGVD 560

Query: 518 WAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQ 577
           WA P GTPIVA G+G V KA W  GYG++  + H NGYV++YNH    A+ + AG+ V+Q
Sbjct: 561 WANPIGTPIVAAGNGTVIKAEWDSGYGRRVEVQHINGYVTTYNHMSRFARGVSAGSRVRQ 620

Query: 578 GQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSL 637
           GQ+IG++G+TGLSTG HLHYE+I+NG  VD  K+R+P    L G LL  F  ++ +  + 
Sbjct: 621 GQVIGYVGSTGLSTGAHLHYEVIINGHFVDPMKIRVPRGRELDGRLLAEFKRQRDQTEAT 680

Query: 638 LNNGENPK 645
           +   +   
Sbjct: 681 MQKSKTAT 688


>gi|163850456|ref|YP_001638499.1| peptidase M23B [Methylobacterium extorquens PA1]
 gi|163662061|gb|ABY29428.1| peptidase M23B [Methylobacterium extorquens PA1]
          Length = 697

 Score =  505 bits (1300), Expect = e-140,   Method: Composition-based stats.
 Identities = 177/668 (26%), Positives = 295/668 (44%), Gaps = 37/668 (5%)

Query: 14  FSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIAI 73
              G  PP+         + +RR V+LRWL  +   GIT  +++G ++  +L G   +A 
Sbjct: 22  LPRGVEPPLNLLGADARQI-DRRDVNLRWLCASALTGITGALLMGAAIHVSLQGDASLAA 80

Query: 74  P---AKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIK 130
                 L  +   +        ++S  +     +       K     P  ++  +++IIK
Sbjct: 81  VSDRPNLGPRPQTQAPAIEEPGIASAHKGDRLVRNLMIASAKQSYRTPVTVRLGDREIIK 140

Query: 131 KIPFAYARMTFATPYPK-VKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVT---T 186
             PF       +        D P+FDP+K  S+   E +           +   V     
Sbjct: 141 VRPFVRISSNLSMSTGVFASDIPRFDPMKFVSDEPQERAPDPGAADAPGAEVTVVKRDLA 200

Query: 187 QKINFPTDITRIQLDHTAQDEEIKNAIMNQFF----------LLHNKKNQSFTLYY---- 232
           +    P        D TAQ EE +                  LL     Q          
Sbjct: 201 EIAVDPGATALSDEDVTAQIEEERRLAAEAGRRTALPLAPQILLSRTLQQGSAFAGFGEG 260

Query: 233 ADPQTLDQRHDHPITYSKKIKIIEENRT-ITSPQVLIDKIPEFADDLIPIQHNTTIFDAM 291
           A         D     S ++ ++ EN T +   ++   + P   +    ++ + T+  A+
Sbjct: 261 AGQGKGKLGEDTSPFKSIEVLVVPENVTKLAKVELRPGEAPLVEERDFALKRSETLDGAL 320

Query: 292 VHAG-YSNGDSAKIAKALKNEVRVDQLTKDEILRIGVV---QKDDKFTIVRFSIYHKQKH 347
              G  S+   A I  AL  + +V  L++ +  R+      +  D   + R  ++ +   
Sbjct: 321 KATGQASDPAIAGIVAALGGKAKVAALSEGQQFRVQFAPGPKPGDGRQVTRVVLFGETGV 380

Query: 348 LLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSE---------ESPNIYDGIWRATSFNG 398
               A+ND+  +V    PV        +  +              P +Y  ++   + + 
Sbjct: 381 QAIAAINDHGAFVPVAPPVDETRGRNREQAQAETPDDDEEDEGSGPRLYQSLYETGARHD 440

Query: 399 MNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANN-QASDDSELLYIHARFGETR 457
           +    ++ I+R  +  ++ Q  +   D ++ F++ +      A++  ELLY     G   
Sbjct: 441 VPRPTIEDIIRIFSYDIDFQRRISSGDGIDLFYTYDEEAGPSAAERPELLYAALNLGGES 500

Query: 458 TRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVD 517
            + YRF +P DGS++Y +E G+S + FL+R P+  G M SGFG R HPILGY+++HTGVD
Sbjct: 501 RKVYRFQSPDDGSIDYLDEQGRSLKKFLIRKPIADGIMRSGFGYRRHPILGYAKLHTGVD 560

Query: 518 WAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQ 577
           WA P GTPIVA G+G V KA W  GYG++  + H NGYV++YNH    A+ + AG+ V+Q
Sbjct: 561 WANPIGTPIVAAGNGTVIKAEWDSGYGRRVEVQHINGYVTTYNHMSRFARGVSAGSRVRQ 620

Query: 578 GQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSL 637
           GQ+IG++G+TGLSTG HLHYE+I+NG  VD  K+R+P    L G LL  F  ++ +  + 
Sbjct: 621 GQVIGYVGSTGLSTGAHLHYEVIINGHFVDPMKIRVPRGRELDGRLLAEFKRQRDQTEAT 680

Query: 638 LNNGENPK 645
           +   +   
Sbjct: 681 MQKSKTAT 688


>gi|319409228|emb|CBI82872.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 672

 Score =  495 bits (1274), Expect = e-138,   Method: Composition-based stats.
 Identities = 215/681 (31%), Positives = 345/681 (50%), Gaps = 51/681 (7%)

Query: 6   ISNKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTAL 65
           + + +      G    ++     K      R+VSLRWL  T   G+ S +++  +L TAL
Sbjct: 1   MWDNQYQKKDPGQEHALVV----KRLKPGLRQVSLRWLIGTILTGLASYILMAIALFTAL 56

Query: 66  DGHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSP-KTKSKHPEKIIIEVPTLIKDH 124
           +G Q++  P +  +  ++             +  R++P + +     K   E+  L    
Sbjct: 57  EGQQQLITPLQWFNVDADIPDF------DRNKSDRIAPTRVRQSFDSKRQFELSILQNKG 110

Query: 125 NKDIIKKIPFAYARMTFATPYPKVKDHPKFDPLKIFS-EGKIESSSQMLMDTIHNVD-SF 182
           +  II+   F + RM  A   P    +P+FD L +F+ + + +  + +    I+      
Sbjct: 111 DAKIIETQKFEWIRMALAEERPHQYTYPQFDALSMFTRDWEKQPPTPLGSGQIYGAKTQT 170

Query: 183 EVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRH 242
           ++T +  NF  +        T  D++ +  I N    +  K      L   +    +   
Sbjct: 171 KMTLRSRNFIVNEINFDGTDTFTDDKAQQEIQNAGLAVDTKNEFLSILTLGELLKANNLS 230

Query: 243 D-HPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHA--GYSNG 299
               ++ + +++I +EN T++S +  ID    + +D+IP+    TI + +      Y+  
Sbjct: 231 STLKLSDNPEVRITQENLTVSSQKNRIDFTKNYVEDIIPVHKKQTILEILQEFESDYNTE 290

Query: 300 DSAKIAKALKNEVRVDQLTKDEILRIGV-VQKDDKFTIVRFSIYHKQKHLLTIALNDNNE 358
              ++A+AL      D L ++ +LR+G+  Q  ++  IVR SIY K+ H+LT+ALND+N+
Sbjct: 291 QIEQVAQALATLNNSDFLKEESLLRLGIVTQHGEEDHIVRASIYRKKYHVLTVALNDDNQ 350

Query: 359 YVLGVEPVKMDINHQMDYM------RTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLA 412
           +V   EP    I               +   P +YD I+RA   + M+ ++ + ++R LA
Sbjct: 351 FVESTEPEMSPILQTAFQNGLSHSLINAGRLPTVYDAIYRAVLSHDMSPSVSQRLIRLLA 410

Query: 413 SSVNLQEHLKPTDFLETFFSVNHANNQASD---------------------------DSE 445
           ++++++  + PTD LE F++V   N+   D                           D E
Sbjct: 411 TNIDMKSRITPTDQLEIFYAVPKENSNEKDKKSTQSEQQSQNTQETPINQESPINNVDPE 470

Query: 446 LLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHP 505
           + YI A FG    ++YR+ +    SV+Y++  GKSS+PFLLR P P G   S FG R HP
Sbjct: 471 IRYISATFGNVTYKYYRYQSKDG-SVDYYDSEGKSSKPFLLRKPTPNGTFGSPFGPRKHP 529

Query: 506 ILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAI 565
           ILGY RMHTGVDW AP+G+PI+AVGDG+V K   A GYG   +I H NGYVSSY HQ+  
Sbjct: 530 ILGYVRMHTGVDWIAPKGSPIIAVGDGVVTKVGVANGYGNHVVIRHANGYVSSYAHQNNH 589

Query: 566 AKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQ 625
           A  IK G  V+QGQ+IG++G+TGL+TGPH H+E+IVNG KVD  ++RIP  + L    LQ
Sbjct: 590 APGIKPGVKVRQGQVIGYVGSTGLATGPHCHFEIIVNGTKVDPMRIRIPNSKELLNQDLQ 649

Query: 626 RFAMEKKRINSLLNNGENPKK 646
            F  EK+ I+SL+N+      
Sbjct: 650 TFLREKRNIDSLINSTTKSTN 670


>gi|170748808|ref|YP_001755068.1| peptidase M23 [Methylobacterium radiotolerans JCM 2831]
 gi|170655330|gb|ACB24385.1| Peptidase M23 [Methylobacterium radiotolerans JCM 2831]
          Length = 674

 Score =  480 bits (1234), Expect = e-133,   Method: Composition-based stats.
 Identities = 171/656 (26%), Positives = 301/656 (45%), Gaps = 38/656 (5%)

Query: 17  GDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIAIPAK 76
           G  P +         + +RR V+LRWL  +   G+T   +I  +L  +L G    A   +
Sbjct: 20  GHEP-LDHLGATATQI-DRRAVNLRWLCASSLTGLTGAGLIAAALHVSLQGDVSFAAIPE 77

Query: 77  LSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKIPFAY 136
            +            A ++  ++     +       K   + P  ++  +++IIK   F  
Sbjct: 78  KATIMPRPQPSESGANIA--RKGDRLVRNLMIASAKQSFKAPVTVRLGDREIIKAKAFVR 135

Query: 137 ARMTFATPYPK-VKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVTTQKINFPTDI 195
                +        + P+FDP+K  S+  +E +     D      S EVT  K +   D 
Sbjct: 136 LTTPLSMTTGVYASEPPRFDPMKFVSDEPLERAPDASAD----APSAEVTVVKRDL-ADA 190

Query: 196 TRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSF---------TLYYADPQTLDQRHDHP- 245
                     D+++   +  +  +      ++          +       T D     P 
Sbjct: 191 AVDANAPALTDDDVTAQVEEERRIAAEAGRRAAIPIAPQIMLSRTLQQGATGDGDGAAPK 250

Query: 246 ---ITYSKKIKIIEENRTITSP-QVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDS 301
                 S ++ ++ EN T  +  ++  ++ P   +  + ++   T+   +   G+++ D+
Sbjct: 251 EANPFKSIEVLVVPENVTKVAKIELKANEAPLVEERDLALKRGETVETTLKATGFASDDA 310

Query: 302 AK-IAKALKNEVRVDQLTKDEILRIGVVQ---KDDKFTIVRFSIYHKQKHLLTIALNDNN 357
            + I  AL  + R   L++ + +R+ +       D   + R  +Y +       ALND  
Sbjct: 311 VRGIVAALGGKTRTAALSEGQPMRVQIAPGPRPGDPRQVTRVVLYGENGIEGIAALNDRG 370

Query: 358 EYVLGVEPVK--------MDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMR 409
            +V    P +               D    S   P +Y  ++   + + +    V+ I+R
Sbjct: 371 AFVSVAPPAEEVPSPKAQPQAEAGEDEDEDSGSGPRLYQSLYETAARHDLPRATVEDIVR 430

Query: 410 TLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDG 469
             +  ++ Q  +   D L+ F+S    ++ ++D  +LLY     G    R YRF +P DG
Sbjct: 431 VFSYDLDFQRRISSGDGLDVFYST--DDDASADRPDLLYAALTLGGETRRVYRFQSPDDG 488

Query: 470 SVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAV 529
           +++Y +E G+S + FLLR P+  G M SGFG R HP+LGY+++HTGVDW+ P GTPI+A 
Sbjct: 489 TIDYLDEQGRSLKKFLLRKPIADGIMRSGFGYRRHPVLGYAKLHTGVDWSNPIGTPIMAA 548

Query: 530 GDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGL 589
           G+G+V +A    GYG +  I H NGYV++YNH     + I+ G  V+QGQI+G++G+TGL
Sbjct: 549 GNGVVIRAEMTSGYGNRVEIQHVNGYVTTYNHMSRFGRGIREGVKVRQGQIVGYVGSTGL 608

Query: 590 STGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPK 645
           STG HLHYE+I+NG  VD  K+R+P    L G LL  F  ++++I++ +   ++  
Sbjct: 609 STGAHLHYEVIINGHFVDPMKIRVPRGRELDGRLLADFKRQREQIDATMQKSKSAT 664


>gi|304394121|ref|ZP_07376044.1| peptidase M23 [Ahrensia sp. R2A130]
 gi|303293561|gb|EFL87938.1| peptidase M23 [Ahrensia sp. R2A130]
          Length = 626

 Score =  462 bits (1188), Expect = e-127,   Method: Composition-based stats.
 Identities = 190/633 (30%), Positives = 320/633 (50%), Gaps = 33/633 (5%)

Query: 43  LSTTFFAGITSGVIIGGSLLTALDGHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLS 102
           ++ +   G+TS +++GG+L  ALDG Q +A PA      + + A++ + +        L+
Sbjct: 1   MAGSILTGVTSILLMGGALHAALDGRQSLARPAS--STPTGDLALDKAGEKGDRPARLLA 58

Query: 103 PKTKSKHPEKIIIEVPTLIKDHNKDIIKKIPFAYARMTFATPYPKVKDHPKFDPLKIFSE 162
                K   + I++VPT+ +D N+++I+K PFAYA    A     + ++P+F+PL +F  
Sbjct: 59  L----KPLNEKILQVPTVTRDGNRNVIRKRPFAYAEAPLAIEAADIGEYPRFNPLTVFRA 114

Query: 163 GKIESSSQMLMDTIHNVDSFEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHN 222
             ++                EV  + + FP             D E + ++      + +
Sbjct: 115 SGVDKQVASSDVIYGADVESEVALETVAFPYTPNLYARTTVITDREAELSVRESLDSMKD 174

Query: 223 KKNQSFTLYYADPQTLDQRH-DHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPI 281
            +     L Y D      +  D     +  I+I+ EN + ++ Q   +    F + ++  
Sbjct: 175 GEVMVTALAYLDTDRFALKDTDIAPPSALDIRIVAENVS-SAAQDDANAGRNFVERVVVK 233

Query: 282 QHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIV---- 337
           + + TI  A+           ++   L+  V +  +   + L++ +  +           
Sbjct: 234 ESDQTIEAALNGLRLKPAVLERLLTPLE--VDLGDVATSDRLKLRIAWERMPVETASLPG 291

Query: 338 -----------RFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYM-------RT 379
                      R S+Y +  HL++ A++D +  V    P  +      D +         
Sbjct: 292 VQLARPTREARRISVYRRGTHLVSFAIDDADRVVRAEAPADIPATAADDVIPENDVRTVA 351

Query: 380 SEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQ 439
           + + P++YDG++RA    G+N++  + I+RT+A  V+ ++   P D LE F+S++    +
Sbjct: 352 NAKLPSLYDGLYRAAMSQGLNADQARRIVRTVAFDVDFRQKASPDDNLEIFYSLDEGETE 411

Query: 440 ASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPF-GRMTSG 498
           AS++SE+L+I         R+YRF    DG V YF+ENGKSS+ FLLR PVP   R+ S 
Sbjct: 412 ASENSEILFIGLTVKGRTNRYYRFKTGEDGQVGYFDENGKSSKKFLLRNPVPNATRIGSR 471

Query: 499 FGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSS 558
           FG R HPI    +MH GVD+ APRGT I+A G+G++ K  W  GYG++T I H NGY ++
Sbjct: 472 FGPRRHPISRVVKMHNGVDFPAPRGTKIIAAGNGVITKIGWNSGYGRKTTIRHANGYETT 531

Query: 559 YNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPEREN 618
           Y+HQ    + +K GT V+ GQ+IG +G+TG STGPHLHYE+ VNG  V+  K+R+P+ + 
Sbjct: 532 YSHQHRFTRGMKVGTRVRLGQVIGQVGSTGYSTGPHLHYEVKVNGRFVNPMKIRLPQGKV 591

Query: 619 LKGDLLQRFAMEKKRINSLLNNGENPKKPLFTS 651
           LKG  L  F  E++RI++LL+ G N       +
Sbjct: 592 LKGLELAAFKQERERIDALLDRGRNGGTQTVAA 624


>gi|170746729|ref|YP_001752989.1| peptidase M23 [Methylobacterium radiotolerans JCM 2831]
 gi|170653251|gb|ACB22306.1| Peptidase M23 [Methylobacterium radiotolerans JCM 2831]
          Length = 656

 Score =  452 bits (1162), Expect = e-124,   Method: Composition-based stats.
 Identities = 157/638 (24%), Positives = 273/638 (42%), Gaps = 33/638 (5%)

Query: 24  GNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIAIPAKLSHQTSE 83
                     +RR+++ RWL  +         ++G +L  ++D   + A P        +
Sbjct: 25  APPADGATPLDRRRLNRRWLCASSLIATCGAALMGAALRMSVDTDLRPAPP-----TFRK 79

Query: 84  ENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKIPFAYARMTFAT 143
             A     +  + +R     + +    ++     P   +   ++II+  PF     + ++
Sbjct: 80  GPAQVAEGQGVAGRRGDRLVRHQLVASDREEFSAPVAHQVGAREIIRTQPFVRLVSSLSS 139

Query: 144 PYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVTTQKINFPTDITRIQLDHT 203
                   P FDP +  +E    ++     +   +     VT  + +     T +  D  
Sbjct: 140 GDEVDGQIPPFDPTRQLAEDGQVAAVSDEPED--DPSGTMVTITRSDLAG--TPVPDDAP 195

Query: 204 AQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDH----------------PIT 247
              +E   A++     +  +      + +A  + L Q  D                    
Sbjct: 196 GLSDEDVTALVETRAQVTREAGSRIAVPFAPQRQLSQILDAAPDDASAKAAGADAGHDPF 255

Query: 248 YSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKA 307
           ++ +++++ EN T  +       +       + ++   T+ D +   G        I  A
Sbjct: 256 HAIEVRVVPENITDLAETEAASGLSLTETRDVVLKRGETLADTLAANGAEPARVKAILAA 315

Query: 308 LKNEVRVDQLTKDEILRIGVVQK---DDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVE 364
             +  R   L++ + + + +++         I R ++Y        +A  D+  +V    
Sbjct: 316 FSDHAR-TGLSEGQHVDLLLIRSRAGQSARQISRVTLYGAGGVEEIVAERDSGGFVTVAP 374

Query: 365 PVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPT 424
           P       +            +Y  I+ A   NG+   L + I+   A  +++Q  + P+
Sbjct: 375 PSAQFAAARTGD-DGDGSGATLYRSIYEAVLRNGLPGILAERIVGIFAFGLDMQHRVNPS 433

Query: 425 DFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPF 484
           D LE  FS +          E+ Y+       + R YRF  P  G+  YF+E G S R F
Sbjct: 434 DRLEVLFSPSEKAG---GPPEVRYVALTLDGVKHRAYRFEAPEAGAASYFSETGSSLRKF 490

Query: 485 LLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYG 544
           L+R P+  GR+TS FG R HPIL Y+R H GVDWA   GTPI+A GDG V  A   GGYG
Sbjct: 491 LMRMPIAEGRITSPFGTRVHPILHYARFHNGVDWANKAGTPIMATGDGTVAYAGPRGGYG 550

Query: 545 KQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGI 604
            +  IHH NGYV++YNH   +A  ++AG AV QGQ+I ++G+TGLSTGPH+HYE+ VNG 
Sbjct: 551 NRVEIHHANGYVTAYNHLQRLAHGVQAGAAVHQGQVIAYMGSTGLSTGPHVHYEVSVNGH 610

Query: 605 KVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGE 642
            +D   +R+P+ + +   L+  F  +    N+L ++G 
Sbjct: 611 FLDPMAIRLPDSQGVSAKLMTAFERQVAATNTLRHHGA 648


>gi|220924440|ref|YP_002499742.1| peptidase M23 [Methylobacterium nodulans ORS 2060]
 gi|219949047|gb|ACL59439.1| Peptidase M23 [Methylobacterium nodulans ORS 2060]
          Length = 615

 Score =  434 bits (1115), Expect = e-119,   Method: Composition-based stats.
 Identities = 167/612 (27%), Positives = 265/612 (43%), Gaps = 33/612 (5%)

Query: 37  KVSLRWLSTTFFAGITSGVIIGGSL-LTALDGHQKIAIPAKLSHQTSEENAINLSAKLSS 95
           +V+LRWL+     G     ++G +L L A +G   +A+P +L+ +   +   +  A+   
Sbjct: 21  RVNLRWLAACLLTGFAGAGLLGVALDLAASNG--IVAVPPELAVRPHPDGPTSDVAR--- 75

Query: 96  MQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKIPFAYARMTFATPYPKVKDHPKFD 155
             +     + +     K     P       +++I+               P     P FD
Sbjct: 76  --KGDRLVRDEVVVAAKREFRAPITESAGERELIRVHSVVQIATDLPLRAPGT-PIPPFD 132

Query: 156 PLKIFSEGKIESSSQMLMDTIHNVDSFEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMN 215
           P++     +IE+++          D  E     +      +  +      DEE+   +  
Sbjct: 133 PMR---SARIEAAAVEEA----GTDPAETAVTLVRSRLAESSDEQGPALTDEEVDALVAE 185

Query: 216 QFFLLHNKKNQSFTLYY------ADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLID 269
              +                   A             + + ++KI+ EN T     +   
Sbjct: 186 TQRIAGGSGPLPPAFPPERMLSRALRLGAGSEEVEAPSGAIEVKILPENLTEIPEILAAP 245

Query: 270 KIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQ 329
             P F      +  + T+   +   G      A I  AL    R D L + + LR+ + +
Sbjct: 246 AAPLFETREAVLGKDQTLDALLRENGAPPQRVAAILAALSPHARTD-LPEGQHLRLLIAR 304

Query: 330 KDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDG 389
           +  +  I R ++Y +       A ND   +V    P       +           ++Y+ 
Sbjct: 305 EGAEAGIARVTLYGESGIEEIAAANDRGAFVSVAPPRSGAAAAEDAEGGV-----SLYES 359

Query: 390 IWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYI 449
           ++ A   NG+   +++ ++  LA+  +LQ   +P D +E  F+ +          ELLY 
Sbjct: 360 LYGAGLKNGVPRTVIEDLVMALAAGSDLQSRTEPGDHIEIVFTTDED-----ARPELLYA 414

Query: 450 HARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGY 509
             R        YRF  P  G VEY    G+S+R FL+R PV  GR++S FG R HPILGY
Sbjct: 415 ALRSHGETQTLYRFRMPGSGEVEYLGAEGRSTRKFLIRRPVAEGRISSPFGARLHPILGY 474

Query: 510 SRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNI 569
            R H GVDWAA RGTPI+A GDG+V  A    GYG +  I H N YV++YNH   IA+ I
Sbjct: 475 YRPHNGVDWAATRGTPIMATGDGVVISAGARSGYGNRVEIQHANNYVTAYNHMARIARGI 534

Query: 570 KAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAM 629
             G  V+ GQ+IG +GTTGLSTGPH+HYE+ +NG  VD  K+R+P    L G  L  F  
Sbjct: 535 VPGARVRLGQVIGAVGTTGLSTGPHVHYEVAINGRFVDPMKIRLPSARELTGPALAAFRA 594

Query: 630 EKKRINSLLNNG 641
            +++I++L  + 
Sbjct: 595 VEEQIDALRQHR 606


>gi|312114906|ref|YP_004012502.1| peptidase M23 [Rhodomicrobium vannielii ATCC 17100]
 gi|311220035|gb|ADP71403.1| Peptidase M23 [Rhodomicrobium vannielii ATCC 17100]
          Length = 666

 Score =  426 bits (1095), Expect = e-117,   Method: Composition-based stats.
 Identities = 146/633 (23%), Positives = 255/633 (40%), Gaps = 32/633 (5%)

Query: 30  IFLDNRRKVS-LRWLSTTFFAGITSGVIIGGSLLTALD------GHQKIAIPAKLSHQTS 82
             L  RR V+ L+W  +T    I+   IIG  + T+++      G        +      
Sbjct: 44  SELGPRRVVTQLKWFISTIIVAISGLAIIGVVIYTSMNVGEGNAGRGMFGAFQRAGVDAM 103

Query: 83  EENAIN----LSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKIPFAYAR 138
              A N           ++  RL   +K      +I E   + +    + +   P+    
Sbjct: 104 RPRAANLVGAEKPIAIGLKTDRLVLSSKGLTTRNLIYE-QVVQRRGTGEYLSTKPYVKLV 162

Query: 139 MTFATPYPKVK-DHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVTTQKINFPTDITR 197
            T AT  P    D P F+P  ++      +        +       V+ + I+ P     
Sbjct: 163 ATLATEKPDEDVDIPAFNPATLYENNTPIARKDQSGGELSTDP--RVSVRFIDVPGGFLP 220

Query: 198 IQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEE 257
            +      D+EI+  +     +    +     +   D + L                   
Sbjct: 221 REDHVELSDDEIERLVAETDAVYTESEVGLEGVAPQDTKRLAGSDMAFAAPEPHT----- 275

Query: 258 NRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQL 317
              +   +        +    I  +   ++   +   G     +  ++ A+    +  +L
Sbjct: 276 TVLVKRMEEEESTDEGYDRRSIIAKGYESLDSVIRGVGVDPMQAGLVSAAVAAITKTRKL 335

Query: 318 TKDEILRIGVVQKDDKFTIVRF----SIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQ 373
              E +R+G+     +   V       +Y      +TI  +    Y     P +  +  +
Sbjct: 336 RAGEEVRLGLTPSASEEGGVDVGKITVVYQGTN--VTIVRDGEGGY----APSEKHLKPE 389

Query: 374 MDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSV 433
                T  +   +Y   +RA     +  + +   ++  +  V+ ++ +K  D  E F+ +
Sbjct: 390 HKADDTVGDRATVYLSAYRAAQSQEIPYDFLMKFVKVHSYDVDFKQRVKSGDGFELFYDL 449

Query: 434 NHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFG 493
               N      EL Y     G     +YRF +     V+YF++ G +S+ FL+RTP+   
Sbjct: 450 VQDENGVERPGELFYAAVTIGGETHGYYRFRSNEG--VDYFDDRGSNSKKFLMRTPIRGA 507

Query: 494 RMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGN 553
           R+TSGFG R HP+L   R+H+GVDWA P GTPI A G+G++E A   G YG    I H N
Sbjct: 508 RLTSGFGWRKHPLLHTLRLHSGVDWAGPIGTPIYAAGNGVIETAERNGNYGNYVRIRHAN 567

Query: 554 GYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRI 613
           GY ++Y H    A+ +  G  V+QGQ+IG++G TG+STGPHLHYE+++N    +   ++I
Sbjct: 568 GYKTAYAHMLRFAQGVATGVKVRQGQVIGYLGNTGMSTGPHLHYEVLINSRFTNPLSIKI 627

Query: 614 PERENLKGDLLQRFAMEKKRINSLLNNGENPKK 646
           P+   L+G LL  F  E+ RI+ L+       +
Sbjct: 628 PKARQLQGRLLADFRKERARIDDLMRRPPVKTR 660


>gi|13472961|ref|NP_104528.1| hypothetical protein mlr3423 [Mesorhizobium loti MAFF303099]
 gi|14023708|dbj|BAB50314.1| mlr3423 [Mesorhizobium loti MAFF303099]
          Length = 476

 Score =  418 bits (1074), Expect = e-114,   Method: Composition-based stats.
 Identities = 197/464 (42%), Positives = 278/464 (59%), Gaps = 6/464 (1%)

Query: 184 VTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHD 243
           ++ + ++FP +            +E++  +      L +   Q  +L+Y DPQ   +   
Sbjct: 1   MSLKTVDFPIETASFDEKSDLSADEVEKVVREAGTDLSDGAVQVASLHYVDPQRFGEAFA 60

Query: 244 HPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAK 303
             +  S  +KI+ EN +++      D+ P FA+++IP   +T + +A   +GY+  D+  
Sbjct: 61  ESMAGSYDVKIVPENVSVSPRAATDDQAPAFAEEIIPFTKDTDLTEAFADSGYTGDDATG 120

Query: 304 IAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGV 363
           +A+A+   +    L    +LR+G+    D   +VR S+Y K  H++TIAL+D  +YV   
Sbjct: 121 MAEAIAKLLNAPTLKAGTVLRVGLEVHGDAAKVVRTSVYDKTTHIVTIALDDRGQYVPAQ 180

Query: 364 EPVKMDINHQMDY-----MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQ 418
           EP                +      PN+YDGI+RA    GM+  + + +++ LAS V+ Q
Sbjct: 181 EPEPNPELLTAFDDSSAPVVVRGNLPNVYDGIYRAAYSYGMSKKMTQRLIKLLASGVDFQ 240

Query: 419 EHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENG 478
             L P+D LE  FS    ++Q SDDSELLY+ A FG T   FYRF      S +YF+E+G
Sbjct: 241 SRLNPSDRLEVLFSQPDGDDQTSDDSELLYVSATFGGTTRNFYRFQMQDG-STDYFDEDG 299

Query: 479 KSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKAN 538
            S++ FLLR P+P GR TSGFG R HPILGY RMHTG DWAAP G+PI+A G+G+VEKA 
Sbjct: 300 SSAQQFLLRNPLPNGRFTSGFGARKHPILGYVRMHTGTDWAAPIGSPIIAAGNGVVEKAG 359

Query: 539 WAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYE 598
           WAGGYGKQ ++ H NGY +SYNHQ A AK I  G  V+QGQ+IG++G TGLSTGPHLHYE
Sbjct: 360 WAGGYGKQIILRHANGYETSYNHQSAFAKGIAPGIRVRQGQVIGYLGQTGLSTGPHLHYE 419

Query: 599 LIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGE 642
           LIVNG KVDS +VR+P  + LKGD L  F  E++RI+ LL   +
Sbjct: 420 LIVNGTKVDSMRVRLPVGKVLKGDDLVAFKRERERIDDLLKQED 463


>gi|170741233|ref|YP_001769888.1| peptidase M23B [Methylobacterium sp. 4-46]
 gi|168195507|gb|ACA17454.1| peptidase M23B [Methylobacterium sp. 4-46]
          Length = 621

 Score =  404 bits (1038), Expect = e-110,   Method: Composition-based stats.
 Identities = 171/615 (27%), Positives = 260/615 (42%), Gaps = 34/615 (5%)

Query: 37  KVSLRWLSTTFFAGITSGVIIGGSLLTA-LDGHQKIAIPAKLS----HQTSEENAINLSA 91
           KVSLRWL+     GI    ++G +L  A  DG   +A+P  L+     +         + 
Sbjct: 21  KVSLRWLAACLLTGIAGAALLGLALDLAASDG--IVAVPPDLALHPRAEAGAPGEAGTAP 78

Query: 92  KLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKIPFAYARMTFATPYPKVKDH 151
              + ++     + +     K     P       +++I+           +   P+    
Sbjct: 79  AEFAARKGDRLVRDEVVVAAKREFRAPLSETVGEREVIRVHQVVQVATDLSLRAPEA-PI 137

Query: 152 PKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVTTQKINFPTDITRIQLDHTAQDEEIKN 211
           P FDP++         +    +      D  E     +  P             DEE+  
Sbjct: 138 PPFDPMR--------GAGSEAVTEETGSDPAETAVTLVRSPLAEAPETEAPALSDEEVDA 189

Query: 212 AIMNQFFLLHNKKNQSFT------LYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQ 265
            +     L                L  A      +  D     +  +KI+ EN T  +  
Sbjct: 190 LVAETQRLAGGPGPLPPAFPPERMLSRALRLGAGREEDEAPAGAIDVKILPENLTEIAET 249

Query: 266 VLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRI 325
                 P F      I  +  +   +   G      A I  AL    R D+L + + LR+
Sbjct: 250 AAAAAGPLFETREAVIGKDQALAAILRENGAGPDRVAAILAALSPRAR-DELPEGQHLRL 308

Query: 326 GVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPN 385
            + ++     I R ++Y +       A ND   +V       +            E   +
Sbjct: 309 LIAREGPTPGIARVTLYGEDGIEEIAAANDRGGFV------SVAPPRPGAPAAEEEGGVS 362

Query: 386 IYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSE 445
           +Y+ ++ A   NG+   +++ ++R LAS  +LQ    P D +E  F+ +          E
Sbjct: 363 LYESLYGAALKNGVPPGVIEDLVRVLASGSDLQSRTGPGDHVELLFTADED-----SKPE 417

Query: 446 LLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHP 505
           LL+   R        YRF  P  G VEY +  G+S+R FL+R PV  GR++S +G R HP
Sbjct: 418 LLFAALRSRGETQSLYRFRGPGTGEVEYLDAEGRSTRKFLIRRPVAEGRISSPYGARLHP 477

Query: 506 ILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAI 565
           ILGY RMH GVDWAA RGTPI+A GDG+V  A    GYG +  I H N YV++YNH   I
Sbjct: 478 ILGYYRMHNGVDWAATRGTPIMATGDGVVIAAGARSGYGNRVEIQHANNYVTAYNHMARI 537

Query: 566 AKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQ 625
           A+ I  G  V  GQ+IG +GTTGLSTGPH+HYE+ +NG  VD  K+R+P    L G  L 
Sbjct: 538 ARGIVPGARVHLGQVIGSVGTTGLSTGPHVHYEVAINGRFVDPMKIRLPSAHALTGPALA 597

Query: 626 RFAMEKKRINSLLNN 640
            F   +++++ L + 
Sbjct: 598 AFRAVEEQVDGLRHR 612


>gi|300025039|ref|YP_003757650.1| peptidase M23 [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526860|gb|ADJ25329.1| Peptidase M23 [Hyphomicrobium denitrificans ATCC 51888]
          Length = 675

 Score =  397 bits (1019), Expect = e-108,   Method: Composition-based stats.
 Identities = 152/662 (22%), Positives = 285/662 (43%), Gaps = 57/662 (8%)

Query: 28  AKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLT-------------ALDGHQKIAIP 74
            +   + R     RW+ +T  A     + I   +               +L    + A+ 
Sbjct: 33  EQENPEPRAGGRFRWILSTCLAATIGAIAILVVVYGSSDSDMSSDGLLPSLRSIGEGALA 92

Query: 75  AKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKIPF 134
            +L+         N       + +A     T      + II   T  +  +++ +++ P+
Sbjct: 93  PQLALTPK-----NAGGLKWIIPKADRLQLTTGALSTRYIIHESTKSRRDSREYVRQKPY 147

Query: 135 AYARMTFA-TPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTI-HNVDSFEVTTQKINFP 192
           A      A  P  +    P F+P K++  GK   + +   ++        +V+ + +   
Sbjct: 148 ARIVARLAPVPTNENGVIPAFNPFKLYGSGKPADTDEDADESAGSGSSRADVSVKVVELL 207

Query: 193 TDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKI 252
             I   +       +E+++ +         +     +   AD + LD         ++ +
Sbjct: 208 GGILPGEDGQELDAQEVQDIV--------ERSVDGTSHAGADGEPLDGVSGSTSAAAQSM 259

Query: 253 KIIE----ENRTITSPQVLIDKIPEFADDL---------IPIQHN--TTIFDAMVHAGYS 297
                    + + +     I K P+ AD+          I ++     T+   +  AG  
Sbjct: 260 ASNPWQPAASTSDSLNTTDIYKSPDAADESSDDIEGGEVIVVKVGAKDTLAKILAKAGAP 319

Query: 298 NGDSAKIAKALKNEVRVDQLTKDEILRIGVVQK---DDKFTIVRFSIYHKQ-KHLLTIAL 353
             D   + +A  +    + L   + +RI +V      +K    RFSI+     HL+T++ 
Sbjct: 320 EWDVHSMIEAGHSIFPENALVSGQEVRITLVPSLSDPNKKEPARFSIFSDGHDHLVTVSR 379

Query: 354 NDNNEYV-LGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLA 412
           +   E++     P   ++           ++ ++Y  ++ A    G+  + +  I+R  A
Sbjct: 380 SAAGEFIGSAQPPFDAELAQLAKSDGGDPQNASLYAAVYNAGLTQGLPQDTISQILRINA 439

Query: 413 SSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVE 472
              + +  + P D LE FF +    +   +  ELLY     G +  +FYRF +     ++
Sbjct: 440 FDTDFRRRVHPGDALEMFFDMKDDQSTEGNPGELLYTAISSGGSLYKFYRFRSADGV-ID 498

Query: 473 YFNENGKSSRPFLLRTPVPFGRMT--SGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVG 530
           +++ +G +S+ FL+R PV    +   SGFG+R+HP+L   +MHTGVDWA   GTPI+A G
Sbjct: 499 FYDADGNNSKKFLMRKPVRGDEVRLTSGFGVRFHPLLNSRKMHTGVDWACSPGTPIIAAG 558

Query: 531 DGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLS 590
           +G +E+    G YG    I H NGY ++Y H    A ++  G  V+QGQ+IG++G+TGLS
Sbjct: 559 NGTIEEVGRKGYYGNYIRIRHANGYQTAYGHMSRFA-DVHPGMKVRQGQVIGFVGSTGLS 617

Query: 591 TGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFT 650
           +GPH+H+E++VN   VD   +++P    L+G  L  F  E+ RI  L++       P+ T
Sbjct: 618 SGPHVHFEVLVNSRFVDPMSIQVPRERKLEGKDLAEFEKERARIEELMHRA-----PVMT 672

Query: 651 SH 652
           ++
Sbjct: 673 AN 674


>gi|254456314|ref|ZP_05069743.1| M23/M37 peptidase [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083316|gb|EDZ60742.1| M23/M37 peptidase [Candidatus Pelagibacter sp. HTCC7211]
          Length = 430

 Score =  384 bits (985), Expect = e-104,   Method: Composition-based stats.
 Identities = 108/367 (29%), Positives = 190/367 (51%), Gaps = 11/367 (2%)

Query: 272 PEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKD 331
           P +      I+   T    +     +  +  +I ++L  +V +++L  ++ ++I + Q +
Sbjct: 65  PRYKKYNHKIKSGETFDKILKEYSINKKEIIEIKESLLKKVNINKLNTNQKIQIVIDQTN 124

Query: 332 DKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIW 391
           +K     F I + +K  L+   N   ++   +  +K+D                I   ++
Sbjct: 125 NKIKEFIFQISNTEKIYLSRD-NVGTKFNQKILTLKLDKKVIFKE-------NTILQSLY 176

Query: 392 RATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVN-HANNQASDDSELLYIH 450
           +A +   +  N +    R     V+ Q  ++  D  +  + V    N +  +  E+++ +
Sbjct: 177 KAATDQNIPPNTIIEFARIYGFQVDFQRDIRKEDKFQIIYEVFVDKNKKVIETGEIIFAN 236

Query: 451 ARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYS 510
            +        Y F    +  + ++++NGKS +  L++TP+   R++S FG+R HPI G++
Sbjct: 237 LKLSGQDNSLYYF--DKEDVMGHYDKNGKSVQKALMKTPINGARLSSSFGLRKHPIDGFT 294

Query: 511 RMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIK 570
           +MH G D+AAP+GTPI+A G+GI++K  W GG G    I H + Y + Y H    A+ +K
Sbjct: 295 KMHRGTDFAAPKGTPIMASGNGIIKKVGWCGGGGNCIKIRHNSTYETVYAHMSKFARGMK 354

Query: 571 AGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAME 630
            G  VKQGQ IG++G+TG STGPHLHYE+IVNG KV+S  +++P  + LKG   Q F   
Sbjct: 355 TGVRVKQGQTIGFVGSTGKSTGPHLHYEVIVNGKKVNSQTLKLPSGKILKGKNRQLFETN 414

Query: 631 KKRINSL 637
           K +I+ L
Sbjct: 415 KIKIDVL 421


>gi|91762343|ref|ZP_01264308.1| M23/M37 peptidase [Candidatus Pelagibacter ubique HTCC1002]
 gi|91718145|gb|EAS84795.1| M23/M37 peptidase [Candidatus Pelagibacter ubique HTCC1002]
          Length = 432

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 109/368 (29%), Positives = 183/368 (49%), Gaps = 12/368 (3%)

Query: 272 PEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKD 331
           P + +    I    T    + +    N +  +I K L ++  ++ L  +  ++I + Q +
Sbjct: 68  PRYKNIDHKISSGETFDKILNNYSIPNEEINQIKKKLNSDYDINNLQPNLEIKITIDQSN 127

Query: 332 DKFTIVRFSIYHKQKHLLTIALN-DNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGI 390
           +K  I  F     +   + +  N DNN +   +    ++                I   +
Sbjct: 128 NK-KITSFLFPVSRTEKIQLTRNLDNNLFEKKIIITNLNKKIVFKE-------GKITQSL 179

Query: 391 WRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSV-NHANNQASDDSELLYI 449
           ++      +  NL+    R     V+ Q  ++  D  +  + V    + +  +   +++ 
Sbjct: 180 YKTAIDLNVQPNLIIEFARIYGFQVDFQRDIRKNDNFQIMYEVFEDDDGKIFETGNIIFA 239

Query: 450 HARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGY 509
             +        Y F      S  +++ENGKS    L++TP+   R++S FGMR HPI G+
Sbjct: 240 DLKLSGKNNALYYFEKKG--SEGHYDENGKSVEKALMKTPINGARLSSAFGMRKHPIDGF 297

Query: 510 SRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNI 569
           ++MH G D+AAP GTPI+A G G++ +A W GG G    I H + Y + Y H    A+ I
Sbjct: 298 NKMHRGTDFAAPMGTPIMASGSGLITRARWCGGGGNCIKIKHNSTYETIYAHMKNFARGI 357

Query: 570 KAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAM 629
           K G  VKQGQIIG++G+TG STGPHLHYE++VNG KV+S K+++P  + LKG   + F +
Sbjct: 358 KEGVRVKQGQIIGYVGSTGKSTGPHLHYEVVVNGKKVNSQKLKLPSGKTLKGKEREIFEV 417

Query: 630 EKKRINSL 637
           EK +++ L
Sbjct: 418 EKIKLDVL 425


>gi|261856720|ref|YP_003264003.1| peptidase M23 [Halothiobacillus neapolitanus c2]
 gi|261837189|gb|ACX96956.1| Peptidase M23 [Halothiobacillus neapolitanus c2]
          Length = 490

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 101/478 (21%), Positives = 175/478 (36%), Gaps = 20/478 (4%)

Query: 167 SSSQMLMDTIHNVDSFEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQ 226
           +    +   I  V S  +   KI+ PTD    Q    +  + I         +  +  N 
Sbjct: 17  APWIRVSALILGVGSLGMVIAKISIPTDPALDQRIDLSIADAIAPTPPEPDLVSQSTNNA 76

Query: 227 SFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTT 286
                     +L      P              T+          P      I ++   +
Sbjct: 77  PSAESPTSTASLFNEDPLPDPAL--------TLTLPQTPPDEPTEPAPVATTIKVKSGDS 128

Query: 287 IFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQK 346
           +       G +    + +         +  L   + L + +   +    ++  +      
Sbjct: 129 LSTIFSRLGLNYQTVSDVIAVGDQAAPLKNLRPGDQLNVELTPDN---QLLAINYQLAPN 185

Query: 347 HLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKL 406
             L+I  + N+++         D        R +     I   ++++   +G+++N+V  
Sbjct: 186 KTLSIRRDANDQF-------TADKIVLPMETRLTTAEGVIDSSLYQSAIESGLSANMVME 238

Query: 407 IMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNP 466
           +       +N  + ++  D     +   + N +  D   ++           +  R+  P
Sbjct: 239 LADIFGWKINFLKDVQNGDHFRIVYEEKYVNGKHVDTGAVVAAEFVNNGKTYQAVRYTAP 298

Query: 467 VDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTP 525
                 Y+  NG S     LR PV F R++S F M   HP+    R H GVD+AAP GTP
Sbjct: 299 NG-KTGYYEPNGASLARGFLRYPVAFSRISSKFNMHRMHPLYHKIRAHKGVDFAAPTGTP 357

Query: 526 IVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIG 585
           I A G G +E   W  GYGK   I H  G+ + Y H       +K G++V  G+ IG++G
Sbjct: 358 IHAAGRGKIEFIGWQHGYGKVIKIKHDGGFETVYGHMSRFNNQLKRGSSVDMGETIGYVG 417

Query: 586 TTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGEN 643
            TG +TGPHLHYE  V G+  D    ++PE   +     Q F  + +    L+   E 
Sbjct: 418 MTGAATGPHLHYEFHVKGVYTDPLVAKLPEANPIPSKYRQDFLAQTQSALDLMAKDER 475


>gi|297182757|gb|ADI18911.1| membrane proteins related to metalloendopeptidases [uncultured
           SAR11 cluster bacterium HF0010_09O16]
          Length = 430

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 108/367 (29%), Positives = 189/367 (51%), Gaps = 11/367 (2%)

Query: 272 PEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKD 331
           P F      I    T  + +      N +  +I K L  ++ +++L  ++     + Q  
Sbjct: 65  PRFKKIEHEISVGETFHNILEEYSVKNSEIEQIKKELGKQINLNKLNVNQKFSFTIDQTS 124

Query: 332 DKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIW 391
                  F + + QK  L+    +N+++   +   K++ N   D          I + ++
Sbjct: 125 SVVKEFVFQVSNTQKIYLS-RKEENDKFDQRILVTKLNKNIVYDE-------SIILESLY 176

Query: 392 RATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVN-HANNQASDDSELLYIH 450
           ++ S   + + ++    R     V+ Q  ++  D  +  + V         +   +LY +
Sbjct: 177 KSASNQKIPAGIIVEFARIYGFQVDFQRDVRKRDSFQIMYEVFLDDKKNVIETGNILYAN 236

Query: 451 ARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYS 510
            +        Y F +    S  +++++GKS +  L++TP+   R++S FGMR HPI G++
Sbjct: 237 LKLSGEDNSLYYFESKN--SEGHYDKSGKSVQKALMKTPINGARLSSPFGMRKHPIDGFN 294

Query: 511 RMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIK 570
           +MH G D+AAP GTPI+A G+G+++KA W GG G   +I H + Y + Y H    AK I+
Sbjct: 295 KMHRGTDFAAPMGTPIMASGNGVIKKAGWCGGGGNCVVIKHNSTYQTVYAHMSKFAKGIR 354

Query: 571 AGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAME 630
            GT VKQGQ IG++G+TG STGPHLHYE+IVNG K++S  +++P  + LKGD  + F  +
Sbjct: 355 KGTRVKQGQTIGYVGSTGKSTGPHLHYEVIVNGKKINSQTLKLPSGKILKGDERKIFETK 414

Query: 631 KKRINSL 637
           + +++ L
Sbjct: 415 RIKLDVL 421


>gi|330505226|ref|YP_004382095.1| peptidase M23B [Pseudomonas mendocina NK-01]
 gi|328919512|gb|AEB60343.1| peptidase M23B [Pseudomonas mendocina NK-01]
          Length = 454

 Score =  380 bits (976), Expect = e-103,   Method: Composition-based stats.
 Identities = 108/440 (24%), Positives = 175/440 (39%), Gaps = 20/440 (4%)

Query: 215 NQFFLLHNKKNQSFTLY-YADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPE 273
           +   +L  K +    L          +      T     +  +EN    +         +
Sbjct: 31  DAEMVLQEKDDLRAGLPVPGAASPFAEIEQSTETAENSAEDADENILEAADNT---PPSD 87

Query: 274 FADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDK 333
                + + +  T+       G +  D  +   + K+  +  +L   ++L   + ++   
Sbjct: 88  PNHHNVTVSNGDTLSTVFAKVGLNANDLHEALNSSKDAKQFSRLKVGQVLEFVLNEEG-- 145

Query: 334 FTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRA 393
             +            + ++  D                     + T+     I   ++ +
Sbjct: 146 -KLKHLQSKLSDLETIRLSRTDKG--------FDFQSEQIKPEVVTAYSRGVINSSLFLS 196

Query: 394 TSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARF 453
               G++ +L   +       ++    ++  D  E  +     N +      +L      
Sbjct: 197 AKRAGLSHSLTMDLANVFGYDIDFAMDIREGDEFEVIYEEKVVNGKRVGTGNILSARFTN 256

Query: 454 GETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRM 512
                   R+ +    +  Y+N NG+S R   +RTPV F R++S F     HPIL   R 
Sbjct: 257 RGKTYTAVRYTSKQG-TTSYYNANGESMRKAFIRTPVDFARISSRFSTGRKHPILNKIRA 315

Query: 513 HTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAG 572
           H GVD+AAPRGTPI A GDG V  A   GGYG   +I HG  Y + Y H    AK I+ G
Sbjct: 316 HKGVDYAAPRGTPIKAAGDGRVMLAGRNGGYGNTVIIQHGQRYRTLYAHMQGFAKGIRNG 375

Query: 573 TAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKK 632
           + VKQGQIIG+IGTTGLSTGPHLHYE  VNG+ VD    ++P  + +     QRF    K
Sbjct: 376 SNVKQGQIIGYIGTTGLSTGPHLHYEFQVNGVHVDPLSQKLPMADPIAASEKQRFMQLSK 435

Query: 633 RINSLLNNGENPKKPLFTSH 652
               L+   +  K  +  ++
Sbjct: 436 ---PLMARMDQEKATMLAAN 452


>gi|146308942|ref|YP_001189407.1| peptidase M23B [Pseudomonas mendocina ymp]
 gi|145577143|gb|ABP86675.1| peptidase M23B [Pseudomonas mendocina ymp]
          Length = 475

 Score =  379 bits (974), Expect = e-103,   Method: Composition-based stats.
 Identities = 111/440 (25%), Positives = 175/440 (39%), Gaps = 20/440 (4%)

Query: 215 NQFFLLHNKKNQSFTLY-YADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPE 273
           +   +L  K +    L          +      T     +  +EN   T+         +
Sbjct: 52  DAELVLQEKDDLRAGLPVPGAASPFAKIEQSADTAENSAEDADENILETA---DTTTPSD 108

Query: 274 FADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDK 333
                I + +  T+       G +  D  +   + K+  +  +L   ++L   + +    
Sbjct: 109 PNHHNITVSNGDTLSTVFAKVGLNANDLHEALNSNKDAKQFSRLKVGQVLEFELNEDG-- 166

Query: 334 FTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRA 393
             +            + ++  D             + +     + T+     I   ++ +
Sbjct: 167 -KLKHLQSKLSDLETIRLSRTDKG--------FDFERDQVKPEVVTTYSRGVINSSLFLS 217

Query: 394 TSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARF 453
               G++ +L   +       ++    ++  D  E  +     N +      +L      
Sbjct: 218 AKRAGLSHSLTMDLANVFGYDIDFAMDIREGDEFEVIYEEKVVNGKRVGTGNILSARFTN 277

Query: 454 GETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRM 512
                   R+ N    +  Y+N NG+S R   +RTPV F R++S F     HPIL   R 
Sbjct: 278 RGKTYTAVRYTNKQG-TTSYYNANGESMRKAFIRTPVDFARISSRFSTGRKHPILNKIRA 336

Query: 513 HTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAG 572
           H GVD+AAP GTPI A GDG V  A   GGYG   +I HG  Y + Y H    AK I+ G
Sbjct: 337 HKGVDYAAPHGTPIKAAGDGRVTLAGRNGGYGNTVIIQHGQRYRTLYAHMQGFAKGIRNG 396

Query: 573 TAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKK 632
             VKQGQIIG+IGTTGLSTGPHLHYE  VNG+ VD    ++P  + +     QRF    K
Sbjct: 397 ANVKQGQIIGYIGTTGLSTGPHLHYEFQVNGVHVDPLSQKLPMADPIAASEKQRFMQLSK 456

Query: 633 RINSLLNNGENPKKPLFTSH 652
               L+   +  K  +  S+
Sbjct: 457 ---PLMARMDQEKATMLASN 473


>gi|40062724|gb|AAR37629.1| peptidase, putative [uncultured marine bacterium 438]
          Length = 432

 Score =  379 bits (973), Expect = e-103,   Method: Composition-based stats.
 Identities = 106/368 (28%), Positives = 183/368 (49%), Gaps = 12/368 (3%)

Query: 272 PEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKD 331
           P + +    I    T    + +    N +  +I K L ++  ++ L  +  ++I + Q +
Sbjct: 68  PRYKNINHKISSGETFDKILNNYSIPNEEINQIKKKLNSDYNINNLQPNLEIKITIDQSN 127

Query: 332 DKFTIVRFSIYHKQKHLLTIALN-DNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGI 390
           +K  I  F     +   + +  N DNN +   +    ++                I   +
Sbjct: 128 NK-KITSFLFPVSRTEKIQLTRNLDNNLFEKKIIITNLNKKIVFKE-------GKITQSL 179

Query: 391 WRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSV-NHANNQASDDSELLYI 449
           ++      +  N++    R     ++ Q  ++  D  +  + V    + +  +   +++ 
Sbjct: 180 YKTAIDLKVQPNVIIEFARIYGFQIDFQRDIRKNDNFQIMYEVFEDDDGKIFETGNIIFA 239

Query: 450 HARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGY 509
             +        Y F      S  +++E+GKS    L++TP+   R++S FGMR HPI G+
Sbjct: 240 DLKLSGKNNALYYFEKKG--SEGHYDESGKSVEKALMKTPINGARLSSAFGMRKHPIDGF 297

Query: 510 SRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNI 569
           ++MH G D+AAP GTPI+A G G++ +A W GG G    I H + Y + Y H    A+ I
Sbjct: 298 NKMHRGTDFAAPMGTPIMASGSGLITRARWCGGGGNCIKIKHNSTYETIYAHMKNFARGI 357

Query: 570 KAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAM 629
           K G  VKQGQIIG++G+TG STGPHLHYE++VNG KV+S K+++P  + LKG   + F +
Sbjct: 358 KEGIRVKQGQIIGYVGSTGKSTGPHLHYEVVVNGKKVNSQKLKLPSGKTLKGKEREIFEV 417

Query: 630 EKKRINSL 637
           EK +++ L
Sbjct: 418 EKIKLDVL 425


>gi|168203423|gb|ACA21558.1| M23/M37 peptidase [Candidatus Pelagibacter ubique]
          Length = 430

 Score =  379 bits (972), Expect = e-102,   Method: Composition-based stats.
 Identities = 109/367 (29%), Positives = 186/367 (50%), Gaps = 11/367 (2%)

Query: 272 PEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKD 331
           P F      I    T    +     +  +   I + L  +V +++L   + +R  + Q  
Sbjct: 65  PRFNKVSHNISAGETFDTILKKYNVNKDEIKIIKETLSKKVNLNKLNTTQKIRFILDQSS 124

Query: 332 DKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIW 391
           +K     F I + +K  LT    + N++   +   K+  +              I   ++
Sbjct: 125 NKIKEFTFQISNTEKIYLT-KNTETNKFNQKLLLTKLKKDIIYKE-------NKILQSLY 176

Query: 392 RATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVN-HANNQASDDSELLYIH 450
           ++     +   ++    R     V+ Q  ++  D  +  +      N +  +   +L+ +
Sbjct: 177 KSAVDRKIPIGVIVEFARVYGFQVDFQRDIRKNDSFQVMYEAFVDDNGKIIETGNILFAN 236

Query: 451 ARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYS 510
            +       FY F     GS  ++++NGKS +  L++TP+   R++S FGMR HPI G++
Sbjct: 237 LKLSGQNNSFYYF--DKKGSEGHYDKNGKSVKKALMKTPINGARLSSPFGMRKHPIDGFT 294

Query: 511 RMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIK 570
           +MH G D+AAP GTPI+A GDG+V+KA+W GG G   +I H + Y + Y H    A  I+
Sbjct: 295 KMHKGTDFAAPMGTPIMASGDGVVKKASWCGGGGNCIVIKHNSTYQTIYAHMSKFANGIR 354

Query: 571 AGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAME 630
           +G  VKQGQIIG++G+TG STGPHLHYE++VNG K++S  +++P  + LKG+  + F   
Sbjct: 355 SGVRVKQGQIIGYVGSTGKSTGPHLHYEVVVNGKKINSQTLKLPSGKILKGEDRKIFETS 414

Query: 631 KKRINSL 637
           K +++ L
Sbjct: 415 KIKLDVL 421


>gi|163797820|ref|ZP_02191765.1| Peptidase M23B [alpha proteobacterium BAL199]
 gi|159176864|gb|EDP61431.1| Peptidase M23B [alpha proteobacterium BAL199]
          Length = 440

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 119/450 (26%), Positives = 200/450 (44%), Gaps = 16/450 (3%)

Query: 204 AQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITS 263
                +   +   + +L   +  S     A P  +D     P T+    +  EE R   +
Sbjct: 3   WTSAVVFGILAAAWIVLGQSEPSSARFAEASPPLVDGAAMRPQTF--DARRAEEMRAFPA 60

Query: 264 PQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEIL 323
            +      P   D +I +    T+   +   G     +      L+    V +L   + +
Sbjct: 61  AETE----PGPEDRIITVSRGDTLIGILTDNGVDRASAHSAVSTLRKVFDVRRLQIGQDI 116

Query: 324 RIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEES 383
            +      D    +  ++       + + L+D   +        +D              
Sbjct: 117 TLTFKPSTDGDQFLGMALRPTPDRDVLVKLDDGGSFTAEEAERALDRRFAYGA------- 169

Query: 384 PNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHAN-NQASD 442
             I   ++ A     +  +++  ++R  +  V+ Q  ++P D  E  +            
Sbjct: 170 ATIDSSLYEAAIDANVPIDVLMDLVRVFSFDVDFQRDVQPGDRFEVLYEGFDDEFGDRVR 229

Query: 443 DSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMR 502
           + ++ Y           FYRF  P  G V+YF  +G+S R  L+RTP+   R++SGFG R
Sbjct: 230 NGDIRYAAITLSGKTLAFYRF-TPSSGFVDYFGPDGRSVRKALMRTPIDGARLSSGFGKR 288

Query: 503 YHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQ 562
            HPILGY++MH GVD+AAP GTPI+A GDG+VE A   GGYG    I H +   ++Y H 
Sbjct: 289 RHPILGYTKMHKGVDFAAPSGTPIMAAGDGVVEMAERFGGYGNYVRIRHNSEIKTAYGHT 348

Query: 563 DAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGD 622
              AK I+AG+ V+QGQII ++GTTG STGPHLHYE+++N  +V+   +++P  E L G 
Sbjct: 349 SRFAKGIRAGSRVRQGQIIAYVGTTGRSTGPHLHYEVMLNARQVNPMSIKLPTGEQLAGK 408

Query: 623 LLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
            L++       I++ ++     +  +  S+
Sbjct: 409 DLKKLQALIPTIDAEVDAARA-EASVVASN 437


>gi|77461320|ref|YP_350827.1| peptidase M23B [Pseudomonas fluorescens Pf0-1]
 gi|77385323|gb|ABA76836.1| putative peptidase [Pseudomonas fluorescens Pf0-1]
          Length = 503

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 114/476 (23%), Positives = 182/476 (38%), Gaps = 26/476 (5%)

Query: 182 FEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQR 241
            E +     +P           A          +                 A+  T DQ 
Sbjct: 32  TEPSKAPPLYPKTHLLAASGIAALLSLALLVFPSSDVEAKKTTLSLELESPAEQLTQDQD 91

Query: 242 HDHPITYSKKIKIIE----ENRT---------ITSPQVLIDKIPEFADDLIPIQHNTTIF 288
                  + +         EN T           +P  ++++        + +    T+ 
Sbjct: 92  AADAAQATNESVASPFAQIENSTEETQETAQAAPAPIPVVEEKKAPNHREVIVSKGDTLS 151

Query: 289 DAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHL 348
                 G       ++  + K   +  QL   + L   +  +     +            
Sbjct: 152 TLFEKVGLPAAAVHEVLASDKQAKQFSQLKHGQKLEFELNPQGQLTNLHSKV---SDVET 208

Query: 349 LTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIM 408
           +T+  ND             +       +RT+     I   + ++ +  G++ +L   + 
Sbjct: 209 ITLTKNDKG--------YVFNRVTAKPTVRTAYVHGVINSSLSQSAARAGLSHSLTMDMA 260

Query: 409 RTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVD 468
                 V+  + ++  D  +  +     N +A  +  +L              R+ N   
Sbjct: 261 SVFGYDVDFAQDIRQGDEFDVIYEQKVVNGKAVGNGPILSARFTNRGKTYTAVRYTNKQG 320

Query: 469 GSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIV 527
            S  Y+  +G S R   +RTPV F R++S F M   HPIL   R H GVD+AAPRGTPI 
Sbjct: 321 NS-SYYTADGNSMRKAFIRTPVDFARISSKFSMGRKHPILNKIRAHKGVDYAAPRGTPIK 379

Query: 528 AVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTT 587
           A GDG V  A   GGYG   +I HGN Y + Y H    AK +K G  VKQGQ+IG+IGTT
Sbjct: 380 AAGDGKVLLAGRRGGYGNTVIIQHGNTYRTLYGHMQGFAKGVKTGGTVKQGQVIGYIGTT 439

Query: 588 GLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGEN 643
           GLSTGPHLHYE  VNG+ VD    ++P  + +      RF  + + + + ++  + 
Sbjct: 440 GLSTGPHLHYEFQVNGVHVDPLGQKLPMADPIAKSERARFLAQSQPLMARMDQEKA 495


>gi|71083227|ref|YP_265946.1| M23/M37 peptidase [Candidatus Pelagibacter ubique HTCC1062]
 gi|71062340|gb|AAZ21343.1| M23/M37 peptidase [Candidatus Pelagibacter ubique HTCC1062]
          Length = 432

 Score =  378 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 109/368 (29%), Positives = 182/368 (49%), Gaps = 12/368 (3%)

Query: 272 PEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKD 331
           P + +    I    T    + +    N +  +I K L ++  ++ L  +  ++I + Q +
Sbjct: 68  PRYKNIDHKISSGETFDKILNNYSIPNEEINQIKKKLNSDYNINNLQPNLEIKITIDQSN 127

Query: 332 DKFTIVRFSIYHKQKHLLTIALN-DNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGI 390
           +K  I  F     +   + +  N DNN +        ++                I   +
Sbjct: 128 NK-KITSFLFPVSRTEKIQLIRNLDNNLFEKKTIITNLNKKIIFKE-------GKITQSL 179

Query: 391 WRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSV-NHANNQASDDSELLYI 449
           ++      +  N++    R     V+ Q  ++  D  +  + V      +  + S +++ 
Sbjct: 180 YKTAIDLKVQPNVIIEFARIYGFQVDFQRDIRKNDNFQIMYEVFEDDEGKVFETSNIIFA 239

Query: 450 HARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGY 509
             +        Y F      S  +++ENGKS    L++TP+   R++S FGMR HPI G+
Sbjct: 240 DLKLSGKNNALYYFEKKG--SEGHYDENGKSVEKALMKTPINGARLSSAFGMRKHPIDGF 297

Query: 510 SRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNI 569
           ++MH G D+AAP GTPI+A G G++ +A W GG G    I H + Y + Y H    A+ I
Sbjct: 298 NKMHRGTDFAAPMGTPIMASGSGLITRARWCGGGGNCIKIKHNSTYETIYAHMKNFARGI 357

Query: 570 KAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAM 629
           K G  VKQGQIIG++G+TG STGPHLHYE++VNG KV+S K+++P  + LKG   + F +
Sbjct: 358 KEGIRVKQGQIIGYVGSTGKSTGPHLHYEVVVNGKKVNSQKLKLPSGKTLKGKEREIFEV 417

Query: 630 EKKRINSL 637
           EK +++ L
Sbjct: 418 EKIKLDVL 425


>gi|87121328|ref|ZP_01077218.1| Peptidase M23B [Marinomonas sp. MED121]
 gi|86163485|gb|EAQ64760.1| Peptidase  M23B [Marinomonas sp. MED121]
          Length = 485

 Score =  375 bits (963), Expect = e-101,   Method: Composition-based stats.
 Identities = 93/411 (22%), Positives = 171/411 (41%), Gaps = 14/411 (3%)

Query: 237 TLDQRHDHPITYSKKIKIIEENRT-ITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAG 295
             D    +    +     I+   T I +P  L+   P F      ++   ++   +   G
Sbjct: 77  ATDGEVANQTIQNNLSNSIQSTTTGIPTPAGLVKHAPAFTTQQATVKTGDSLSKILSLHG 136

Query: 296 YSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALND 355
            SN D  +++ + K    + ++   + L     +  D+   ++     K +    +    
Sbjct: 137 ISNQDIYRVSSSDKKSKELTRMRPGQTLEFVKDKNTDELISLKLI---KSQLETIVYEKS 193

Query: 356 NNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSV 415
           + ++         +   +   +    +   I + ++      G++ +++  +       +
Sbjct: 194 DGKFTS-------NKVVREPEIVKVYKEATISNSLFLDGLKAGISQSMLIEMANIFGWDI 246

Query: 416 NLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFN 475
           +    L+  D     F   + + Q+     +L           +  R+         Y+ 
Sbjct: 247 DFALDLRTGDTFSLLFEEKYLDGQSIGFGNILAAQFVNNGRVYQAIRYKTSKGSH--YYT 304

Query: 476 ENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIV 534
            +G S R   LRTPV F R++S F     HPI   +R H GVD+AA +GTP+ A GDG V
Sbjct: 305 PDGLSMRKTFLRTPVDFTRISSKFNPNRLHPIFKTTRPHRGVDYAASKGTPVKASGDGKV 364

Query: 535 EKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPH 594
                  GYG   ++ HG GY + Y H +  ++ IK G  VKQGQ I ++G TG +TGPH
Sbjct: 365 IFKGRQNGYGNVVILDHGRGYTTLYAHLNGFSRKIKRGGRVKQGQTIAFVGQTGYATGPH 424

Query: 595 LHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPK 645
           LHYE  +NG   +   V++P  E +    L+++    + + S L +  +P 
Sbjct: 425 LHYEFRINGTHKNPVTVKLPNDEPMAKKDLKKYLPYAQTMASALESYHSPN 475


>gi|70732896|ref|YP_262667.1| M24/M37 family peptidase [Pseudomonas fluorescens Pf-5]
 gi|68347195|gb|AAY94801.1| peptidase, M23/M37 family [Pseudomonas fluorescens Pf-5]
          Length = 500

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 108/454 (23%), Positives = 177/454 (38%), Gaps = 23/454 (5%)

Query: 191 FPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSK 250
           FP+     +    + D E     + Q         Q+ +   A P    +      T + 
Sbjct: 61  FPSSDVEAKKTTLSLDLESPIEQLTQDQDAA-STEQATSEAVASPFAQIENTAEDTTQTA 119

Query: 251 KIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKN 310
           +   +             ++        + +    T+       G       ++  + K 
Sbjct: 120 ETAPVPAAV---------EEPKAPGHREVLVTKGDTLSTLFEKVGLPATSVHEVLASDKQ 170

Query: 311 EVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDI 370
             +  QL   + L   +        +            +T+                   
Sbjct: 171 AKQFSQLKHGQKLEFELTPDGQLNNLHSKV---SDLETITLTKGPKG--------FTFSR 219

Query: 371 NHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETF 430
                 +R++     I   + ++ +  G++ +L   +       ++  + ++  D  +  
Sbjct: 220 VITKPVVRSAYVHGVINSSLSQSAARAGLSHSLTMDMANVFGYDIDFAQDIRQGDEFDVI 279

Query: 431 FSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPV 490
           +    AN +      +L              R+ N    S  Y+  +G S R   +RTPV
Sbjct: 280 YEQKVANGKVVGTGNILSARFTNRGKTYTAVRYTNKQGSS-SYYTADGNSMRKAFIRTPV 338

Query: 491 PFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLI 549
            F R++S F M   HPIL   R H GVD+AAPRGTPI A GDG V  A   GGYG   +I
Sbjct: 339 DFARISSRFSMGRKHPILNKIRAHKGVDYAAPRGTPIKAAGDGKVLLAGRRGGYGNTVII 398

Query: 550 HHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDST 609
            HGN Y + Y H    AK +K G +VKQGQ+IG+IGTTGLSTGPHLHYE  VNG+ VD  
Sbjct: 399 QHGNTYRTLYGHMQGFAKGVKTGGSVKQGQVIGYIGTTGLSTGPHLHYEFQVNGVHVDPL 458

Query: 610 KVRIPERENLKGDLLQRFAMEKKRINSLLNNGEN 643
             ++P  + +      RF  + + + + ++  + 
Sbjct: 459 GQKLPMADPIAKAERARFLQQSQPLMARMDQEKA 492


>gi|300113477|ref|YP_003760052.1| peptidase M23 [Nitrosococcus watsonii C-113]
 gi|299539414|gb|ADJ27731.1| Peptidase M23 [Nitrosococcus watsonii C-113]
          Length = 479

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 103/418 (24%), Positives = 176/418 (42%), Gaps = 13/418 (3%)

Query: 227 SFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTT 286
           +  L   D  TL     H       + I +   TI  PQ+   K P +    I I+    
Sbjct: 61  ASPLAQIDHLTLATIASHQPPP-PLLTIEQPTATIQKPQITASKSPTW--RNITIKEGDN 117

Query: 287 IFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQK 346
           +       G S     ++         + +L   ++L+I + + +    +    +     
Sbjct: 118 LSRIFARLGLSARQVHEVMSLGNPVRSLARLRPGQLLQIKLKKDNGSRRLTALRLNFSPI 177

Query: 347 HLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKL 406
             L +        +   +  K     +    R    + +I   +       G+ +  V  
Sbjct: 178 KYLEV--------LAEEDKFKAKQISRNIETRIETIAGSIKSSLSEDGLQAGLTNKQVIE 229

Query: 407 IMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNP 466
           + +     ++    L+P D  +  F  ++  N+   +  +L           +  R+ + 
Sbjct: 230 LTQIFGWDIDFALDLRPGDNFKVLFEEHYFQNKKLQNGPILAAEFTNHGKTFQAIRYTDA 289

Query: 467 VDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTP 525
              +  Y+   G S R   LRTPV + R++S F +R  HP+L   R H GVD+AAP GTP
Sbjct: 290 SGHT-GYYTPAGLSMRKAFLRTPVNYARISSHFNLRRKHPVLNRIRAHKGVDYAAPIGTP 348

Query: 526 IVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIG 585
           + A G+G V      GGYGK  ++ HG  Y + Y H     + +KAG  VKQG  IG++G
Sbjct: 349 VKAAGNGKVLFVGRKGGYGKAIVLQHGAKYSTLYGHLSRFKRGLKAGNKVKQGATIGYVG 408

Query: 586 TTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGEN 643
            TGL+TGPHLHYE +VNG+  +   V++P+   +   L Q F     ++++ L+  + 
Sbjct: 409 QTGLATGPHLHYEFLVNGVHRNPLTVKLPQAAPIPHQLKQDFQKHAAKLDAQLDAADT 466


>gi|104779736|ref|YP_606234.1| M24/M37 family peptidase [Pseudomonas entomophila L48]
 gi|95108723|emb|CAK13417.1| putative peptidase, M23/M37 family [Pseudomonas entomophila L48]
          Length = 498

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 109/450 (24%), Positives = 180/450 (40%), Gaps = 17/450 (3%)

Query: 205 QDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSP 264
              E++         L +   Q      A P    +++        +    +  +T + P
Sbjct: 62  PSSEVEAKKTTLSLELESPAEQLKDESRAAPLVQAEQNTDSPFAQIEGDEADTAQTKSEP 121

Query: 265 QV-LIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEIL 323
                 +        + +    T+       G        I  + K   +  QL   ++L
Sbjct: 122 TPVAKQEEKAPGHREVVVSRGDTLSTLFNKVGLPANAVHDILASNKQAKQFSQLKHGQVL 181

Query: 324 RIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEES 383
           +  + +      +            + +   D             D       +RT+   
Sbjct: 182 QFELDKDG---QLTSLHSKVSNLETIRLTRTDKG--------FTFDREVSKPVVRTAYAH 230

Query: 384 PNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDD 443
             I   +  +    G++ ++   + + L   ++  + ++P D  +  +     + +    
Sbjct: 231 GVIKSSLSASAQRAGLSHSMTMDMAKILGYDIDFAQDIRPGDEFDVVYEQKMMDGKVVGT 290

Query: 444 SELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY 503
             +L              R+ N    +  Y+  +G S R   +RTPV F R++S F    
Sbjct: 291 GSILSARFTNRGKTYTAVRYTNKQG-NTNYYTADGNSLRKAFIRTPVDFARISSRFSAGR 349

Query: 504 -HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQ 562
            HPIL   R H GVD+AAPRGTPI A GDG +E A   GGYG   +I HGN Y + Y H 
Sbjct: 350 KHPILNKIRAHKGVDYAAPRGTPIKAAGDGRIELAGRRGGYGNTVIIAHGNSYKTLYGHM 409

Query: 563 DAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGD 622
              AK IK G +VKQGQIIG+IGTTGLSTGPHLHYE  VNG+ VD    ++P  + +   
Sbjct: 410 QGFAKGIKTGGSVKQGQIIGYIGTTGLSTGPHLHYEFQVNGVHVDPLSQKVPMADPIAKA 469

Query: 623 LLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
              RF  + + + + ++  +     L  ++
Sbjct: 470 ERARFNQQSQPLIARMDQEKA---TLLAAN 496


>gi|107099633|ref|ZP_01363551.1| hypothetical protein PaerPA_01000649 [Pseudomonas aeruginosa PACS2]
          Length = 451

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 113/457 (24%), Positives = 181/457 (39%), Gaps = 23/457 (5%)

Query: 204 AQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENR---- 259
              E           L  N            PQ++    D    +++     ++N     
Sbjct: 7   PSSEVEAKRTTLNLELESNTDRLLQEKDALLPQSVTNSSDEGTPFAQVEGASDDNTAEQD 66

Query: 260 ---TITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQ 316
                 S      K  +     I +    T+      AG S      +  + K+  R   
Sbjct: 67  SDKPGASVADADTKPVDPEWKTITVASGDTLSTVFTKAGLSTSAMHDMLTSSKDAKRFTH 126

Query: 317 LTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDY 376
           L   + +++ +  K +   +    +   +   + +   D                     
Sbjct: 127 LKVGQEVKLKLDPKGE---LQALRVKQSELETIGLDKTDKG--------YSFKREKAQID 175

Query: 377 MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHA 436
           + T+     I   ++ A    G+  NLV  +       ++    L+  D  +  +  +  
Sbjct: 176 LHTAYAHGRITSSLFVAGRNAGLPYNLVTSLSNIFGYDIDFALDLREGDEFDVIYEQHKV 235

Query: 437 NNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMT 496
           N +      +L              R+ N    +  Y+  +G S R   +RTPV F R++
Sbjct: 236 NGKQVATGNILAARFVNRGKTYTAVRYTNKQG-NTSYYRADGSSMRKAFIRTPVDFARIS 294

Query: 497 SGFG-MRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGY 555
           S F   R HPIL   R H GVD+AAP GTPI A GDG + +A   GGYG   +I HG  Y
Sbjct: 295 SRFSLGRRHPILNKIRAHKGVDYAAPIGTPIKATGDGKILEAGRKGGYGNAVVIQHGQRY 354

Query: 556 VSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPE 615
            + Y H    AK I+AGT+VKQGQIIG++G TGL+TGPHLHYE  +NG  VD    ++P 
Sbjct: 355 RTIYGHMSRFAKGIRAGTSVKQGQIIGYVGMTGLATGPHLHYEFQINGRHVDPLSAKLPM 414

Query: 616 RENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
            + L G   +RF  + + + + ++  +   K L   +
Sbjct: 415 ADPLGGADRKRFMAQTQPMIARMDQEK---KTLLALN 448


>gi|77164427|ref|YP_342952.1| peptidase M23B [Nitrosococcus oceani ATCC 19707]
 gi|254433952|ref|ZP_05047460.1| M23 peptidase domain protein [Nitrosococcus oceani AFC27]
 gi|76882741|gb|ABA57422.1| Peptidase M23B [Nitrosococcus oceani ATCC 19707]
 gi|207090285|gb|EDZ67556.1| M23 peptidase domain protein [Nitrosococcus oceani AFC27]
          Length = 479

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 97/419 (23%), Positives = 169/419 (40%), Gaps = 11/419 (2%)

Query: 225 NQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHN 284
           +   T   A    L             +  +EE         +    P      I I+  
Sbjct: 57  SAYPTGPLAQIDHLTLATIASHQPPPPLLTVEEPTAAVQKPQIATPKPPT-WQNITIKKG 115

Query: 285 TTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHK 344
             +       G S     ++         + +L   ++L+I +   +    ++   +   
Sbjct: 116 DNLSHIFSRLGLSARQVHEVMSLGNPVHSLARLRPGQLLQIKLEGDNGSRRLIALRLNFS 175

Query: 345 QKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLV 404
               L +        +   +  +     +    R    + +I   +       G+ +  V
Sbjct: 176 PIEYLEV--------LAEEDKFEAKRISRNIETRIETIAGSIKSSLSEDGLQAGLTNKQV 227

Query: 405 KLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFL 464
             + +     ++    L+P D  +  F  ++  N+   +  +L           +  R+ 
Sbjct: 228 IELTQIFGWDIDFALDLRPGDSFKVLFEEHYFQNKKLQNGPILAAEFTNHGKTFQAIRYA 287

Query: 465 NPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRG 523
           +    +  Y+   G S R   LRTPV + R++S F +R  HP+L   R H GVD+AAP G
Sbjct: 288 DASGHT-GYYTPAGLSMRKAFLRTPVNYARISSHFNLRRKHPVLNRIRAHKGVDYAAPIG 346

Query: 524 TPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGW 583
           TP+ A GDG V+     GGYGK  ++ HG  Y + Y H       +KAG+ VKQG  IG+
Sbjct: 347 TPVKAAGDGKVQFVGRKGGYGKAIVLQHGAKYSTLYGHLSRFKSGLKAGSKVKQGATIGY 406

Query: 584 IGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGE 642
           +G TGL+TGPHLHYE +VNG+  +   V++P+   +   L Q F     ++ + L+  +
Sbjct: 407 VGQTGLATGPHLHYEFLVNGVHRNPLTVKLPQAAPIPRQLRQDFQKHAAKLEAQLDAAD 465


>gi|218889390|ref|YP_002438254.1| putative metallopeptidase [Pseudomonas aeruginosa LESB58]
 gi|218769613|emb|CAW25373.1| putative metallopeptidase [Pseudomonas aeruginosa LESB58]
          Length = 447

 Score =  372 bits (955), Expect = e-100,   Method: Composition-based stats.
 Identities = 114/459 (24%), Positives = 183/459 (39%), Gaps = 27/459 (5%)

Query: 204 AQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENR---- 259
              E           L  N            PQ++    D    +++     ++N     
Sbjct: 3   PSSEVEAKRTTLNLELESNTDRLLQEKDDLLPQSVTNSSDEGTPFAQVEGASDDNTAEQD 62

Query: 260 -----TITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRV 314
                T  +        PE+    I +    T+      AG S      +  + K+  R 
Sbjct: 63  SDKPGTSVADADTKPVDPEWKT--ITVASGDTLSTVFTKAGLSTSAMHDMLTSSKDAKRF 120

Query: 315 DQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQM 374
             L   + +++ +  K +   +    +   +   + +   D                   
Sbjct: 121 THLKVGQEVKLKLDPKGE---LQALRVKQSELETIGLDKTDKG--------YSFKREKAQ 169

Query: 375 DYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVN 434
             + T+     I   ++ A    G+  NLV  +       ++    L+  D  +  +  +
Sbjct: 170 IDLHTAYAHGRITSSLFVAGRNAGLPYNLVTSLSNIFGYDIDFALDLREGDEFDVIYEQH 229

Query: 435 HANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGR 494
             N +      +L              R+ N    +  Y+  +G S R   +RTPV F R
Sbjct: 230 KVNGKQVATGNILAARFVNRGKTYTAVRYTNKQG-NTSYYRADGSSMRKAFIRTPVDFAR 288

Query: 495 MTSGFG-MRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGN 553
           ++S F   R HPIL   R H GVD+AAP GTPI A GDG + +A   GGYG   +I HG 
Sbjct: 289 ISSRFSLGRRHPILNKIRAHKGVDYAAPIGTPIKATGDGKILEAGRKGGYGNAVVIQHGQ 348

Query: 554 GYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRI 613
            Y + Y H    AK I+AGT+VKQGQIIG++G TGL+TGPHLHYE  +NG  VD    ++
Sbjct: 349 RYRTIYGHMSRFAKGIRAGTSVKQGQIIGYVGMTGLATGPHLHYEFQINGRHVDPLSAKL 408

Query: 614 PERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
           P  + L G   +RF  + + + + ++  +   K L   +
Sbjct: 409 PMADPLGGADRKRFMAQTQPMIARMDQEK---KTLLALN 444


>gi|254237141|ref|ZP_04930464.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|126169072|gb|EAZ54583.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
          Length = 447

 Score =  372 bits (955), Expect = e-100,   Method: Composition-based stats.
 Identities = 114/459 (24%), Positives = 183/459 (39%), Gaps = 27/459 (5%)

Query: 204 AQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENR---- 259
              E           L  N            PQ++    D    +++     ++N     
Sbjct: 3   PSSEVEAKRTTLNLELESNTDRLLQEKDDLLPQSVTNSSDEGTPFAQVEGASDDNTAEQD 62

Query: 260 -----TITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRV 314
                T  +        PE+    I +    T+      AG S      +  + K+  R 
Sbjct: 63  SDKPGTSVADADTKPVDPEWKT--ITVASGDTLSTVFTKAGLSTSAMHDMLTSSKDAKRF 120

Query: 315 DQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQM 374
             L   + +++ +  K +   +    +   +   + +   D                   
Sbjct: 121 THLKVGQEVKLKLDPKGE---LQALRVKQSELETIGLDKTDKG--------YSFKREKAQ 169

Query: 375 DYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVN 434
             + T+     I   ++ A    G+  NLV  +       ++    L+  D  +  +  +
Sbjct: 170 IDLLTAYAHGRITSSLFVAGRNAGLPYNLVTSLSNIFGYDIDFALDLREGDEFDVIYEQH 229

Query: 435 HANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGR 494
             N +      +L              R+ N    +  Y+  +G S R   +RTPV F R
Sbjct: 230 KVNGKQVATGNILAARFVNRGKTYTAVRYTNKQG-NTSYYRADGSSMRKAFIRTPVDFAR 288

Query: 495 MTSGFG-MRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGN 553
           ++S F   R HPIL   R H GVD+AAP GTPI A GDG + +A   GGYG   +I HG 
Sbjct: 289 ISSRFSLGRRHPILNKIRAHKGVDYAAPIGTPIKATGDGKILEAGRKGGYGNAVVIQHGQ 348

Query: 554 GYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRI 613
            Y + Y H    AK I+AGT+VKQGQIIG++G TGL+TGPHLHYE  +NG  VD    ++
Sbjct: 349 RYRTIYGHMSRFAKGIRAGTSVKQGQIIGYVGMTGLATGPHLHYEFQINGRHVDPLSAKL 408

Query: 614 PERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
           P  + L G   +RF  + + + + ++  +   K L   +
Sbjct: 409 PMADPLGGADRKRFMAQTQPMIARMDQEK---KTLLALN 444


>gi|15595864|ref|NP_249358.1| hypothetical protein PA0667 [Pseudomonas aeruginosa PAO1]
 gi|116054392|ref|YP_788837.1| hypothetical protein PA14_08540 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|9946545|gb|AAG04056.1|AE004501_8 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|115589613|gb|ABJ15628.1| putative metallopeptidase [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 447

 Score =  372 bits (954), Expect = e-100,   Method: Composition-based stats.
 Identities = 113/457 (24%), Positives = 181/457 (39%), Gaps = 23/457 (5%)

Query: 204 AQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENR---- 259
              E           L  N            PQ++    D    +++     ++N     
Sbjct: 3   PSSEVEAKRTTLNLELESNTDRLLQEKDDLLPQSVTNSSDEGTPFAQVEGASDDNTAEQD 62

Query: 260 ---TITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQ 316
                 S      K  +     I +    T+      AG S      +  + K+  R   
Sbjct: 63  SDKPGASVADADTKPVDPEWKTITVASGDTLSTVFTKAGLSTSAMHDMLTSSKDAKRFTH 122

Query: 317 LTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDY 376
           L   + +++ +  K +   +    +   +   + +   D                     
Sbjct: 123 LKVGQEVKLKLDPKGE---LQALRVKQSELETIGLDKTDKG--------YSFKREKAQID 171

Query: 377 MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHA 436
           + T+     I   ++ A    G+  NLV  +       ++    L+  D  +  +  +  
Sbjct: 172 LHTAYAHGRITSSLFVAGRNAGLPYNLVTSLSNIFGYDIDFALDLREGDEFDVIYEQHKV 231

Query: 437 NNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMT 496
           N +      +L              R+ N    +  Y+  +G S R   +RTPV F R++
Sbjct: 232 NGKQVATGNILAARFVNRGKTYTAVRYTNKQG-NTSYYRADGSSMRKAFIRTPVDFARIS 290

Query: 497 SGFG-MRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGY 555
           S F   R HPIL   R H GVD+AAP GTPI A GDG + +A   GGYG   +I HG  Y
Sbjct: 291 SRFSLGRRHPILNKIRAHKGVDYAAPIGTPIKATGDGKILEAGRKGGYGNAVVIQHGQRY 350

Query: 556 VSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPE 615
            + Y H    AK I+AGT+VKQGQIIG++G TGL+TGPHLHYE  +NG  VD    ++P 
Sbjct: 351 RTIYGHMSRFAKGIRAGTSVKQGQIIGYVGMTGLATGPHLHYEFQINGRHVDPLSAKLPM 410

Query: 616 RENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
            + L G   +RF  + + + + ++  +   K L   +
Sbjct: 411 ADPLGGADRKRFMAQTQPMIARMDQEK---KTLLALN 444


>gi|313111704|ref|ZP_07797497.1| hypothetical protein PA39016_004010001 [Pseudomonas aeruginosa
           39016]
 gi|310883999|gb|EFQ42593.1| hypothetical protein PA39016_004010001 [Pseudomonas aeruginosa
           39016]
          Length = 479

 Score =  371 bits (953), Expect = e-100,   Method: Composition-based stats.
 Identities = 114/502 (22%), Positives = 190/502 (37%), Gaps = 35/502 (6%)

Query: 152 PKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVTTQKINFPTDITRIQLDHTAQDEEIKN 211
           P + P          ++   L   +      E     +N   +    +L      +E  +
Sbjct: 9   PPYYPKSHLLAASGVAALLSLALLVFPSSEVEAKRTTLNLELESNTDRL-----LQEKDD 63

Query: 212 AIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKI 271
            +        ++      +  A      ++       S                    K 
Sbjct: 64  LLPQSVTNSSDEGTPFAQVEGASDDNTAEQDSDKPGASVA--------------DADTKP 109

Query: 272 PEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKD 331
            +     I +    T+      AG S      +  + K+  R   L   + +++ +  K 
Sbjct: 110 VDPEWKTITVASGDTLSTVFTKAGLSTSAMHDMLTSSKDAKRFTHLKVGQEVKLKLDPKG 169

Query: 332 DKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIW 391
           +   +    +   +   + +   D                     + T+     I   ++
Sbjct: 170 E---LQALRVKQSELETIGLDKTDKG--------YSFKREKAQIDLHTAYAHGRITSSLF 218

Query: 392 RATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHA 451
            A    G+  NLV  +       ++    L+  D  +  +  +  N +      +L    
Sbjct: 219 VAGRNAGLPYNLVTSLSNIFGYDIDFALDLREGDEFDVIYEQHKVNGKQVATGNILAARF 278

Query: 452 RFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFG-MRYHPILGYS 510
                     R+ N    +  Y+  +G S R   +RTPV F R++S F   R HPIL   
Sbjct: 279 VNRGKTYTAVRYTNKQG-NTSYYRADGSSMRKAFIRTPVDFARISSRFSLGRRHPILNKI 337

Query: 511 RMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIK 570
           R H GVD+AAP GTPI A GDG + +A   GGYG   +I HG  Y + Y H    AK I+
Sbjct: 338 RAHKGVDYAAPIGTPIKATGDGKILEAGRKGGYGNAVVIQHGQRYRTIYGHMSRFAKGIR 397

Query: 571 AGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAME 630
           AGT+VKQGQIIG++G TGL+TGPHLHYE  +NG  VD    ++P  + L G   +RF  +
Sbjct: 398 AGTSVKQGQIIGYVGMTGLATGPHLHYEFQINGRHVDPLSAKLPMADPLGGADRKRFMAQ 457

Query: 631 KKRINSLLNNGENPKKPLFTSH 652
            + + + ++  +   K L   +
Sbjct: 458 TQPMIARMDQEK---KTLLALN 476


>gi|254243744|ref|ZP_04937066.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|126197122|gb|EAZ61185.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
          Length = 447

 Score =  371 bits (953), Expect = e-100,   Method: Composition-based stats.
 Identities = 111/474 (23%), Positives = 189/474 (39%), Gaps = 33/474 (6%)

Query: 180 DSFEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLD 239
            S EV  ++     ++   + +     +E  + +        ++      +  A      
Sbjct: 3   PSSEVEAKRTTLNLEL---ESNTDRLLQEKDDLLPQSVTNSSDEGTPFAQVEGASDDNTA 59

Query: 240 QRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNG 299
           ++       S             +   +    PE+    I +    T+      AG S  
Sbjct: 60  EQDSDKPGAS------------VADADIKPVDPEWKT--ISVASGDTLSTVFTKAGLSTS 105

Query: 300 DSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEY 359
               +  + K+  R   L   + +++ +  K +   +    +   +   + +   D    
Sbjct: 106 AMHDMLTSSKDAKRFTHLKVGQEVKLKLDPKGE---LQALRVKQSELETIGLDKTDKG-- 160

Query: 360 VLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQE 419
                            + T+     I   ++ A    G+  NL+  +       ++   
Sbjct: 161 ------YSFKREKAQIDLHTAYAHGRITSSLFVAGRNAGLPYNLITSLSNIFGYDIDFAL 214

Query: 420 HLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGK 479
            L+  D  +  +  +  N +      +L              R+ N    +  Y+  +G 
Sbjct: 215 DLREGDEFDVIYEQHKVNGKQVATGNILAARFVNRGKTYTAVRYTNKQG-NTSYYRADGS 273

Query: 480 SSRPFLLRTPVPFGRMTSGFG-MRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKAN 538
           S R   +RTPV F R++S F   R HPIL   R H GVD+AAP GTPI A GDG + +A 
Sbjct: 274 SMRKAFIRTPVDFARISSRFSLGRRHPILNKIRAHKGVDYAAPIGTPIKATGDGKILEAG 333

Query: 539 WAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYE 598
             GGYG   +I HG  Y + Y H    AK I+AGT+VKQGQIIG++G TGL+TGPHLHYE
Sbjct: 334 RKGGYGNAVVIQHGQRYRTIYGHMSRFAKGIRAGTSVKQGQIIGYVGMTGLATGPHLHYE 393

Query: 599 LIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
             +NG  VD    ++P  + L G   +RF  + + + + ++  +   K L   +
Sbjct: 394 FQINGRHVDPLSAKLPMADPLGGADRKRFMAQTQPMIARMDQEK---KTLLALN 444


>gi|152995101|ref|YP_001339936.1| peptidase M23B [Marinomonas sp. MWYL1]
 gi|150836025|gb|ABR70001.1| peptidase M23B [Marinomonas sp. MWYL1]
          Length = 470

 Score =  371 bits (953), Expect = e-100,   Method: Composition-based stats.
 Identities = 97/463 (20%), Positives = 188/463 (40%), Gaps = 23/463 (4%)

Query: 184 VTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHD 243
           +    I FP + T    D+     E    +++Q  L+     +           LD    
Sbjct: 20  LAVVLIAFPDEKTA---DNNLISLEANFEVIDQSQLMLQDLQRLNPKSNTVSIPLDATPS 76

Query: 244 HPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAK 303
           +  T + +I+        ++P+        F +  + ++   ++   +   G S  D  K
Sbjct: 77  NNATPTYEIQTPSNLVKKSTPET-------FKEQSVEVKSGDSLSKLLSSEGISAQDIYK 129

Query: 304 IAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGV 363
           ++ A K +  + Q+   + ++    +   +            +  L +   D+  +    
Sbjct: 130 VSLADKKQKTLLQMRPGQTIQFTTNETTGEL----------TQLTLILNRLDSVTFERND 179

Query: 364 EPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKP 423
                    +   +  + +   I + ++     +G++  L+  +       ++    ++ 
Sbjct: 180 NKFNRTETSRTPEVVQAYKEAEINNSLFVDGLRSGIDQPLLIELANIFGWDIDFALDIRK 239

Query: 424 TDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRP 483
            D L   +   + + +      ++           +  R+      +  Y+  +G + R 
Sbjct: 240 GDSLSILYEEKYLDGEKIGHGNIIAAQFINNGRTYQAIRYQTEKGAN--YYTPDGLAMRK 297

Query: 484 FLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGG 542
             +RTPV F R++S F     HPI   SR H GVD+AA  GTP+ A GDG +  A    G
Sbjct: 298 AFIRTPVDFTRISSKFNPNRLHPIFKTSRPHRGVDYAAASGTPVKAAGDGKISFAGKQNG 357

Query: 543 YGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVN 602
           YG   +I HG GY + Y H    +K  K G  V+QG II ++G TG +TGPHLHYE  +N
Sbjct: 358 YGNVVIIDHGKGYQTLYAHLKGFSKGTKRGARVQQGNIIAYVGQTGWATGPHLHYEFRIN 417

Query: 603 GIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPK 645
           G   +   V++P  + +  + L+ +    K++ + L+N  +P 
Sbjct: 418 GTHKNPVTVKLPNDDPMPKNDLKSYLPYAKQVVATLSNSHSPS 460


>gi|330812095|ref|YP_004356557.1| peptidase [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
 gi|327380203|gb|AEA71553.1| putative peptidase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 440

 Score =  371 bits (952), Expect = e-100,   Method: Composition-based stats.
 Identities = 103/442 (23%), Positives = 172/442 (38%), Gaps = 14/442 (3%)

Query: 204 AQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITS 263
              +           L    +  +     A+                +    +   T   
Sbjct: 3   PSSDVEAKKTTLSLELESPAEQLTQEQDAAEAVQATNEPAASPFAQIENSPQDTTETAAQ 62

Query: 264 PQVL-IDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEI 322
            +    ++        + +    T+       G  +    +I  + K   +  QL + + 
Sbjct: 63  AEAPVAEEKKGPDHREVIVAKGDTLSTLFEKVGLPSTSVHEILASDKQAKQFTQLQRGQK 122

Query: 323 LRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEE 382
           L   +        +            +T+  ND             +       +R++  
Sbjct: 123 LEFELNPDG---QLTNLHTKLSDLESITLTKNDKG--------YVFNRVTAKPTVRSAYV 171

Query: 383 SPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASD 442
              I   + ++ +  G++ +L   +       ++  + ++  D  +  +     N ++  
Sbjct: 172 HGVINSSLSQSAARAGLSHSLTMDMASVFGYDIDFAQDIRQGDEFDIIYEQKVVNGKSVG 231

Query: 443 DSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMR 502
           +  +L              R+ N    S  Y+  +G S R   +RTPV F R++S F   
Sbjct: 232 NGPILSARFTNRGKTYTAVRYTNKQGNS-SYYTADGNSMRKAFIRTPVDFARISSKFSAG 290

Query: 503 Y-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNH 561
             HPIL   R H GVD+AAPRGTPI A GDG V  A   GGYG   +I HGN Y + Y H
Sbjct: 291 RKHPILNKIRAHKGVDYAAPRGTPIKAAGDGKVLLAGRRGGYGNTVIIQHGNTYRTLYGH 350

Query: 562 QDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKG 621
               AK +K G  VKQGQ+IG+IGTTGLSTGPHLHYE  VNG+ VD    ++P  + +  
Sbjct: 351 MQGFAKGVKTGGTVKQGQVIGYIGTTGLSTGPHLHYEFQVNGVHVDPLGQKLPMADPIAK 410

Query: 622 DLLQRFAMEKKRINSLLNNGEN 643
               RF  + + + + ++  + 
Sbjct: 411 AERARFLAQSQPLMARMDQEKA 432


>gi|296387161|ref|ZP_06876660.1| hypothetical protein PaerPAb_03459 [Pseudomonas aeruginosa PAb1]
          Length = 462

 Score =  371 bits (952), Expect = e-100,   Method: Composition-based stats.
 Identities = 113/457 (24%), Positives = 181/457 (39%), Gaps = 23/457 (5%)

Query: 204 AQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENR---- 259
              E           L  N            PQ++    D    +++     ++N     
Sbjct: 18  PSSEVEAKRTTLNLELESNTDRLLQEKDDLLPQSVTNSSDEGTPFAQVEGASDDNTAEQD 77

Query: 260 ---TITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQ 316
                 S      K  +     I +    T+      AG S      +  + K+  R   
Sbjct: 78  SDKPGASVADADTKPVDPEWKTITVASGDTLSTVFTKAGLSTSAMHDMLTSSKDAKRFTH 137

Query: 317 LTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDY 376
           L   + +++ +  K +   +    +   +   + +   D                     
Sbjct: 138 LKVGQEVKLKLDPKGE---LQALRVKQSELETIGLDKTDKG--------YSFKREKAQID 186

Query: 377 MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHA 436
           + T+     I   ++ A    G+  NLV  +       ++    L+  D  +  +  +  
Sbjct: 187 LHTAYAHGRITSSLFVAGRNAGLPYNLVTSLSNIFGYDIDFALDLREGDEFDVIYEQHKV 246

Query: 437 NNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMT 496
           N +      +L              R+ N    +  Y+  +G S R   +RTPV F R++
Sbjct: 247 NGKQVATGNILAARFVNRGKTYTAVRYTNKQG-NTSYYRADGSSMRKAFIRTPVDFARIS 305

Query: 497 SGFG-MRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGY 555
           S F   R HPIL   R H GVD+AAP GTPI A GDG + +A   GGYG   +I HG  Y
Sbjct: 306 SRFSLGRRHPILNKIRAHKGVDYAAPIGTPIKATGDGKILEAGRKGGYGNAVVIQHGQRY 365

Query: 556 VSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPE 615
            + Y H    AK I+AGT+VKQGQIIG++G TGL+TGPHLHYE  +NG  VD    ++P 
Sbjct: 366 RTIYGHMSRFAKGIRAGTSVKQGQIIGYVGMTGLATGPHLHYEFQINGRHVDPLSAKLPM 425

Query: 616 RENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
            + L G   +RF  + + + + ++  +   K L   +
Sbjct: 426 ADPLGGADRKRFMAQTQPMIARMDQEK---KTLLALN 459


>gi|312963385|ref|ZP_07777867.1| peptidase, M23/M37 family [Pseudomonas fluorescens WH6]
 gi|311282191|gb|EFQ60790.1| peptidase, M23/M37 family [Pseudomonas fluorescens WH6]
          Length = 498

 Score =  369 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 108/422 (25%), Positives = 170/422 (40%), Gaps = 17/422 (4%)

Query: 232 YADPQTLDQRHDHPITYSKKIKIIEENRTIT-SPQVLIDKIPEFADDLIPIQHNTTIFDA 290
            +D Q              +    +  + +   P+   D         + +    T+   
Sbjct: 89  ASDAQQATNAPAESPFAQIESTPEDTQQAVQDQPKPAADTAKNAQHREVIVAKGDTLSTL 148

Query: 291 MVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLT 350
               G       ++  + K   +  QL   + L   +       T+              
Sbjct: 149 FEKVGLPAATVNEVLTSDKQAKQFTQLKHGQKLEFELTPDGQLNTLHSN----------- 197

Query: 351 IALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRT 410
           +   ++     G +    +       MR++     I   + ++ +  G++ N+   +   
Sbjct: 198 VNDLESISLTRGAKGFAFNRITTKPVMRSAYVHGVINSSLSQSAARAGLSHNMTMDMASV 257

Query: 411 LASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGS 470
               ++  + ++  D  +  +    AN +      +L              R+ N    S
Sbjct: 258 FGYDIDFAQDIRQGDEFDVIYEQKVANGKVVGTGNILSARFTNRGKTYTAVRYTNKQGNS 317

Query: 471 VEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAV 529
             Y+  +G S R   +RTPV F R++S F M   HPIL   R H GVD+AAPRGTPI A 
Sbjct: 318 -SYYTADGNSMRKAFIRTPVDFARISSRFSMGRKHPILNKIRAHKGVDYAAPRGTPIKAA 376

Query: 530 GDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGL 589
           GDG V  A   GGYG   +I HGN Y + Y H    AK +K G  VKQGQ+IG+IGTTGL
Sbjct: 377 GDGKVLLAGRRGGYGNTVIIQHGNTYRTLYGHMQGFAKGVKTGGNVKQGQVIGYIGTTGL 436

Query: 590 STGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLF 649
           STGPHLHYE  VNG+ VD    ++P  + +      RF  + +    L+   +  +  L 
Sbjct: 437 STGPHLHYEFQVNGVHVDPLGQKLPMADPIAKAERARFMQQSQ---PLMARMDQERSTLL 493

Query: 650 TS 651
            S
Sbjct: 494 AS 495


>gi|292491223|ref|YP_003526662.1| peptidase M23 [Nitrosococcus halophilus Nc4]
 gi|291579818|gb|ADE14275.1| Peptidase M23 [Nitrosococcus halophilus Nc4]
          Length = 481

 Score =  369 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 89/430 (20%), Positives = 164/430 (38%), Gaps = 13/430 (3%)

Query: 220 LHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFA---D 276
           L     +           +D      I                +                
Sbjct: 49  LTLYGRELSAYPTRPLTQIDHLTLGTIAAGTIAARQPLPTQKPAAIAAKPHAITPDLHNW 108

Query: 277 DLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTI 336
             I I+    +       G S     ++         +  L   ++L+I +   +D   +
Sbjct: 109 QNITIKKGDNLSRIFSRLGLSPRQVHEVMSLGNPVRPLALLRPGQLLQIALKGDNDSRQL 168

Query: 337 VRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSF 396
               +       L +   D+          +     +    R    +  + + +++    
Sbjct: 169 AALRLNFSPIEYLEVQAKDD--------KFQAKRISRNVQTRLETVTGTVENSLFKDGLQ 220

Query: 397 NGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGET 456
            G+ +  +  + +     ++    L+  D  +  F  ++  ++   +  ++         
Sbjct: 221 AGLTNKQIMELTQIFGWDIDFALDLRSGDNFKVLFEEHYLQDKKVQNGPIVAAEFTNRGK 280

Query: 457 RTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTG 515
             R  R+ +    S  Y+   G S R   LRTPV + R++S F ++  HP+L   R H G
Sbjct: 281 TFRAIRYPDGNGHSA-YYTPAGLSMRKAFLRTPVNYSRISSHFNLQRKHPVLNRIRAHKG 339

Query: 516 VDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAV 575
           VD+AAP GTP+ A GDG V      GGYGK  ++ HG  Y + Y H     + +K G  +
Sbjct: 340 VDYAAPIGTPVKAAGDGKVVFVGRKGGYGKAVILQHGTKYSTLYGHLSRFKRGLKVGARI 399

Query: 576 KQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRIN 635
            QG++I ++G TGL+TGPHLHYE +VNG+  +   V++P+   +   L Q F     ++ 
Sbjct: 400 SQGEVIAYVGQTGLATGPHLHYEFLVNGVHRNPLTVKLPQANPIPSQLQQDFQRHATKLV 459

Query: 636 SLLNNGENPK 645
           + L+  +N  
Sbjct: 460 AQLDAADNTT 469


>gi|330813114|ref|YP_004357353.1| peptidase, M23/M37 family [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486209|gb|AEA80614.1| peptidase, M23/M37 family [Candidatus Pelagibacter sp. IMCC9063]
          Length = 433

 Score =  369 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 105/373 (28%), Positives = 191/373 (51%), Gaps = 8/373 (2%)

Query: 274 FADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDK 333
               +I +    ++   ++    S  +  KI +  K  V + ++ + + + I    K +K
Sbjct: 68  PNKKIIKVVAGDSLQKILLKEKISKVEVNKIYQKTKGIVDLTKIKQGQTITIIFRIKQNK 127

Query: 334 FTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRA 393
            +I R +    +     I       Y    +  ++ +N +            I + ++ +
Sbjct: 128 PSISRITFQVDELSTAYI------YYSNKTDDYEVRLNQKNLEKINFLAKGVIVNSLFAS 181

Query: 394 TSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSV-NHANNQASDDSELLYIHAR 452
                +++ +V    R     ++ Q  ++  D    F+        +   +  +L+ + +
Sbjct: 182 AQKIDVDAEVVVEFARIFGFEIDFQRDIRKNDEFRIFYERFEDDEGENFKNGNILFAYLK 241

Query: 453 FGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRM 512
                 + YR+ +    ++ YF  +GKS    L++TP+   R++SG+GMR HPILGY+++
Sbjct: 242 NSGREIKLYRYKD-SKNNIGYFTPDGKSIEKALMKTPINGARLSSGYGMRKHPILGYNKL 300

Query: 513 HTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAG 572
           H G D+AA RGTP++A G G VE+A+W G YGK   I H + Y ++Y H     +NIKAG
Sbjct: 301 HQGTDFAARRGTPVMASGSGTVERASWFGAYGKYVRIRHNSTYKTAYAHLSKFGRNIKAG 360

Query: 573 TAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKK 632
             VKQGQIIG++G+TG STGPHLHYE++VN  +++S ++++P  + L  + ++ F +EK+
Sbjct: 361 RKVKQGQIIGYVGSTGRSTGPHLHYEVLVNNKRINSQRLKLPSGKKLSQNEMENFNLEKQ 420

Query: 633 RINSLLNNGENPK 645
           RI+ L    +  K
Sbjct: 421 RIDQLAEISKTTK 433


>gi|254448492|ref|ZP_05061952.1| M23 peptidase domain protein [gamma proteobacterium HTCC5015]
 gi|198261875|gb|EDY86160.1| M23 peptidase domain protein [gamma proteobacterium HTCC5015]
          Length = 500

 Score =  369 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 98/466 (21%), Positives = 176/466 (37%), Gaps = 20/466 (4%)

Query: 186 TQKINFPTDITRIQLDHTA---QDEEIKNAIMNQFFLLHNKKNQSF---TLYYADPQTLD 239
              + F T+    Q   T      E I  A+  +   +  +++              TL 
Sbjct: 39  ISSVLFLTESEDTQASSTPATTSQEGITLALPQERDQVSEQESLLPPQKIAPPTTASTLA 98

Query: 240 QRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNG 299
                P   +++     + + +                   ++   ++      A     
Sbjct: 99  APRSEPAAPTQEAAATSDAKELPDQPTTTASDKALEWQTARVKSGDSLARIAYRADIKAS 158

Query: 300 DSAKIAKALKNEVR-VDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNE 358
           +   +       ++ + ++   + LR       D   ++           L++  N    
Sbjct: 159 EIHHLMNTDNEAIQTLTRIRPGDELRYRSSASGD---LLALEYDTSDTERLSVIKN---- 211

Query: 359 YVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQ 418
                +    ++  +   +  +  S  I   ++      G++ NL+  +       ++  
Sbjct: 212 ----GDQFAAEVIARPYDVFENRISATIDSSLFGTAKAAGLSDNLIMELANIFGYDIDFA 267

Query: 419 EHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENG 478
             ++  D     +     N +   D +++           R  R+ +    + +Y+  NG
Sbjct: 268 LDVRHGDTFTVIWKEYFRNGEKIKDGDIIAAEFINNGRTVRGVRYTDASGHT-DYYAPNG 326

Query: 479 KSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKA 537
            S R   +R+PV F R++S F     HPI    R H GVD+AA  GTPI+A GDG V   
Sbjct: 327 DSLRKAFIRSPVHFTRISSKFNPNRLHPIYKTRRPHRGVDYAARTGTPIMAAGDGKVIFR 386

Query: 538 NWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHY 597
              GGYG   +I HG  Y + Y H  +  + +  GT VKQGQ+IG++G TG +TGPHLHY
Sbjct: 387 GKKGGYGNCVIIQHGQRYNTLYAHMSSFNRKVGYGTRVKQGQVIGYVGATGWATGPHLHY 446

Query: 598 ELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGEN 643
           E  VNG+  +   V++P  E LK      F    + + + LN    
Sbjct: 447 EFRVNGVHRNPLTVKLPSAEPLKAQYKADFERFSQPLMAQLNTLTR 492


>gi|325271185|ref|ZP_08137738.1| peptidase M23B [Pseudomonas sp. TJI-51]
 gi|324103696|gb|EGC00990.1| peptidase M23B [Pseudomonas sp. TJI-51]
          Length = 473

 Score =  369 bits (947), Expect = e-100,   Method: Composition-based stats.
 Identities = 111/453 (24%), Positives = 183/453 (40%), Gaps = 21/453 (4%)

Query: 205 QDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSP 264
              E++         L +   Q      A P    Q          +     E +    P
Sbjct: 35  PSSEVEAKKTTLNLELESPAEQLKDEARAAPMVQAQGEQGSPFAQIEAA-TPETQKAEQP 93

Query: 265 QVLIDKIPEFAD----DLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKD 320
                ++ E A       + +    T+       G        +  + K   +  QL   
Sbjct: 94  TQDAKQVAEAAKQPGHREVTVARGDTLSTLFAKVGLPANAVHDLLASNKQAKQFTQLKHG 153

Query: 321 EILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTS 380
           ++L+  + +     ++              ++  +        +    +       +RT+
Sbjct: 154 QVLQFELDKDGQLASLHS-----------KVSNLETISLSKSAKGFTFNREISKPVVRTA 202

Query: 381 EESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQA 440
                I   +  +    G++ ++   + R L   ++  + ++P D  +  +     + + 
Sbjct: 203 YAHGVIKSSLSASAQRAGLSHSMTMDMARVLGYDIDFAQDIRPGDEFDVVYEQKVMDGKV 262

Query: 441 SDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFG 500
                +L              R+ N    +  Y+  +G S R   +RTPV F R++S F 
Sbjct: 263 VGTGNILSARFTNRGKTYTAVRYTNKQGNTT-YYTADGNSLRKAFIRTPVDFARISSRFS 321

Query: 501 MRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSY 559
               HPIL   R H GVD+AAPRGTPI A GDG +E A   GGYG   +I HGN Y + Y
Sbjct: 322 AGRKHPILNKIRAHKGVDYAAPRGTPIKAAGDGRIELAGRRGGYGNTVIIQHGNRYKTLY 381

Query: 560 NHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENL 619
            H    AK IK G+ VKQGQIIG+IGTTGLSTGPHLHYE  VNG+ VD    ++P  + +
Sbjct: 382 GHMQGFAKGIKTGSTVKQGQIIGYIGTTGLSTGPHLHYEFQVNGVHVDPLSQKVPMADPI 441

Query: 620 KGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
             +  QRF  + + + + ++  +     L  ++
Sbjct: 442 AKNERQRFLQQSQPLIARMDQEKA---TLLAAN 471


>gi|298485367|ref|ZP_07003458.1| Peptidase, M23/M37 family [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|298160134|gb|EFI01164.1| Peptidase, M23/M37 family [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
          Length = 479

 Score =  369 bits (947), Expect = e-100,   Method: Composition-based stats.
 Identities = 103/451 (22%), Positives = 176/451 (39%), Gaps = 13/451 (2%)

Query: 203 TAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTIT 262
            + + E K   ++    + ++  Q      A   T +                ++  T  
Sbjct: 35  PSSEVEAKRTNLSLDLEMPDQDVQDQDAPDAAQATPETTESPFAQIDNADDQAQDTATAQ 94

Query: 263 SPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEI 322
           S         +     + +    T+       G       ++  + K   +  +L   + 
Sbjct: 95  SDAEKPAPAKDPNHREVIVSKGDTLSTLFEKVGLPAATVHEVLASDKQAKQFTKLQNGQT 154

Query: 323 LRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEE 382
           L+  +        +              ++  +             +       +R +  
Sbjct: 155 LQFELSPDGQLKQLH-----------TKLSELETISLSKSASGFVFNREISKPNVRNAYV 203

Query: 383 SPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASD 442
              I   + ++    G+  ++   +       ++  + ++  D  +  +     N ++  
Sbjct: 204 HGVINSSLSQSAQRAGLTHSMTMDMANIFGYDIDFAQDIRKGDEFDVVYEQKVVNGKSVG 263

Query: 443 DSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMR 502
              +L              R+ N    +  Y+  +G S R   +RTPV F R++S F M 
Sbjct: 264 TGNILSARFTNRGKTYTAVRYTNKQG-NTNYYTADGNSMRKAFIRTPVDFARISSMFSMG 322

Query: 503 Y-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNH 561
             HPIL   R H GVD+AAPRGTPI A GDG V  A   GGYG   +I HG+ Y + Y H
Sbjct: 323 RKHPILNKIRAHKGVDYAAPRGTPIKATGDGKVLLAGRRGGYGNTVIIQHGDTYRTLYGH 382

Query: 562 QDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKG 621
               AK I+ G  VKQGQ+IG+IGTTGLSTGPHLHYE  VNG+ VD    ++P  + +  
Sbjct: 383 MQGFAKGIQTGGTVKQGQVIGYIGTTGLSTGPHLHYEFQVNGVHVDPLGQKLPMADPIAK 442

Query: 622 DLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
              QRF  + + + + ++    P+ P    +
Sbjct: 443 SEKQRFMQQSQPLMARMDQERPPRWPRIKGN 473


>gi|262277605|ref|ZP_06055398.1| M23/M37 peptidase [alpha proteobacterium HIMB114]
 gi|262224708|gb|EEY75167.1| M23/M37 peptidase [alpha proteobacterium HIMB114]
          Length = 423

 Score =  368 bits (945), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 109/369 (29%), Positives = 193/369 (52%), Gaps = 12/369 (3%)

Query: 276 DDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFT 335
              I I+   ++   +  AG S  +   I+K L+  + + ++  ++I  +   +  D   
Sbjct: 66  KKTIGIKKGQSLNSILSEAGASQKEIFNISKILRQYISLKKINTNQIFEVLTNK--DNGE 123

Query: 336 IVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATS 395
           I+R ++     + L I   D N++V       +     +           I   +++A  
Sbjct: 124 IIRLTVNLDNINSLHIFKKD-NKFVANKIEKVLYKKTVLGE-------GLIKSSLFQAAQ 175

Query: 396 FNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVN-HANNQASDDSELLYIHARFG 454
              +++ +V    R     ++ Q  ++  D  +  +      + +   + E++Y + +  
Sbjct: 176 KENIDAEVVVDFARIFGFEIDFQRDIRKNDIFQIVYDKYVDDDGELQKNGEIIYAYMKNR 235

Query: 455 ETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHT 514
                 YRF++       Y+  NGKS    L++TP+   R++S +GMR HPILGY++MH 
Sbjct: 236 GREIALYRFVDQKGI-PGYYQTNGKSIEKALMKTPINGARLSSTYGMRKHPILGYNKMHR 294

Query: 515 GVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTA 574
           G D+AAP+GTPI+A G GI+E A W G YGK   I H + Y ++Y H +  A+ IK G  
Sbjct: 295 GTDFAAPKGTPIMASGSGIIEMAKWNGAYGKYIRIRHNSKYKTAYAHLNGYARGIKRGAK 354

Query: 575 VKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRI 634
           V+QGQIIG++G+TG STGPHLHYE++VNG + +S ++++P    LKG+  ++F + + +I
Sbjct: 355 VRQGQIIGYVGSTGRSTGPHLHYEVLVNGKRRNSQRLKLPSGRTLKGEDREKFEISRIKI 414

Query: 635 NSLLNNGEN 643
           + + +N  N
Sbjct: 415 DVMRSNLVN 423


>gi|298531041|ref|ZP_07018442.1| Peptidase M23 [Desulfonatronospira thiodismutans ASO3-1]
 gi|298509064|gb|EFI32969.1| Peptidase M23 [Desulfonatronospira thiodismutans ASO3-1]
          Length = 495

 Score =  368 bits (945), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 114/441 (25%), Positives = 192/441 (43%), Gaps = 14/441 (3%)

Query: 208 EIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVL 267
            I+ +I     L     + S     +         D     ++          I      
Sbjct: 62  TIEQSIPEASGLQTAGDSSSSADTASPEIVPGNTGDALAQEAQA----PGTGDILDAGDQ 117

Query: 268 IDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGV 327
            +   + ++  I +    T+   +   G     + +I + L       ++ + + + +  
Sbjct: 118 KEVRAKLSEKNIRVSSGDTLMGLLNGEGLPRTQAHEIIEELSEVYNPRRIRQGQEITLVF 177

Query: 328 VQKDDKFTIVR-FSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNI 386
            ++DD+  I    ++       + +     N  V   E  ++D        RT      I
Sbjct: 178 REEDDQEPIFEAMNLKLDVDRDVRVEKCPENGLVATEEKRELD-------TRTVVAQAEI 230

Query: 387 YDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFF-SVNHANNQASDDSE 445
              ++ A   + M   ++  ++R  +  V+ Q  ++P D  E  F      +        
Sbjct: 231 TSSLYNAAVASDMPLRVLMQMIRAYSFDVDFQRDIRPGDSFEVMFKEKLDQDGNFVRGGS 290

Query: 446 LLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHP 505
           +LY   +        YR+       V++FN +G+S R  L+ TP+   R+TSG+G R HP
Sbjct: 291 VLYATLKTRGRDLPIYRYETTDG-EVDFFNPDGESVRKTLMVTPIDGARLTSGYGKRRHP 349

Query: 506 ILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAI 565
           ILGYSRMH G+D+AAP GTPI+A GDG+VE A   G YG    I H N Y + Y H    
Sbjct: 350 ILGYSRMHQGLDFAAPTGTPIMAAGDGVVEYAGRKGNYGNYIRIRHPNEYHTVYAHLSRF 409

Query: 566 AKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQ 625
              ++ G  V+QGQ IG++G+TG+STGPHLHYE+   G  V+ + V  P    L+G+ LQ
Sbjct: 410 GSGVRRGARVEQGQTIGYVGSTGMSTGPHLHYEVHHRGSHVNPSTVDTPPGRTLEGEELQ 469

Query: 626 RFAMEKKRINSLLNNGENPKK 646
           RF   ++ + +L  + ++   
Sbjct: 470 RFKAAREDLETLFASLKDEDT 490


>gi|152989299|ref|YP_001346203.1| hypothetical protein PSPA7_0808 [Pseudomonas aeruginosa PA7]
 gi|150964457|gb|ABR86482.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7]
          Length = 468

 Score =  367 bits (943), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 110/450 (24%), Positives = 179/450 (39%), Gaps = 20/450 (4%)

Query: 204 AQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITS 263
              E           L  N            PQ++    D    +++      E  + T 
Sbjct: 35  PSSEVEAKRTTLNLELESNTDRILQEKDDLLPQSVTNSSDEGTPFAQAEGA--EQNSDTP 92

Query: 264 PQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEIL 323
                   PE+    + +    T+      AG S      +  + K+  R   L   + +
Sbjct: 93  VSAAKPVDPEW--KSVTVASGDTLSTVFAKAGLSTSAMHDMLASSKDAKRFTHLKVGQEV 150

Query: 324 RIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEES 383
           ++ +    +   +    +   +   + +                         + T+   
Sbjct: 151 KLKLDPNGE---LQALRVKQSELETIGLDKTAKG--------YAFKREKAQIDLHTAYAH 199

Query: 384 PNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDD 443
             I   ++ A    G+  NLV  +       ++    L+  D  +  +  +  N +    
Sbjct: 200 GRITSSLFVAGRNAGLPYNLVTSLSNIFGYDIDFALDLREGDEFDVIYEQHKVNGKQVAT 259

Query: 444 SELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFG-MR 502
             +L              R+ N    +  Y+  +G S R   +RTPV F R++S F   R
Sbjct: 260 GNILAARFVNRGKTYTAVRYTNKQG-NTSYYRADGSSMRKAFIRTPVDFARISSRFSLGR 318

Query: 503 YHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQ 562
            HPIL   R H GVD+AAP GTPI A GDG + +A   GGYG   +I HG  Y + Y H 
Sbjct: 319 RHPILNKIRAHKGVDYAAPIGTPIKATGDGKILQAGRKGGYGNAVVIQHGQRYRTIYGHM 378

Query: 563 DAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGD 622
              AK I++GT+VKQGQIIG++G TGL+TGPHLHYE  +NG  VD    ++P  + L G 
Sbjct: 379 SRFAKGIRSGTSVKQGQIIGYVGMTGLATGPHLHYEFQINGRHVDPLSAKLPMADPLGGA 438

Query: 623 LLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
             +RF  + + + + ++  +   K L   +
Sbjct: 439 DRKRFMAQTQPMIARMDQEK---KTLLALN 465


>gi|289623556|ref|ZP_06456510.1| M24/M37 family peptidase [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289650838|ref|ZP_06482181.1| M24/M37 family peptidase [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|330868551|gb|EGH03260.1| M24/M37 family peptidase [Pseudomonas syringae pv. aesculi str.
           0893_23]
          Length = 472

 Score =  367 bits (942), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 103/451 (22%), Positives = 175/451 (38%), Gaps = 16/451 (3%)

Query: 203 TAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTIT 262
            + + E K   ++    + ++  Q      A   T +                ++  T  
Sbjct: 35  PSSEVEAKRTNLSLDLEMPDQDVQDQDAPDAAQATPETTESPFAQIDNADDQAQDTATAQ 94

Query: 263 SPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEI 322
           S         +     + +    T+       G       ++  + K   +  +L   + 
Sbjct: 95  SDAEKPAPAKDPNHREVIVSKGDTLSTLFEKVGLPAATVHEVLASDKQAKQFTKLQNGQT 154

Query: 323 LRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEE 382
           L+  +        +              ++  D             +       +R +  
Sbjct: 155 LQFELSPDGQLKQLH-----------TKLSELDTISLSKSASGFVFNREISKPNVRNAYV 203

Query: 383 SPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASD 442
              I   + ++    G+  ++   +       ++  + ++  D  +  +     N ++  
Sbjct: 204 HGVINSSLSQSAQRAGLTHSMTMDMANIFGYDIDFAQDIRKGDEFDVVYEQKVVNGKSVG 263

Query: 443 DSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMR 502
              +L              R+ N    +  Y+  +G S R   +RTPV F R++S F M 
Sbjct: 264 TGNILSARFTNRGKTYTAVRYTNKQG-NTNYYTADGNSMRKAFIRTPVDFARISSMFSMG 322

Query: 503 Y-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNH 561
             HPIL   R H GVD+AAPRGTPI A GDG V  A   GGYG   +I HG+ Y + Y H
Sbjct: 323 RKHPILNKIRAHKGVDYAAPRGTPIKATGDGKVLLAGRRGGYGNTVIIQHGDTYRTLYGH 382

Query: 562 QDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKG 621
               AK I+ G  VKQGQ+IG+IGTTGLSTGPHLHYE  VNG+ VD    ++P  + +  
Sbjct: 383 MQGFAKGIQTGGTVKQGQVIGYIGTTGLSTGPHLHYEFQVNGVHVDPLGQKLPMADPIAK 442

Query: 622 DLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
              QRF  + + + + ++  +        S+
Sbjct: 443 SEKQRFMQQSQPLMARMDQEKATT---LASN 470


>gi|40062644|gb|AAR37565.1| M23/M37 peptidase domain protein [uncultured marine bacterium 313]
          Length = 447

 Score =  367 bits (942), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 107/391 (27%), Positives = 179/391 (45%), Gaps = 12/391 (3%)

Query: 259 RTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLT 318
            T     +L      F +    I+   +I   +      N +   +    K     +QL 
Sbjct: 66  LTSVKEFLLTLIKSPFTNINYEIKSGDSIQKILKKLKVQNNEIQTVINQYKKYSNPNQLL 125

Query: 319 KDEILRIGVVQKDDKFT--IVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDY 376
               + I + +   K    IV+F+I   +   + I  N+  + +      K         
Sbjct: 126 TGNKIDIIIEENLSKKNYSIVKFAIPITESTTIEINKNEQGKILSKKIITKFYKKRTFSE 185

Query: 377 MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSV-NH 435
                    I + ++ +     +N + +    R     ++ Q  ++  D+ +  +     
Sbjct: 186 -------NVIKNNLYSSAIKAKINPDTIIEFARIFGFEIDFQRDIRKNDYFKIVYDKYFD 238

Query: 436 ANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRM 495
            N +      + Y+H            +    D +  YF+ NGKS    L++TP+   R+
Sbjct: 239 ENGEFVKSGTIHYVHMSVNGREIT--LYKFGGDKNYGYFDINGKSVEKALMKTPINGARL 296

Query: 496 TSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGY 555
           +S FGMR HPILG+++MHTG D+AAP GTPI+A G G +  A W GG G    I H + Y
Sbjct: 297 SSNFGMRKHPILGFNKMHTGTDFAAPSGTPIMASGSGTIVLAKWCGGGGNCIKIKHNSTY 356

Query: 556 VSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPE 615
            + Y H  + A+ +K G  V+QG+IIG++G+TG+STGPHLHYE+IVNG KV+S  +++P 
Sbjct: 357 KTVYAHMKSFARGMKKGKKVRQGEIIGYVGSTGMSTGPHLHYEVIVNGKKVNSRTLKLPS 416

Query: 616 RENLKGDLLQRFAMEKKRINSLLNNGENPKK 646
            + LK    + F + + + + L+      KK
Sbjct: 417 GKILKDHERKLFEIHRIKTDVLIAEMIADKK 447


>gi|167031481|ref|YP_001666712.1| peptidase M23B [Pseudomonas putida GB-1]
 gi|166857969|gb|ABY96376.1| peptidase M23B [Pseudomonas putida GB-1]
          Length = 473

 Score =  367 bits (941), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 109/453 (24%), Positives = 184/453 (40%), Gaps = 21/453 (4%)

Query: 205 QDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTI--- 261
              E++         L +   Q      A P    +          +     E +     
Sbjct: 35  PSSEVEAKKTTLNLELESPAEQLKDESRAAPLVQAEGEQGSPFAQIEDA-APETQKAEQQ 93

Query: 262 -TSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKD 320
             + + + +   E     + +    T+       G        +  + K   +  QL   
Sbjct: 94  TPTAEPVAEAAKEPGHREVTVARGDTLSTLFAKVGLPANAVHDVLASNKQAKQFSQLKHG 153

Query: 321 EILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTS 380
           ++L+  + +     ++              ++  +        +    +       +RT+
Sbjct: 154 QVLQFELDKDGQLASLHS-----------KVSNLETIRLTKTAKGYAFNREISKPVVRTA 202

Query: 381 EESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQA 440
                I   +  +    G++ ++   + R L   ++  + ++P D  +  +     + + 
Sbjct: 203 YAHGVIKSSLSASAQRAGLSHSMTMDMARVLGYDIDFAQDIRPGDEFDVVYEQKVMDGKV 262

Query: 441 SDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFG 500
                +L              R+ N    S  Y+  +G S R   +RTPV F R++S F 
Sbjct: 263 VGTGNILSARFTNRGKTYTAVRYTNKQGNST-YYTADGNSLRKAFIRTPVDFARISSRFS 321

Query: 501 MRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSY 559
               HPIL   R H GVD+AAPRGTPI A GDG +E A   GGYG   +I HGN Y + Y
Sbjct: 322 AGRKHPILNKIRAHKGVDYAAPRGTPIKAAGDGRIELAGRRGGYGNTVIIQHGNRYKTLY 381

Query: 560 NHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENL 619
            H    AK IK G++VKQGQIIG+IGTTGLSTGPHLHYE  VNG+ VD    ++P  + +
Sbjct: 382 GHMQGFAKGIKTGSSVKQGQIIGYIGTTGLSTGPHLHYEFQVNGVHVDPLSQKVPMADPI 441

Query: 620 KGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
             +  QRF  + + + + ++  +     L  ++
Sbjct: 442 AKNERQRFLQQSQPLIARMDQEKA---TLLAAN 471


>gi|330891257|gb|EGH23918.1| M24/M37 family peptidase [Pseudomonas syringae pv. mori str.
           301020]
          Length = 472

 Score =  366 bits (940), Expect = 6e-99,   Method: Composition-based stats.
 Identities = 103/451 (22%), Positives = 175/451 (38%), Gaps = 16/451 (3%)

Query: 203 TAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTIT 262
            + + E K   ++    + ++  Q      A   T +                +E  T  
Sbjct: 35  PSSEVEAKRTNLSLDLEMPDQGVQDQDAPDAAQATPETTESPFAQIDNADDQAQETATAQ 94

Query: 263 SPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEI 322
           S         +     + +    T+       G       ++  + K   +  +L   + 
Sbjct: 95  SDAEKPTPAKDPNHREVIVSKGDTLSTLFEKVGLPAATVHEVLASDKQAKQFTKLQNGQT 154

Query: 323 LRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEE 382
           L+  + Q      +              ++  +             +       +R +  
Sbjct: 155 LQFELSQDGQLKQLH-----------TKLSELETISLSKSASGFVFNREISKPNVRNAYV 203

Query: 383 SPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASD 442
              I   + ++    G+  ++   +       ++  + ++  D  +  +     N ++  
Sbjct: 204 HGVINSSLSQSAQRAGLTHSMTMDMANIFGYDIDFAQDIRKGDEFDVVYEQKVVNGKSVG 263

Query: 443 DSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMR 502
              +L              R+ N    +  Y+  +G S R   +RTPV F R++S F M 
Sbjct: 264 TGNILSARFTNRGKTYTAVRYTNKQG-NTNYYTADGNSMRKAFIRTPVDFARISSMFSMG 322

Query: 503 Y-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNH 561
             HPIL   R H GVD+AAPRGTPI A GDG V  A   G YG   +I HG+ Y + Y H
Sbjct: 323 RKHPILNKIRAHKGVDYAAPRGTPIKATGDGKVLLAGRRGVYGNTVIIQHGDTYRTLYGH 382

Query: 562 QDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKG 621
               AK I+ G  VKQGQ+IG+IGTTGLSTGPHLHYE  VNG+ VD    ++P  + +  
Sbjct: 383 MQGFAKGIQTGGTVKQGQVIGYIGTTGLSTGPHLHYEFQVNGVHVDPLGQKLPMADPIAK 442

Query: 622 DLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
              QRF  + + + + ++  +        S+
Sbjct: 443 SEKQRFMQQSQPLMARMDQEKATT---LASN 470


>gi|170723925|ref|YP_001751613.1| peptidase M23B [Pseudomonas putida W619]
 gi|169761928|gb|ACA75244.1| peptidase M23B [Pseudomonas putida W619]
          Length = 472

 Score =  366 bits (939), Expect = 6e-99,   Method: Composition-based stats.
 Identities = 107/452 (23%), Positives = 181/452 (40%), Gaps = 17/452 (3%)

Query: 202 HTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTI 261
            +++ E  K  +  +      +               DQ            K  +  + +
Sbjct: 35  PSSEVEAKKTTLSLELESPSEQLKDESGAAPLVQTEADQGSPFAQIEGADSKTEQATQEL 94

Query: 262 TSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDE 321
              +    +  E     + +    T+       G        +  + K   +  QL   +
Sbjct: 95  PPLEQ-QPEAKEPGHREVTVARGDTLSTLFAKVGLPANAVHDLLASSKQAKQFSQLKHGQ 153

Query: 322 ILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSE 381
           +L+  +       ++              ++  +        +    D       +RT+ 
Sbjct: 154 VLQFELDNDGQLASL-----------QSKVSTLETIRLTKTAKGYSFDREISKPVVRTAY 202

Query: 382 ESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQAS 441
               I   +  +    G++ +L   + + L   ++  + ++  D  +  +     + +  
Sbjct: 203 AHGVIKSSLSASAQRAGLSHSLTMDMAKVLGYDIDFAQDIRQGDEFDVVYEQKVMDGKVI 262

Query: 442 DDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGM 501
               +L              R+ N    +  Y+  +G S R   +RTPV F R++S F  
Sbjct: 263 GTGNILSARFTNRGKTYTAVRYTNKQG-NTSYYTADGNSLRKAFIRTPVDFARISSRFSA 321

Query: 502 RY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYN 560
              HPIL   R H GVD+AAPRGTPI A GDG +E A   GGYG   +I HGN Y + Y 
Sbjct: 322 GRKHPILNKIRAHKGVDYAAPRGTPIKAAGDGRIELAGRRGGYGNTVIIAHGNRYKTLYG 381

Query: 561 HQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLK 620
           H    AK IK G++VKQGQIIG+IGTTGLSTGPHLHYE  VNG+ VD    ++P  + + 
Sbjct: 382 HMQGFAKGIKTGSSVKQGQIIGYIGTTGLSTGPHLHYEFQVNGVHVDPLSQKVPMSDPIA 441

Query: 621 GDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
               QRF  + K + + ++  +     +  ++
Sbjct: 442 KAERQRFLQQSKPLIARMDQEKA---TMLAAN 470


>gi|257483167|ref|ZP_05637208.1| M24/M37 family peptidase [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|330985736|gb|EGH83839.1| M24/M37 family peptidase [Pseudomonas syringae pv. lachrymans str.
           M301315]
 gi|331011599|gb|EGH91655.1| M24/M37 family peptidase [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 472

 Score =  366 bits (939), Expect = 7e-99,   Method: Composition-based stats.
 Identities = 102/463 (22%), Positives = 174/463 (37%), Gaps = 27/463 (5%)

Query: 191 FPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSK 250
           FP+     +       +        Q     +    +     +    +D   D       
Sbjct: 34  FPSSEVEAKR-TNLSLDLEMPDQDVQDQDAPDAAQATPETTESPFAQIDNADDQ------ 86

Query: 251 KIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKN 310
                ++  T  S         +     + +    T+       G       ++  + K 
Sbjct: 87  ----AQDTATAQSDAEKPAPAKDPNHREVIVSKGDTLSTLFEKVGLPAATVHEVLASDKQ 142

Query: 311 EVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDI 370
             +  +L   + L+  +        +              ++  +             + 
Sbjct: 143 AKQFTKLQNGQTLQFELSPDGQLKQLH-----------TKLSELETISLSKSASGFVFNR 191

Query: 371 NHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETF 430
                 +R +     I   + ++    G+  ++   +       ++  + ++  D  +  
Sbjct: 192 EISKPNVRNAYVHGVINSSLSQSAQRAGLTHSMTMDMANIFGYDIDFAQDIRKGDEFDVV 251

Query: 431 FSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPV 490
           +     N ++     +L              R+ N    +  Y+  +G S R   +RTPV
Sbjct: 252 YEQKVVNGKSVGTGNILSARFTNRGKTYTAVRYTNKQG-NTNYYTADGNSMRKAFIRTPV 310

Query: 491 PFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLI 549
            F R++S F M   HPIL   R H GVD+AAPRGTPI A GDG V  A   GGYG   +I
Sbjct: 311 DFARISSMFSMGRKHPILNKIRAHKGVDYAAPRGTPIKATGDGKVLLAGRRGGYGNTVII 370

Query: 550 HHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDST 609
            HG+ Y + Y H    AK I+ G  VKQGQ+IG+IGTTGLSTGPHLHYE  VNG+ VD  
Sbjct: 371 QHGDTYRTLYGHMQGFAKGIQTGGTVKQGQVIGYIGTTGLSTGPHLHYEFQVNGVHVDPL 430

Query: 610 KVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
             ++P  + +     QRF  + + + + ++  +        S+
Sbjct: 431 GQKLPMADPIAKSEKQRFMQQSQPLMARMDQEKATT---LASN 470


>gi|237803467|ref|ZP_04591052.1| peptidase, M23/M37 family protein [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331025449|gb|EGI05505.1| peptidase, M23/M37 family protein [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 473

 Score =  366 bits (938), Expect = 9e-99,   Method: Composition-based stats.
 Identities = 100/452 (22%), Positives = 174/452 (38%), Gaps = 17/452 (3%)

Query: 203 TAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTI- 261
            + + E K   +     + ++  Q      A   T +             +   +  T  
Sbjct: 35  PSSEVEAKRTNLALDLEMPDQDVQDQDAPEATQATPETTESPFAQIDNAAEQAPDTETAQ 94

Query: 262 TSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDE 321
              +       +     + +    T+       G       +   + K   +  +L   +
Sbjct: 95  AEAEKQAPVAKDPLHREVTVSKGDTLSTLFEKVGLPAAAVHEALASDKQAKQFSKLQNGQ 154

Query: 322 ILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSE 381
            L+  +        +              ++  +             +       +R   
Sbjct: 155 TLQFELTPDGQLKQLH-----------TKLSELETISLSKTATGFAFNREISKPNVRNVY 203

Query: 382 ESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQAS 441
               I   + ++    G+  ++   +       V+  + ++  D  +  +     N ++ 
Sbjct: 204 VHGVINSSLSQSAQRAGLTHSMTMDMANIFGYDVDFAQDIRKGDQFDVVYEQKVVNGKSV 263

Query: 442 DDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGM 501
               +L              R+ +    +  Y+  +G S R   +RTPV F R++S F M
Sbjct: 264 GTGNILAARFTNRGKTYTAVRYTSKQG-TTNYYTADGNSMRKAFIRTPVDFARISSMFSM 322

Query: 502 RY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYN 560
              HPIL   R H GVD+AAPRGTPI A GDG V  A   GGYG   +I HG+ Y + Y 
Sbjct: 323 GRKHPILNKIRAHKGVDYAAPRGTPIKATGDGKVLLAGRRGGYGNTVIIQHGDTYRTLYG 382

Query: 561 HQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLK 620
           H    AK ++ G++VKQGQ+IG+IGTTGLSTGPHLHYE  VNG+ VD    ++P  + + 
Sbjct: 383 HMQGFAKGVQTGSSVKQGQVIGYIGTTGLSTGPHLHYEFQVNGVHVDPLGQKLPMADPIA 442

Query: 621 GDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
               QRF  + + + + ++  +        S+
Sbjct: 443 KSEKQRFMQQSQPLMARMDQEKATT---LASN 471


>gi|320331998|gb|EFW87934.1| M24/M37 family peptidase [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330882165|gb|EGH16314.1| M24/M37 family peptidase [Pseudomonas syringae pv. glycinea str.
           race 4]
          Length = 472

 Score =  366 bits (938), Expect = 9e-99,   Method: Composition-based stats.
 Identities = 102/463 (22%), Positives = 174/463 (37%), Gaps = 27/463 (5%)

Query: 191 FPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSK 250
           FP+     +       +        Q     +    +     +    +D   D       
Sbjct: 34  FPSSEVEAKR-TNLSLDLEMPDQDVQDQDAPDAAQATPETTESPFAQIDNADDE------ 86

Query: 251 KIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKN 310
                ++  T  S         +     + +    T+       G       ++  + K 
Sbjct: 87  ----AQDTATAQSDAEKPAPAKDPNHREVIVSKGDTLSTLFEKVGLPAATVHEVLASDKQ 142

Query: 311 EVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDI 370
             +  +L   + L+  +        +              ++  +             + 
Sbjct: 143 AKQFTKLQNGQTLQFELSPDGQLKQLH-----------TKLSELETISLSKSASGFVFNR 191

Query: 371 NHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETF 430
                 +R +     I   + ++    G+  ++   +       ++  + ++  D  +  
Sbjct: 192 EISKPNVRNAYVHGVINSSLSQSAQRAGLTHSMTMDMANIFGYDIDFAQDIRKGDEFDVV 251

Query: 431 FSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPV 490
           +     N ++     +L              R+ N    +  Y+  +G S R   +RTPV
Sbjct: 252 YEQKVVNGKSVGTGNILSARFTNRGKTYTAVRYTNKQG-NTNYYTADGNSMRKAFIRTPV 310

Query: 491 PFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLI 549
            F R++S F M   HPIL   R H GVD+AAPRGTPI A GDG V  A   GGYG   +I
Sbjct: 311 DFARISSMFSMGRKHPILNKIRAHKGVDYAAPRGTPIKATGDGKVLLAGRRGGYGNTVII 370

Query: 550 HHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDST 609
            HG+ Y + Y H    AK I+ G  VKQGQ+IG+IGTTGLSTGPHLHYE  VNG+ VD  
Sbjct: 371 QHGDTYRTLYGHMQGFAKGIQTGGTVKQGQVIGYIGTTGLSTGPHLHYEFQVNGVHVDPL 430

Query: 610 KVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
             ++P  + +     QRF  + + + + ++  +        S+
Sbjct: 431 GQKLPMADPIAKSEKQRFMQQSQPLMARMDQEKATT---LASN 470


>gi|167622978|ref|YP_001673272.1| peptidase M23B [Shewanella halifaxensis HAW-EB4]
 gi|167353000|gb|ABZ75613.1| peptidase M23B [Shewanella halifaxensis HAW-EB4]
          Length = 474

 Score =  365 bits (937), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 111/471 (23%), Positives = 190/471 (40%), Gaps = 23/471 (4%)

Query: 184 VTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLL-HNKKNQSFTLYYADPQTLDQRH 242
           VT   I  P+D  +      +   E          L        S ++  + P       
Sbjct: 25  VTLIIIFMPSDDVQASKQTPSTSGEYDVNTRYDVPLAFRKPTPPSASMSESTPSQRTSSE 84

Query: 243 DHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSA 302
                 S++ K     +    P++     P+  +    ++   T+      AG +  D  
Sbjct: 85  KLAFNTSEQSKKQALVQATDKPEIQEPAAPKLKEKRFQVKSGDTLAALFDRAGLTAKDVY 144

Query: 303 KIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLG 362
            + +  K +  + ++   + L I    K+D   +V+   +  +   L I   D+      
Sbjct: 145 DVTQLPKAKKDLLKIMPGDNLVIA---KNDDGKLVQLRYHLDKITTLIIDRTDSG----- 196

Query: 363 VEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLK 422
               K  I  +    R+   S  I +  W A    G+  N +  +       ++    L+
Sbjct: 197 ---YKEQIVTKKVEARSKFASATIENNFWNAGVNAGLTPNQIMQLATIFGWDIDFALDLR 253

Query: 423 PTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSR 482
             D     F   +AN +   +  +L         R    R+ +       Y++E G+S R
Sbjct: 254 KGDQFAMIFEEEYANGEFLKNGNILAAEFTNQGDRYTAVRYKDGN-----YYSEEGRSMR 308

Query: 483 PFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAG 541
              LR+PV F  ++S F  R  HP+ G  + H GVD+ A  GTPI A G+G V K+++  
Sbjct: 309 KAFLRSPVDFKYVSSSFNPRRLHPVTGQVKAHRGVDYVAAVGTPIKAAGNGRVIKSSYNQ 368

Query: 542 GYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIV 601
             G    I H + Y + Y H     + +K G +VKQGQIIG +G+TG  TGPHLHYE IV
Sbjct: 369 YNGNYVFIKHNDTYTTKYLHLTK--RKVKTGQSVKQGQIIGTLGSTGRVTGPHLHYEFIV 426

Query: 602 NGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
           NG+  +   +++P+ E +      +FA   K   +++   E+ K+    + 
Sbjct: 427 NGVHRNPRTIKLPKSEPIAKKEKAQFATLSK---TMMAELEHNKQVQIAAQ 474


>gi|148545720|ref|YP_001265822.1| peptidase M23B [Pseudomonas putida F1]
 gi|18149147|dbj|BAB83598.1| toluene resistance protein Trg3 [Pseudomonas putida]
 gi|148509778|gb|ABQ76638.1| peptidase M23B [Pseudomonas putida F1]
          Length = 473

 Score =  365 bits (937), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 108/453 (23%), Positives = 182/453 (40%), Gaps = 21/453 (4%)

Query: 205 QDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSP 264
              E++         L +   Q      A P    +          + +   E +     
Sbjct: 35  PSSEVEAKKTTLNLELESPAEQLKDESRAAPLVQSEGEQGSPFAQIE-EATPETQKADQQ 93

Query: 265 QVLIDKI----PEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKD 320
               + +     E     + +    T+       G        +  + K   +  QL   
Sbjct: 94  APAAEPVAEAAKEPGHREVTVARGDTLSTLFAKVGLPANAVHDLLASNKQAKQFSQLKHG 153

Query: 321 EILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTS 380
           ++L+  + +     ++              ++  +        +    +       +RT+
Sbjct: 154 QVLQFELDKDGQLASLHS-----------KVSNLETIRLTKTAKGYTFNREISKPVIRTA 202

Query: 381 EESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQA 440
                I   +  +    G++ ++   + R L   ++  + ++P D  +  +     + + 
Sbjct: 203 YAHGVIKSSLSASAQRAGLSHSMTMDMARVLGYDIDFAQDIRPGDEFDVVYEQKVMDGKV 262

Query: 441 SDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFG 500
                +L              R+ N    +  Y+  +G S R   +RTPV F R++S F 
Sbjct: 263 VGTGNILSARFTNRGKTYTAVRYTNKQGNTT-YYTADGNSLRKAFIRTPVDFARISSRFS 321

Query: 501 MRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSY 559
               HPIL   R H GVD+AAPRGTPI A GDG +E A   GGYG   +I HGN Y + Y
Sbjct: 322 AGRKHPILNKIRAHKGVDYAAPRGTPIKAAGDGRIELAGRRGGYGNTVIIQHGNRYKTLY 381

Query: 560 NHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENL 619
            H    AK IK G+ VKQGQIIG+IGTTGLSTGPHLHYE  VNG+ VD    ++P  + +
Sbjct: 382 GHMQGFAKGIKTGSTVKQGQIIGYIGTTGLSTGPHLHYEFQVNGVHVDPLSQKVPMADPI 441

Query: 620 KGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
             +  QRF  + + + + ++  +     L  ++
Sbjct: 442 AKNERQRFLQQSQPLIARMDQEKA---TLLAAN 471


>gi|26987176|ref|NP_742601.1| M24/M37 family peptidase [Pseudomonas putida KT2440]
 gi|24981811|gb|AAN66065.1|AE016235_4 peptidase, M23/M37 family [Pseudomonas putida KT2440]
          Length = 475

 Score =  365 bits (937), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 108/453 (23%), Positives = 182/453 (40%), Gaps = 21/453 (4%)

Query: 205 QDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSP 264
              E++         L +   Q      A P    +          + +   E +     
Sbjct: 37  PSSEVEAKKTTLNLELESPAEQLKDESRAAPLVQSEGEQGSPFAQIE-EATPETQKADQQ 95

Query: 265 QVLIDKI----PEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKD 320
               + +     E     + +    T+       G        +  + K   +  QL   
Sbjct: 96  APAAEPVAEAAKEPGHREVTVARGDTLSTLFAKVGLPANAVHDLLASNKQAKQFSQLKHG 155

Query: 321 EILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTS 380
           ++L+  + +     ++              ++  +        +    +       +RT+
Sbjct: 156 QVLQFELDKDGQLASLHS-----------KVSNLETIRLTKTAKGYTFNREISKPVIRTA 204

Query: 381 EESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQA 440
                I   +  +    G++ ++   + R L   ++  + ++P D  +  +     + + 
Sbjct: 205 YAHGVIKSSLSASAQRAGLSHSMTMDMARVLGYDIDFAQDIRPGDEFDVVYEQKVMDGKV 264

Query: 441 SDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFG 500
                +L              R+ N    +  Y+  +G S R   +RTPV F R++S F 
Sbjct: 265 VGTGNILSARFTNRGKTYTAVRYTNKQGNTT-YYTADGNSLRKAFIRTPVDFARISSRFS 323

Query: 501 MRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSY 559
               HPIL   R H GVD+AAPRGTPI A GDG +E A   GGYG   +I HGN Y + Y
Sbjct: 324 AGRKHPILNKIRAHKGVDYAAPRGTPIKAAGDGRIELAGRRGGYGNTVIIQHGNRYKTLY 383

Query: 560 NHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENL 619
            H    AK IK G+ VKQGQIIG+IGTTGLSTGPHLHYE  VNG+ VD    ++P  + +
Sbjct: 384 GHMQGFAKGIKTGSTVKQGQIIGYIGTTGLSTGPHLHYEFQVNGVHVDPLSQKVPMADPI 443

Query: 620 KGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
             +  QRF  + + + + ++  +     L  ++
Sbjct: 444 AKNERQRFLQQSQPLIARMDQEKA---TLLAAN 473


>gi|313496800|gb|ADR58166.1| M24/M37 family peptidase [Pseudomonas putida BIRD-1]
          Length = 456

 Score =  365 bits (936), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 107/453 (23%), Positives = 183/453 (40%), Gaps = 21/453 (4%)

Query: 205 QDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSP 264
              E++         L +   Q      A P    +          + +   E +     
Sbjct: 18  PSSEVEAKKTTLNLELESPAEQLKDESRAAPLVQSESEQGSPFAQIE-EATPETQKADQQ 76

Query: 265 QVLIDKI----PEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKD 320
               + +     E     + +    T+       G        +  + K   +  QL   
Sbjct: 77  APAAEPVAEAAKEPGHREVTVARGDTLSTLFAKVGLPANAVHDLLASNKQAKQFSQLKHG 136

Query: 321 EILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTS 380
           ++L+  + +     ++              ++  +  +     +    +       +RT+
Sbjct: 137 QVLQFELDKDGQLASLHS-----------KVSNLETIQLTKTAKGYTFNREISKPVVRTA 185

Query: 381 EESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQA 440
                I   +  +    G++ ++   + R L   ++  + ++P D  +  +     + + 
Sbjct: 186 YAHGVIKSSLSASAQRAGLSHSMTMSLARVLGYDIDFAQDIRPGDEFDVVYEQKVMDGKV 245

Query: 441 SDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFG 500
                +L              R+ N    +  Y+  +G S R   +RTPV F R++S F 
Sbjct: 246 VGTGNILSARFTNRGKTYTAVRYTNKQG-NTAYYTADGNSLRKAFIRTPVDFARISSRFS 304

Query: 501 MRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSY 559
               HPIL   R H GVD+AAPRGTPI A GDG +E A   GGYG   +I HGN Y + Y
Sbjct: 305 AGRKHPILNKIRAHKGVDYAAPRGTPIKAAGDGRIELAGRRGGYGNTVIIQHGNRYKTLY 364

Query: 560 NHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENL 619
            H    AK IK G+ VKQGQIIG+IGTTGLSTGPHLHYE  VNG+ VD    ++P  + +
Sbjct: 365 GHMQGFAKGIKTGSTVKQGQIIGYIGTTGLSTGPHLHYEFQVNGVHVDPLSQKVPMADPI 424

Query: 620 KGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
             +  QRF  + + + + ++  +     +  ++
Sbjct: 425 AKNERQRFLQQSQPLIARMDQEKA---TMLAAN 454


>gi|330961005|gb|EGH61265.1| peptidase M23B [Pseudomonas syringae pv. maculicola str. ES4326]
          Length = 474

 Score =  365 bits (936), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 105/454 (23%), Positives = 181/454 (39%), Gaps = 20/454 (4%)

Query: 203 TAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTIT 262
            + + E K   +     + ++  Q      A   T +     P       +   ++    
Sbjct: 35  PSSEVEAKRTNLALDLEMPDQDVQDQDAPDATQATPETAE-SPFAQIDATEDQPQDTAAA 93

Query: 263 SPQVLIDKIPEFAD---DLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTK 319
            P           D     + +    T+       G       ++  + K   +  +L  
Sbjct: 94  QPVTEKPAPAAIKDQLHREVTVSKGDTLSTLFEKVGLPAATVHEVLASDKQARQFSKLQN 153

Query: 320 DEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRT 379
            +  +  +        +     + K   + TI+L+              +       +R 
Sbjct: 154 GQTFQFELTPDGQLKQL-----HTKLSEVETISLSKT------ANGYAFNREISKPNVRN 202

Query: 380 SEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQ 439
           +     I   + ++    G++ ++   +       V+  + ++  D  +  +     N +
Sbjct: 203 AYVHGVINSSLSQSAQRAGLSHSMTMDMANIFGYDVDFAQDIRKGDEFDVVYEQKVVNGK 262

Query: 440 ASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGF 499
                 +L              R+ +    +  Y+  +G S R   +RTPV F R++S F
Sbjct: 263 NVGTGNILAARFTNRGKTYTAVRYTSKQG-TTNYYTADGNSMRKAFIRTPVDFARISSMF 321

Query: 500 GMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSS 558
            M   HPIL   R H GVD+AAPRGTPI A GDG V  A   GGYG   +I HG+ Y + 
Sbjct: 322 SMGRKHPILNKIRAHKGVDYAAPRGTPIKATGDGKVLLAGRRGGYGNTVIIQHGDTYRTL 381

Query: 559 YNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPEREN 618
           Y H    AK ++ G++VKQGQ+IG+IGTTGLSTGPHLHYE  VNG+ VD    ++P  + 
Sbjct: 382 YGHMQGFAKGVQTGSSVKQGQVIGYIGTTGLSTGPHLHYEFQVNGVHVDPLGQKLPMADP 441

Query: 619 LKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
           +     QRF  + + + + ++  +        S+
Sbjct: 442 IAKSEKQRFMQQSQPLMARMDQEKATT---LASN 472


>gi|154252206|ref|YP_001413030.1| peptidase M23B [Parvibaculum lavamentivorans DS-1]
 gi|154156156|gb|ABS63373.1| peptidase M23B [Parvibaculum lavamentivorans DS-1]
          Length = 569

 Score =  365 bits (936), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 120/505 (23%), Positives = 226/505 (44%), Gaps = 30/505 (5%)

Query: 157 LKIFSEGKIESSSQMLMDTIHNVDSFEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQ 216
             + +  +  +++ +  +    V +++ +  ++   T+   +Q        +   A    
Sbjct: 74  ASLVAPYEGVATAALTAERAPRVVAWDASPAQMAERTETRALQETAALLPTDDLLAAAET 133

Query: 217 FFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFAD 276
                  + +   +  ADP     + +  +                +        P   +
Sbjct: 134 ETAAATAEQELAAVSLADPGLFLPQTEESLAAEA------------ASLPAAPLEPRATE 181

Query: 277 DLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDK--- 333
             + + +  T+ + + +AG    D+     A+ +     +L   + + +  ++  D    
Sbjct: 182 TTVSLANGETLMEVLQNAGVDRIDAYHAVAAMTSYYSPRKLRAGQEISLAFMEMPDGMIG 241

Query: 334 -------FTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNI 386
                    +   S+    +  + +  N++  +       +               S  I
Sbjct: 242 EEGETPAKYLTAISLQPDIERAIEVTRNEDGSFGGRETIREFTEGFVR-------ASGTI 294

Query: 387 YDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQ-ASDDSE 445
            + ++      G+   ++  ++R  + SV+ Q  ++P D  E +FS      Q    + +
Sbjct: 295 NNSLFLDAEQAGIPPQIIIEMIRMYSYSVDFQREIQPGDKFEVYFSRKFDEMQLPVKEGD 354

Query: 446 LLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHP 505
           +L+     G    + +RF    DG  +YF+E+G+S + FL++TP+   R++SG+G+R HP
Sbjct: 355 VLHASLTVGGKTHKLWRFDPGKDGEWDYFDESGQSMKKFLMKTPIDGARLSSGYGLRKHP 414

Query: 506 ILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAI 565
           ILGYS+MH GVD+AAPRGTPI A GDG V +AN  G +G    I H NGY ++Y H +  
Sbjct: 415 ILGYSKMHAGVDFAAPRGTPIYAAGDGTVTRANRFGSFGNYISIRHANGYETAYAHLNGF 474

Query: 566 AKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQ 625
           A+ ++AGT V+QGQ+IG++GTTG STGPHLHYE+ VNG K++   +++P    L+G+ L 
Sbjct: 475 ARGVRAGTRVRQGQVIGYVGTTGRSTGPHLHYEVHVNGKKMNPLALKVPTGRKLEGNQLA 534

Query: 626 RFAMEKKRINSLLNNGENPKKPLFT 650
            F   +  I + +       K    
Sbjct: 535 AFKNLRADIATQMAEAPLATKVAAA 559


>gi|229592921|ref|YP_002875040.1| putative peptidase [Pseudomonas fluorescens SBW25]
 gi|229364787|emb|CAY52796.1| putative peptidase [Pseudomonas fluorescens SBW25]
          Length = 472

 Score =  364 bits (934), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 112/482 (23%), Positives = 178/482 (36%), Gaps = 27/482 (5%)

Query: 182 FEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQR 241
            E +     +P           A          +                  +  T DQ 
Sbjct: 3   TEPSKAPPLYPKTHLLAASGIAALLSLALLVFPSSEVEAKRTSLSLDLESPVEQLTQDQD 62

Query: 242 HDHPITYSKKIKIIE----ENRTITSPQVLIDKIPEFAD-------DLIPIQHNTTIFDA 290
                  +           EN    + Q    K     D         + +    T+   
Sbjct: 63  ASDAQQATNAQVDSPFAQIENSPEDTQQAAQTKAALTVDTAKNPQHREVIVGKGDTLSTL 122

Query: 291 MVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLT 350
               G       ++  + K   +  QL + + L   +        +              
Sbjct: 123 FEKVGLPAATVNEVLASDKQAKQFTQLKRGQKLEFELTPDGQLNNLHSN----------- 171

Query: 351 IALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRT 410
           ++  ++     G +    +       MR++     I   + ++ +  G++ ++   +   
Sbjct: 172 VSDLESITLTKGAKGFAFNRVTTKPVMRSAYVHGVINSSLSQSAARAGLSHSMTMDMASV 231

Query: 411 LASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGS 470
               ++  + ++  D  +  +    AN +      +L              R+ N    S
Sbjct: 232 FGYDIDFAQDIRQGDEFDVIYEQKVANGKVVGTGNILSARFTNRGKTYTAVRYTNKQGNS 291

Query: 471 VEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAV 529
             Y+  +G S R   +RTPV F R++S F M   HPIL   R H GVD+AAPRGTPI A 
Sbjct: 292 -SYYTADGNSMRKAFIRTPVDFARISSRFSMGRKHPILNKIRAHKGVDYAAPRGTPIKAA 350

Query: 530 GDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGL 589
           GDG V  A   GGYG   +I HGN Y + Y H    AK ++ G  VKQGQ+IG+IGTTGL
Sbjct: 351 GDGKVLLAGRRGGYGNTVIIQHGNTYRTLYGHMQGFAKGVQTGGTVKQGQVIGYIGTTGL 410

Query: 590 STGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLF 649
           STGPHLHYE  VNG+ VD    ++P  + +      RF  + +    L+   +  +  L 
Sbjct: 411 STGPHLHYEFQVNGVHVDPLGQKLPMADPIAKAERARFMQQSQ---PLMARMDQERSTLL 467

Query: 650 TS 651
            S
Sbjct: 468 AS 469


>gi|71733610|ref|YP_272985.1| M24/M37 family peptidase [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|71554163|gb|AAZ33374.1| peptidase, M23/M37 family [Pseudomonas syringae pv. phaseolicola
           1448A]
          Length = 472

 Score =  364 bits (933), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 103/451 (22%), Positives = 176/451 (39%), Gaps = 16/451 (3%)

Query: 203 TAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTIT 262
            + + E K   ++    + ++  Q      A   T +                ++  T  
Sbjct: 35  PSSEVEAKRTNLSLNLEMPDQDVQDQDAPDAAQATPETTESPFAQIDNADDEAQDTATAQ 94

Query: 263 SPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEI 322
           S         +     + +    T+       G       ++  + K   +  +L   + 
Sbjct: 95  SDAEKPAPAKDPNHREVIVSKGDTLSTLFEKVGLPAATVHEVLASDKQAKQFTKLQNGQT 154

Query: 323 LRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEE 382
           L+  +        +              ++  +             +       +R +  
Sbjct: 155 LQFELSPDGQLKQLH-----------TKLSELETISLSKSASGFVFNREISKPNVRNAYV 203

Query: 383 SPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASD 442
              I   + ++    G+  ++   +       ++  + ++  D  +  +     N ++  
Sbjct: 204 HGVINSSLSQSAQRAGLTHSMTMDMANIFGYDIDFAQDIRKGDEFDVVYEQKVVNGKSVG 263

Query: 443 DSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMR 502
              +L              R+ N    +  Y+  +G S R  L+RTPV F R++S F M 
Sbjct: 264 TGNILSARFTNRGKTYTAVRYTNKQG-NTNYYTADGNSMRKALIRTPVDFARISSMFSMG 322

Query: 503 Y-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNH 561
             HPIL   R H GVD+AAPRGTPI A GDG V  A   GGYG   +I HG+ Y + Y H
Sbjct: 323 RKHPILNKIRAHKGVDYAAPRGTPIKATGDGKVLLAGRRGGYGNTVIIQHGDTYRTLYGH 382

Query: 562 QDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKG 621
               AK I+ G  VKQGQ+IG+IGTTGLSTGPHLHYE  VNG+ VD    ++P  + +  
Sbjct: 383 MQGFAKGIQTGGTVKQGQVIGYIGTTGLSTGPHLHYEFQVNGVHVDPLGQKLPMADPIAK 442

Query: 622 DLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
              QRF  + + + + ++  +        S+
Sbjct: 443 SEKQRFMQQSQPLMARMDQEKATT---LASN 470


>gi|83648876|ref|YP_437311.1| metalloendopeptidase-like membrane protein [Hahella chejuensis KCTC
           2396]
 gi|83636919|gb|ABC32886.1| Membrane protein related to metalloendopeptidase [Hahella
           chejuensis KCTC 2396]
          Length = 473

 Score =  364 bits (933), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 95/448 (21%), Positives = 176/448 (39%), Gaps = 16/448 (3%)

Query: 200 LDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENR 259
                   E   A      +  + +     +  + P                +    E  
Sbjct: 27  SALILSPSEQAAAGRITLNIPLDGQPS-SQVDSSSPLADLPEDSASAKIKPLVPSTVEQA 85

Query: 260 TITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTK 319
           T T      +    + +    +++  ++      AG S+ + A++   +  +    Q+  
Sbjct: 86  TETPAPAAAEPEIAWNEFE--VKNGDSLSALFKRAGASSAELAQMVNDIPGK-EWTQIFP 142

Query: 320 DEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRT 379
            E L      ++    +    I+  Q     I     N++       +++       ++T
Sbjct: 143 GEKLDFAFNAEN---KLSALRIHRSQLENWLINATAENKF-------ELEKVVLKPDVQT 192

Query: 380 SEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQ 439
           +     I   ++      G+  +L+  +       V+    ++  D  +  +     +  
Sbjct: 193 AYAEGVIKSALFIDAKNAGLPDSLIMDLANIFGWDVDFVLDIRSGDSFKLVYEELFLDGN 252

Query: 440 ASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGF 499
              +  +L              R+ +       YF  +GKS +   LRTP+ F R++S F
Sbjct: 253 KISNGNILAAEFTNQGETFTAVRYEDQEG-KTGYFTPDGKSLKKAFLRTPIDFARISSHF 311

Query: 500 GMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSS 558
            ++  HP+L   R H G D+AA RGTPI A GDG V  A   GGYG   ++ HG    + 
Sbjct: 312 NLQRKHPVLHKFRAHKGTDYAAGRGTPIKASGDGKVIFAGRKGGYGNVVILQHGQSITTL 371

Query: 559 YNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPEREN 618
           Y H    A+ IK G  + QGQ+IG++G++GL+TGPHLHYE  VNG+  +   V+ P  + 
Sbjct: 372 YAHMKGFARGIKNGKRINQGQVIGYVGSSGLATGPHLHYEFRVNGVHKNPVTVKFPHAQP 431

Query: 619 LKGDLLQRFAMEKKRINSLLNNGENPKK 646
           + G+ + RF  + +   + L    +  +
Sbjct: 432 VAGNEMARFKEQAQTALAQLQAYSDSYQ 459


>gi|94502121|ref|ZP_01308623.1| Membrane protein [Oceanobacter sp. RED65]
 gi|94425758|gb|EAT10764.1| Membrane protein [Oceanobacter sp. RED65]
          Length = 425

 Score =  363 bits (932), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 92/397 (23%), Positives = 162/397 (40%), Gaps = 15/397 (3%)

Query: 245 PITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKI 304
           P+    + +       +          PE   D+  I+    +     +   S      +
Sbjct: 33  PVQQELQRRTFAYQVPLPEKTQSKPDQPEIIWDMHEIRPGENLAQLFKNRDLSPKSLYLL 92

Query: 305 AKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVE 364
            +       +D+L   + +   +        ++ F +           L ++ E+ L   
Sbjct: 93  TQTEHGSA-LDRLHPGDAIGFQIEND----ELIAFRLEKS--------LYESFEFHLVDS 139

Query: 365 PVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPT 424
                          S     I   ++      G++++++  +       V+    ++  
Sbjct: 140 KFNSKKIVLEPDTIESFAQGTINTSLFETGMDAGLSNSVIMQLASIFGWDVDFALDIREG 199

Query: 425 DFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPF 484
           D     +   + + +   D ++L              R+ +    S +Y+  +G S R  
Sbjct: 200 DNFSLIYEEKYLDGKKVGDGDILVARFENQGRSYTAVRYADDSGYS-QYYTPSGLSMRKA 258

Query: 485 LLRTPVPFGRMTSGFG-MRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGY 543
            LRTPV F R++S F   R HPIL   R H GVD+AA  GTPI A GDG V  A   GGY
Sbjct: 259 FLRTPVDFTRISSRFNLNRRHPILHKIRAHRGVDYAARTGTPIKAAGDGKVIFAGRKGGY 318

Query: 544 GKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNG 603
           GK  ++ HG+ Y + Y H +A  + I+ G  VKQGQI+ ++G++GL++GPHLHYE  VNG
Sbjct: 319 GKVLILQHGSSYTTLYAHLNAFHRTIRRGKKVKQGQIVAYVGSSGLASGPHLHYEFRVNG 378

Query: 604 IKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNN 640
           +  +   V++P    +     + F    + +   L +
Sbjct: 379 VHRNPLTVKLPHARPIDESRKKDFMHYAQVMVMRLES 415


>gi|254292516|ref|YP_003058539.1| peptidase M23 [Hirschia baltica ATCC 49814]
 gi|254041047|gb|ACT57842.1| Peptidase M23 [Hirschia baltica ATCC 49814]
          Length = 440

 Score =  363 bits (932), Expect = 5e-98,   Method: Composition-based stats.
 Identities = 122/429 (28%), Positives = 202/429 (47%), Gaps = 18/429 (4%)

Query: 217 FFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFAD 276
             L  +      +   A      Q   +         +  E+ T  +P  +         
Sbjct: 22  GTLALSGCENETSSADAKNPISTQTSQNNYLAELANLVSAEDVTPAAPLSIKPGA----- 76

Query: 277 DLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTI 336
               ++   T+ D +   G    +S +   A  N + + +L   + +     Q DD   +
Sbjct: 77  ----LKKRETLIDVLDRLGADRKESNRAVYAAANHIDMRRLRPGQGVTAYF-QNDDTAQL 131

Query: 337 VRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSF 396
              S     +  + ++ +   ++V     VK+            +    I   I+     
Sbjct: 132 TALSFKPDAERQVLVSKSSAGDWVSRELKVKLH-------PDFEKVGGVIDTSIYDLALK 184

Query: 397 NGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSV-NHANNQASDDSELLYIHARFGE 455
            G     V       A  V+ Q  ++  D  E  + V            ++LY      +
Sbjct: 185 QGAGDQQVVDFAEIFAYDVDFQREIRQGDTFEIAYEVFRDELGNTIKKGDVLYASLNGKK 244

Query: 456 TRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTG 515
               FYR+    DG  +Y+++NGK++R FL++TP+   R++S FG R HP+LGY+++H G
Sbjct: 245 VSRNFYRYTTSDDGITDYYDDNGKAARKFLMKTPINGARLSSSFGKRRHPVLGYTKVHKG 304

Query: 516 VDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAV 575
            D+AAPRGTPI A G+G+VE+A+  G YG    I H +GY ++Y H +   K IK+G  V
Sbjct: 305 TDFAAPRGTPIYAAGNGVVERASRYGSYGNYVRIRHADGYKTAYAHMNGYGKGIKSGVRV 364

Query: 576 KQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRIN 635
           KQGQIIG++GTTG STGPHLHYE+ +NG  VD+ ++++P    L G++L++F +EK RI+
Sbjct: 365 KQGQIIGYVGTTGRSTGPHLHYEVQINGKHVDAMRLKLPTGRTLSGEMLEKFKIEKARID 424

Query: 636 SLLNNGENP 644
           ++  + E P
Sbjct: 425 AIRTSHELP 433


>gi|311693248|gb|ADP96121.1| peptidase M23B [marine bacterium HP15]
          Length = 472

 Score =  363 bits (931), Expect = 6e-98,   Method: Composition-based stats.
 Identities = 98/449 (21%), Positives = 176/449 (39%), Gaps = 16/449 (3%)

Query: 204 AQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENR---T 260
           +    ++   M+    L                  +         + +  +  E     +
Sbjct: 30  SPSSNVEAKRMSYALDLEQGTVSETGAAPEQAMPTEAPVADTQPKAPESDVATEATQQAS 89

Query: 261 ITSPQVL-IDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTK 319
           +++P+     K+PE       I+   T+      AG+++G    +        ++ +L  
Sbjct: 90  VSAPEQPVAPKLPELEWQTFAIKSGDTLSSLFKKAGFNDGIMLSVIHGDGEAEKLQRLYA 149

Query: 320 DEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRT 379
            E +R    ++     I            L     +  +     E    +   +    R 
Sbjct: 150 GETIRFATTEEGGLAAI-----------DLQRNRLETLKITKEGESFTGETEVRKPEARP 198

Query: 380 SEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQ 439
           +  S  I   ++ A    G+N +L   +       ++    ++  D  E  +   + + +
Sbjct: 199 AFASGTIDGSLYLAAREAGLNDSLTMELAGIFGWDIDFVYDVRKGDQFEVVYEELYLDGE 258

Query: 440 ASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGF 499
             D   +L               + +    S +Y+  +GKS R   LRTP+     +   
Sbjct: 259 KFDTGRILSARFVNRGEENLALLYTDSNGDS-DYYAPDGKSMRKAFLRTPINARISSPFN 317

Query: 500 GMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSY 559
             R HP+L   R H G D+AAP GTPI A G G V+ A W GGYG+  ++ HG+   + Y
Sbjct: 318 LQRRHPVLDVVRPHEGTDYAAPPGTPIKAAGSGRVKFAGWKGGYGRTVILQHGDNITTLY 377

Query: 560 NHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENL 619
            H   + K IK GT VKQGQ IG +G++G+ TGPHLHYE  +NG   +S  V++P+ + +
Sbjct: 378 AHMSRLGKGIKNGTRVKQGQTIGHVGSSGMVTGPHLHYEFRLNGSPRNSRTVKLPDAKPI 437

Query: 620 KGDLLQRFAMEKKRINSLLNNGENPKKPL 648
               + RF    ++  +  +      + L
Sbjct: 438 PSSEMARFKQFTEQRIAQFDVFRESYQQL 466


>gi|66047793|ref|YP_237634.1| peptidase M23B [Pseudomonas syringae pv. syringae B728a]
 gi|63258500|gb|AAY39596.1| Peptidase M23B [Pseudomonas syringae pv. syringae B728a]
 gi|330970781|gb|EGH70847.1| peptidase M23B [Pseudomonas syringae pv. aceris str. M302273PT]
          Length = 475

 Score =  363 bits (931), Expect = 6e-98,   Method: Composition-based stats.
 Identities = 103/463 (22%), Positives = 176/463 (38%), Gaps = 24/463 (5%)

Query: 191 FPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSK 250
           FP+     +  +   D E      +Q     + +  +            Q  +       
Sbjct: 34  FPSSDVEAKRTNIPLDLEA----PDQDVQDQDAQQATQATPETTESPFAQIDNADDQAQD 89

Query: 251 KIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKN 310
                 +  T                  + +    T+       G       ++  + K 
Sbjct: 90  TANAQPQAETTAPAAAKDPAH-----REVTVSKGDTLSTLFEKVGLPAATVHEVLASDKQ 144

Query: 311 EVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDI 370
             +  +L   + L+  +        +        +   ++++      Y         + 
Sbjct: 145 AKQFSKLQNGQTLQFELTPDGQLKQLHT---KLSEVESISLSKTATGGY-------AFNR 194

Query: 371 NHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETF 430
                 +R +     I   + ++    G+  ++   +       ++  + ++  D  +  
Sbjct: 195 EISKPNVRNAYVHGVINSSLSQSAQRAGLTHSMTMDMANIFGYDIDFAQDIRKGDEFDVV 254

Query: 431 FSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPV 490
           +     N ++     +L              R+ N    +  Y+  +G S R   +RTPV
Sbjct: 255 YEQKVVNGKSVGTGNILSARFTNRGKTYTAVRYTNKQG-NTNYYTADGNSMRKAFIRTPV 313

Query: 491 PFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLI 549
            F R++S F M   HPIL   R H GVD+AAPRGTPI A GDG V  A   GGYG   +I
Sbjct: 314 DFARISSMFSMGRKHPILNKIRAHKGVDYAAPRGTPIKATGDGKVLLAGRRGGYGNTVII 373

Query: 550 HHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDST 609
            HG+ Y + Y H    AK I+ G  VKQGQ+IG+IGTTGLSTGPHLHYE  VNG+ VD  
Sbjct: 374 QHGDTYRTLYGHMQGFAKGIQTGGTVKQGQVIGYIGTTGLSTGPHLHYEFQVNGVHVDPL 433

Query: 610 KVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
             ++P  + +     QRF  + + + + ++  +        S+
Sbjct: 434 GQKLPMADPIAKSEKQRFMQQSQPLMARMDQEKATT---LASN 473


>gi|330980906|gb|EGH79009.1| peptidase M23B [Pseudomonas syringae pv. aptata str. DSM 50252]
          Length = 371

 Score =  363 bits (931), Expect = 6e-98,   Method: Composition-based stats.
 Identities = 97/383 (25%), Positives = 162/383 (42%), Gaps = 15/383 (3%)

Query: 271 IPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQK 330
             + A   + +    T+       G       ++  + K   +  +L   + L+  +   
Sbjct: 1   AKDPAHREVTVSKGDTLSTLFEKVGLPAATVHEVLASDKQAKQFSKLQNGQTLQFELTPD 60

Query: 331 DDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGI 390
                +        +   ++++      Y         +       +R +     I   +
Sbjct: 61  GQLKQLHT---KLSEVESISLSKTATGGY-------AFNREISKPNVRNAYVHGVINSSL 110

Query: 391 WRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIH 450
            ++    G+  ++   +       ++  + ++  D  +  +     N ++     +L   
Sbjct: 111 SQSAQRAGLTHSMTMDMANIFGYDIDFAQDIRKGDEFDVVYEQKVVNGKSVGAGNILSAR 170

Query: 451 ARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGY 509
                      R+ N    +  Y+  +G S R   +RTPV F R++S F M   HPIL  
Sbjct: 171 FTNRGKTYTAVRYTNKQG-NTNYYTADGNSMRKAFIRTPVDFARISSMFSMGRKHPILNK 229

Query: 510 SRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNI 569
            R H GVD+AAPRGTPI A GDG V  A   GGYG   +I HG+ Y + Y H    AK I
Sbjct: 230 IRAHNGVDYAAPRGTPIKATGDGKVLLAGRRGGYGNTVIIQHGDTYRTLYGHMQGFAKGI 289

Query: 570 KAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAM 629
           + G  VKQGQ+IG+IGTTGLSTGPHLHYE  VNG+ VD    ++P  + +     QRF  
Sbjct: 290 QTGGTVKQGQVIGYIGTTGLSTGPHLHYEFQVNGVHVDPLGQKLPMADPIAKSEKQRFMQ 349

Query: 630 EKKRINSLLNNGENPKKPLFTSH 652
           + + + + ++  +        S+
Sbjct: 350 QSQPLMARMDQEKATT---LASN 369


>gi|157960822|ref|YP_001500856.1| peptidase M23B [Shewanella pealeana ATCC 700345]
 gi|157845822|gb|ABV86321.1| peptidase M23B [Shewanella pealeana ATCC 700345]
          Length = 470

 Score =  362 bits (930), Expect = 7e-98,   Method: Composition-based stats.
 Identities = 105/471 (22%), Positives = 183/471 (38%), Gaps = 27/471 (5%)

Query: 184 VTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFT-LYYADPQTLDQRH 242
           VT   I  P+D  +      +   E          L           L   DP+   +  
Sbjct: 25  VTLIIILIPSDDVQASKQTPSASGEYDVNTRYSVPLAFRTPTAPAASLSETDPELRKRPA 84

Query: 243 DHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSA 302
                 SK  +  ++               +  +    ++   T+      AG S  D  
Sbjct: 85  QLAPASSKTAEQAQQEI----KPEPTVAAQKLNEKRFQVKSGDTLAALFERAGLSAKDVY 140

Query: 303 KIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLG 362
            + +  K +  + ++   + L I   +      +V+   +  +   L +  + +      
Sbjct: 141 DVTQLPKAKKNLLKIMPGDNLVIAKSEDG---KLVQLRYHLDKITTLIVDNDSSG----- 192

Query: 363 VEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLK 422
                  I  +    R+   S  I +  W A    G+  N +  +       ++    L+
Sbjct: 193 ---YTEHIVTKKVEARSKFASATIENNFWNAGVNAGLTPNQIMQLATIFGWDIDFALDLR 249

Query: 423 PTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSR 482
             D     F   +A+ +   +  +L         R    R+ +       Y++E G+S R
Sbjct: 250 KGDQFAMIFEEEYADGEFLKNGNILAAEFTNQGDRYTAVRYKDGN-----YYSEEGRSMR 304

Query: 483 PFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAG 541
              LR+PV F  ++S F  R  HP+ G  R H GVD+ A  GTPI A G+G V K+++  
Sbjct: 305 KAFLRSPVDFKYVSSSFNPRRLHPVTGQVRAHRGVDYVAAVGTPIKAAGNGRVIKSSYNQ 364

Query: 542 GYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIV 601
             G    I H + Y + Y H     + +K G +VKQGQIIG +G+TG  TGPHLHYE IV
Sbjct: 365 YNGNYVFIKHNDTYTTKYLHLTK--RKVKTGQSVKQGQIIGTLGSTGRVTGPHLHYEFIV 422

Query: 602 NGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
           NG+  +   +++P+ E +      +FA   +   +++   E+ K+    + 
Sbjct: 423 NGVHRNPRTIKLPKSEPIASKEKAQFAKLSE---TMMAELEHNKQVQIAAQ 470


>gi|88813722|ref|ZP_01128947.1| metalloendopeptidase-like membrane protein [Nitrococcus mobilis
           Nb-231]
 gi|88789015|gb|EAR20157.1| metalloendopeptidase-like membrane protein [Nitrococcus mobilis
           Nb-231]
          Length = 518

 Score =  362 bits (929), Expect = 9e-98,   Method: Composition-based stats.
 Identities = 119/521 (22%), Positives = 195/521 (37%), Gaps = 49/521 (9%)

Query: 134 FAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVTTQKINFPT 193
           F    +  AT   +    P  + L+   E   E ++   +  +                 
Sbjct: 37  FTALALLLATKD-EAGAIPNHNALQQLPEQIPEEAAATRILDLPIPK------------L 83

Query: 194 DITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIK 253
             T I     A    +   I +                   P   D              
Sbjct: 84  QRTTIDASSPASPHILAAPIADHPSEATPN---------LLPTAFDTSTTAD-------- 126

Query: 254 IIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVR 313
              E  T     +      ++   ++ ++   ++   +   G S+ D   +  A  +  R
Sbjct: 127 ---ETITKQPNTLGGGTQAKWE--VVHVKQGDSLTTLLKRQGLSSKDIFDVTHADDDSAR 181

Query: 314 -VDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINH 372
            + QL   + + + V        + R      +   LTIA   +          +  +  
Sbjct: 182 TLAQLFPGDKIWLRVSGNGTLLALRR---RLDETKTLTIARGSS-----ADIGFQTTLTE 233

Query: 373 QMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFS 432
                R +  +  I+D +++A    G++  L+  +       ++    ++  D     + 
Sbjct: 234 HQLERRIAHATAVIHDSLYQAAVKAGLDDKLIMKLTGIFGWDIDFAHDVRSGDSFTLVYR 293

Query: 433 VNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPF 492
             + N +   + E++         R R  R+  P   S  Y+   GKS R   LRTPV F
Sbjct: 294 QYYRNGEKIRNGEIVAAEFANQGKRYRAIRYTAPSGRS-GYYTPEGKSMRKAFLRTPVDF 352

Query: 493 GRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHH 551
            R++S F     HPIL   R H G D+AA  GTPI A GDG+V  A   GGYG   ++ H
Sbjct: 353 RRISSRFNKSRCHPILHVCRPHEGTDFAAATGTPIQAAGDGLVAFAGRRGGYGNAVILQH 412

Query: 552 GNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKV 611
            + Y + Y H   I K I+AG  V QGQIIG++G +GL+TGPHLHYE  VNG+  D+ KV
Sbjct: 413 AHRYSTLYGHMQRIRKGIRAGVQVTQGQIIGYVGQSGLATGPHLHYEFRVNGVPRDALKV 472

Query: 612 RIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
            +P+ + +    L  F     +  S L       +    S+
Sbjct: 473 TLPDAKPIDSRYLADFKA---KALSRLAQLTVITRTQLASN 510


>gi|254784883|ref|YP_003072311.1| M23 peptidase domain-containing protein [Teredinibacter turnerae
           T7901]
 gi|237684467|gb|ACR11731.1| putative M23 peptidase domain protein [Teredinibacter turnerae
           T7901]
          Length = 426

 Score =  362 bits (929), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 93/387 (24%), Positives = 163/387 (42%), Gaps = 14/387 (3%)

Query: 261 ITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKD 320
            T+P+      PE       ++    +      AG ++ D  ++  A   + ++  L   
Sbjct: 40  ATAPEPTAPIEPETIVREETVKSGDNLSLLFKRAGLTDRDMMEVLAAENGK-KLAALYPG 98

Query: 321 EILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTS 380
             +   + +               +    T     +  +             +   ++ S
Sbjct: 99  HTVAFTLSRDGKL-----------EGLTYTKDRLTSFSFTRADNLFTYSEQKRTPDVQIS 147

Query: 381 EESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQA 440
             S  I + ++ A     ++  LV  +       ++    ++  D  +  +  ++ + + 
Sbjct: 148 TRSGVITESLFLAGKEAQLDDRLVMELASIFGWDIDFVLDIRQGDSFKVAYEESYIDGEK 207

Query: 441 SDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFG 500
             +  ++           R  R+ +    +V+Y+   G + R   LRTP+ F R++S F 
Sbjct: 208 IGNGNIVAAEFTNQNKTYRAVRYEDANG-NVQYYTPAGDTMRKEFLRTPIEFARISSPFN 266

Query: 501 MRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSY 559
           ++  HP+L   R H G D+AA RGTPI A GDG V  A   GGYG   +I HG  Y + Y
Sbjct: 267 LKRKHPVLNKIRAHKGTDYAAARGTPIKAAGDGKVIFAGRKGGYGNVVIIQHGQTYKTLY 326

Query: 560 NHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENL 619
            H     K I+AG  VKQGQ I ++G+TGL+TGPHLHYE  VNG   +   V++P+ + +
Sbjct: 327 AHISKFRKGIRAGARVKQGQTIAYVGSTGLATGPHLHYEFYVNGSVRNPVTVKLPKAKAI 386

Query: 620 KGDLLQRFAMEKKRINSLLNNGENPKK 646
               L RF    + + + L+      K
Sbjct: 387 AKAELPRFLNATQPLLAELDPTSGSTK 413


>gi|327479306|gb|AEA82616.1| M24/M37 family peptidase [Pseudomonas stutzeri DSM 4166]
          Length = 469

 Score =  362 bits (928), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 105/417 (25%), Positives = 170/417 (40%), Gaps = 18/417 (4%)

Query: 233 ADPQTLDQRH-DHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDL----IPIQHNTTI 287
           A+P T  Q   D P  Y+  ++  E+  +           P    D     + + +  T+
Sbjct: 57  AEPDTTAQSPADSPFAYASDMQTSEQASSDEDKPEDQTGEPVAETDPLAKSVVVANGDTL 116

Query: 288 FDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKH 347
                  G S      +  +  +  ++ +L   + L   + ++ +  ++           
Sbjct: 117 STVFAKVGLSPAVMHAVLASSPDAKQLSRLKIGQTLEFQLTEQGELASLR----SKLNSL 172

Query: 348 LLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLI 407
                      YV                + T      I   ++ A    G++ NL   +
Sbjct: 173 ETLALEQTPKGYV-------FKKEQVKPEVSTVYARGEIDSSLFLAAKRAGLSHNLTMDL 225

Query: 408 MRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPV 467
                  ++    ++  D  E  +       Q      +L              R+ +  
Sbjct: 226 ANVFGYDIDFALDIRKGDSFEVIYEEKTVEGQRVGTGNILAARFTNRGKTYSAVRYTSKD 285

Query: 468 DGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPI 526
             +  Y+N +G S R   +RTPV F R++S F     HPIL   R H GVD+AAP GTPI
Sbjct: 286 G-TTSYYNADGTSMRKAFIRTPVDFARISSRFSNGRKHPILNKIRAHKGVDYAAPHGTPI 344

Query: 527 VAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGT 586
            + GDG V  A   GGYG   +I HG  Y + Y H    AK ++ G+ VKQGQIIG+IGT
Sbjct: 345 KSAGDGKVLLAGRKGGYGNTVIIQHGQRYRTLYAHMQGFAKGVRNGSTVKQGQIIGYIGT 404

Query: 587 TGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGEN 643
           TGLSTGPHLHYE  V+G+ VD   +++P  + +    + RF  + + + + ++    
Sbjct: 405 TGLSTGPHLHYEFQVDGVHVDPLGLKLPMADPIAKSEMPRFMQQSQPLMARMDEERA 461


>gi|320325936|gb|EFW81995.1| M24/M37 family peptidase [Pseudomonas syringae pv. glycinea str.
           B076]
          Length = 472

 Score =  362 bits (928), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 101/463 (21%), Positives = 173/463 (37%), Gaps = 27/463 (5%)

Query: 191 FPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSK 250
           FP+     +       +        Q     +    +     +    +D   D       
Sbjct: 34  FPSSEVEAKR-TNLSLDLEMPDQDVQDQDAPDAAQATPETTESPFAQIDNADDE------ 86

Query: 251 KIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKN 310
                ++  T  S         +     + +    T+       G       ++  + K 
Sbjct: 87  ----AQDTATAQSDAEKPAPAKDPNHREVIVSKGDTLSTLFEKVGLPAATVHEVLASDKQ 142

Query: 311 EVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDI 370
             +  +L   + L+  +        +              ++  +             + 
Sbjct: 143 AKQFTKLQNGQTLQFELSPDGQLKQLH-----------TKLSELETISLSKSASGFVFNR 191

Query: 371 NHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETF 430
                 +R +     I   + ++    G+  ++   +       ++  + ++  D  +  
Sbjct: 192 EISKPNVRNAYVHGVINSSLSQSAQRAGLTHSMTMDMANIFGYDIDFAQDIRKGDEFDVV 251

Query: 431 FSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPV 490
           +     N ++     +L              R+ N    +  Y+  +G S R   +RTPV
Sbjct: 252 YEQKVVNGKSVGTGNILSARFTNRGKTYTAVRYTNKQG-NTNYYTADGNSMRKAFIRTPV 310

Query: 491 PFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLI 549
            F R++S F M   HPIL   R H GVD+AAPRGTPI A GDG V  A   GGYG   +I
Sbjct: 311 DFARISSMFSMGRKHPILNKIRAHKGVDYAAPRGTPIKATGDGKVLLAGRRGGYGNTVII 370

Query: 550 HHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDST 609
            HG+ Y + Y H    AK I+ G  VKQ Q+IG+IGTTGLSTGPHLHYE  VNG+ VD  
Sbjct: 371 QHGDTYRTLYGHMQGFAKGIQTGGTVKQSQVIGYIGTTGLSTGPHLHYEFQVNGVHVDPL 430

Query: 610 KVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
             ++P  + +     QRF  + + + + ++  +        S+
Sbjct: 431 GQKLPMADPIAKSEKQRFMQQSQPLMARMDQEKATT---LASN 470


>gi|110833226|ref|YP_692085.1| M24/M37 family peptidase [Alcanivorax borkumensis SK2]
 gi|110646337|emb|CAL15813.1| peptidase, M23/M37 family [Alcanivorax borkumensis SK2]
          Length = 439

 Score =  362 bits (928), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 96/403 (23%), Positives = 165/403 (40%), Gaps = 13/403 (3%)

Query: 237 TLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGY 296
                   P     +   + E  T T                + ++   ++   +   G 
Sbjct: 34  AFRPDSTEPTPERIQNISLPERVTPTPQPTNKPATIATEWQTVTVKAGDSLSSLLQPLGI 93

Query: 297 SNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDN 356
                 K+  +     R+  L   + L++ +    D+ T+     +  +   LT A   N
Sbjct: 94  GAQQVYKLIGSDTRLERLASLRPGDTLQVAIS---DEQTLTAVQYHPSRVETLT-ARLKN 149

Query: 357 NEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVN 416
             +   +   +     +            I D ++ A +  G++  L   +    A  V+
Sbjct: 150 GRWQTRISQREYQKQTRF-------AQAQITDSLFLAGAAAGISDKLTLQLANLFAWDVD 202

Query: 417 LQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNE 476
               ++  D     +   + + +     ++L       +     +R+       VEY + 
Sbjct: 203 FVLDIRKGDRFRILYEELYLDGEKVGVGDILMAEFWNRDRHLTAFRYKTLSGD-VEYLDI 261

Query: 477 NGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVE 535
            G S R   +RTPV F R++S F +   HPIL   R H G+D+AAP GTPI A GDG V 
Sbjct: 262 KGGSLRKEFIRTPVAFSRISSRFSLGRKHPILNRIRAHKGIDYAAPSGTPIKAAGDGKVI 321

Query: 536 KANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHL 595
            A   GGYG   +I HG  Y + Y H    AK+++ G  VKQGQ IG++G +GL+TGPHL
Sbjct: 322 FAGIKGGYGNVLIIKHGQSYTTLYAHMRNFAKDMRVGRRVKQGQTIGYVGMSGLATGPHL 381

Query: 596 HYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLL 638
           HYE  +NG+  +   V +P+   +  +    F +   ++ + +
Sbjct: 382 HYEFRINGVHRNPLTVPLPKARGINDNERAEFLIAANQLKAQM 424


>gi|146281151|ref|YP_001171304.1| M24/M37 family peptidase [Pseudomonas stutzeri A1501]
 gi|145569356|gb|ABP78462.1| peptidase, M23/M37 family [Pseudomonas stutzeri A1501]
          Length = 468

 Score =  361 bits (927), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 105/417 (25%), Positives = 170/417 (40%), Gaps = 18/417 (4%)

Query: 233 ADPQTLDQRH-DHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDL----IPIQHNTTI 287
           A+P T  Q   D P  Y+  ++  E+  +           P    D     + + +  T+
Sbjct: 56  AEPDTTAQSPADSPFAYASDMQTSEQASSDEDKPEDQTGEPVAETDPLAKSVVVANGDTL 115

Query: 288 FDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKH 347
                  G S      +  +  +  ++ +L   + L   + ++ +  ++           
Sbjct: 116 STVFAKVGLSPAVMHAVLASSPDAKQLSRLKIGQTLEFQLTEQGELASLR----SKLNSL 171

Query: 348 LLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLI 407
                      YV                + T      I   ++ A    G++ NL   +
Sbjct: 172 ETLALEQTPKGYV-------FKKEQVKPEVSTVYARGEIDSSLFLAAKRAGLSHNLTMDL 224

Query: 408 MRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPV 467
                  ++    ++  D  E  +       Q      +L              R+ +  
Sbjct: 225 ANVFGYDIDFALDIRKGDSFEVIYEEKTVEGQRVGTGNILAARFTNRGKTYSAVRYTSKD 284

Query: 468 DGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPI 526
             +  Y+N +G S R   +RTPV F R++S F     HPIL   R H GVD+AAP GTPI
Sbjct: 285 G-TTSYYNADGTSMRKAFIRTPVDFARISSRFSNGRKHPILNKIRAHKGVDYAAPHGTPI 343

Query: 527 VAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGT 586
            + GDG V  A   GGYG   +I HG  Y + Y H    AK ++ G+ VKQGQIIG+IGT
Sbjct: 344 KSAGDGKVLLAGRKGGYGNTVIIQHGQRYRTLYAHMQGFAKGVRNGSTVKQGQIIGYIGT 403

Query: 587 TGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGEN 643
           TGLSTGPHLHYE  V+G+ VD   +++P  + +    + RF  + + + + ++    
Sbjct: 404 TGLSTGPHLHYEFQVDGVHVDPLGLKLPMADPIAKSEMPRFMQQSQPLMARMDEERA 460


>gi|89095106|ref|ZP_01168032.1| peptidase, M23/M37 family protein [Oceanospirillum sp. MED92]
 gi|89080601|gb|EAR59847.1| peptidase, M23/M37 family protein [Oceanospirillum sp. MED92]
          Length = 450

 Score =  361 bits (926), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 90/424 (21%), Positives = 162/424 (38%), Gaps = 25/424 (5%)

Query: 230 LYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFD 289
           L    P  +    D     S        N T            +       +     +  
Sbjct: 46  LPAPLPLKVISISDTAPAKSGA-----NNLTTPE---ADPLPAQENWVTYTVGSGDNLTS 97

Query: 290 AMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLL 349
               AG SN D  ++A A K++    ++   +     +        + +      +    
Sbjct: 98  IFKKAGLSNRDVFRVANAGKSQKAFTRIFPGQEFSFLI----QNGKLTQLKHIQSKLKQT 153

Query: 350 TIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMR 409
            +  +D           ++    +   ++    S  I D ++ A    G++S  +  +  
Sbjct: 154 HLIESDTG--------YQVTEVIREPSLKQRYTSGTIKDSLFLAGEEAGLSSKKIMELSS 205

Query: 410 TLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDG 469
                V+    ++  D     +     + +   +  ++         +    R+      
Sbjct: 206 IFGWDVDFVLDIRKGDHFSLIYEEKFLDGEKIGEGPIIAAQFTNRGKQFTALRYTTIDGD 265

Query: 470 SVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVA 528
           S  Y+   G S R   LR+PV F R++S F ++  HP+L   R H GVD+AA  GTPI A
Sbjct: 266 S-SYYTPEGYSMRKAFLRSPVDFARISSRFNLKRKHPVLNRIRAHKGVDYAARTGTPIKA 324

Query: 529 VGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTG 588
            GDG +      GGYG   ++ HG+   + Y H ++  +  K GT VKQGQ+IG++G TG
Sbjct: 325 AGDGKIIFRGRKGGYGNVVIVQHGSNITTLYAHMNSFKRGQKNGTRVKQGQVIGFVGKTG 384

Query: 589 LSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPL 648
           L++GPHLHYE  +NG+  +   V++P+   +       F      + + L   +      
Sbjct: 385 LASGPHLHYEFRLNGVHKNPLTVKLPQASPIAKSEKSAFKTAASTMLAQLETYQATT--- 441

Query: 649 FTSH 652
             ++
Sbjct: 442 LAAN 445


>gi|330878331|gb|EGH12480.1| peptidase, M23/M37 family protein [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 474

 Score =  361 bits (925), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 102/463 (22%), Positives = 180/463 (38%), Gaps = 25/463 (5%)

Query: 191 FPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSK 250
           FP+     +  + A D E+ +  +       + +    T      ++   + D+    ++
Sbjct: 34  FPSSEVEAKRTNLALDLEMPDQDVQDQDAAKDTQATPET-----TESPFAQIDNADDQAQ 88

Query: 251 KIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKN 310
                +      +P    D         + +    T+       G       ++  + K 
Sbjct: 89  DTAAAQPEAEKPAPAAAKDPNH----REVTVSKGDTLSTLFEKVGLPASTVHEVLASDKQ 144

Query: 311 EVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDI 370
             +  +L   + L+  +        +              ++  +             + 
Sbjct: 145 AKQFSKLQNGQTLQFELSPDGQLKQLH-----------TKLSELETISLSKSASGFVFNR 193

Query: 371 NHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETF 430
                 +R +     I   + ++    G+   +   +       ++  + ++  D  +  
Sbjct: 194 EISKPNVRNAYVHGVINSSLSQSAQRAGLTHTMTMDMANIFGYDIDFAQDIRKGDEFDVV 253

Query: 431 FSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPV 490
           +     N +      +L              R+ +    +  Y+  +G S R   +RTPV
Sbjct: 254 YEQKVVNGKNVGTGNILSARFTNRGKTYTAVRYTSKQG-TTNYYTADGNSMRKAFIRTPV 312

Query: 491 PFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLI 549
            F R++S F M   HPIL   R H GVD+AAPRGTPI A GDG V  A   GGYG   +I
Sbjct: 313 DFARISSMFSMGRKHPILNKIRAHKGVDYAAPRGTPIKATGDGKVLLAGRRGGYGNTVII 372

Query: 550 HHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDST 609
            HG+ Y + Y H    AK ++ G  VKQGQ+IG+IGTTGLSTGPHLHYE  VNG+ VD  
Sbjct: 373 QHGDTYRTLYGHMQGFAKGVQTGGTVKQGQVIGYIGTTGLSTGPHLHYEFQVNGVHVDPL 432

Query: 610 KVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
             ++P  + +     QRF  + + + + ++  +        S+
Sbjct: 433 GQKLPMADPIAKSEKQRFMQQSQPLMARMDQEKATT---LASN 472


>gi|192359426|ref|YP_001981398.1| peptidase, M23/M37 family [Cellvibrio japonicus Ueda107]
 gi|190685591|gb|ACE83269.1| peptidase, M23/M37 family [Cellvibrio japonicus Ueda107]
          Length = 477

 Score =  361 bits (925), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 97/485 (20%), Positives = 181/485 (37%), Gaps = 28/485 (5%)

Query: 178 NVDSFEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQT 237
                      I+    I      H      +   ++    + H +  +S          
Sbjct: 2   APPKSRTNITAISL---INAFPRGHMIALALLLLCLLFSLVVSHPQDPESTIAVPISSTE 58

Query: 238 LDQRHDHPITYSKKIKIIEENRT-----------ITSPQVLIDKIPEFADDLIPIQHNTT 286
                  P+  S  + +  E  +           + +                 +Q   +
Sbjct: 59  SSNFDARPLLPSLDVSLNTEPLSQTTDTPPSALPLATSTQAEVLPQGPQPKEFTVQSGDS 118

Query: 287 IFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQK 346
           +      AG  + D  ++         + ++   + L   V                 ++
Sbjct: 119 LSLLFRRAGLGDKDIYELFNDAAEAKNLRKIKPGQKLTFLVDDN------------QLKE 166

Query: 347 HLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKL 406
            + TI   D+  +    +            ++       I   ++ A   +G+++ L   
Sbjct: 167 LVYTINTLDSMTFTRASKGFIAKDTSLQPDIQHGFSQGVIDSSLYMAGKRSGLSTGLTME 226

Query: 407 IMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNP 466
           +       ++    ++  D  +  +   H + +     ++L           R  R+++ 
Sbjct: 227 LANIFGWDIDFALDIQKGDAFKVMYEEQHLDGKRIGYGKILAAEFTNSGKTFRAVRYVDK 286

Query: 467 VDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTP 525
              +  Y+  +G+  +   LRTP+ F R++S F +   HP+L   R H G D+AA RGTP
Sbjct: 287 DGVAR-YYTPDGRGMQKAFLRTPIEFARISSHFNLARKHPVLHIIRAHKGTDYAAARGTP 345

Query: 526 IVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIG 585
           I A GDG V  A   GGYG   +I+HG+GY + Y H +  AK ++AGT + QG IIG++G
Sbjct: 346 IRATGDGKVSFAGRKGGYGNCIIINHGSGYETLYGHMNNFAKGMRAGTRISQGDIIGYVG 405

Query: 586 TTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPK 645
           +TGL++GPHLHYE  VNG   +   V +P+   +    L  F    + + + LN   +  
Sbjct: 406 STGLASGPHLHYEFHVNGQVRNPVTVPLPKSMGIDKSQLAVFNESTRPLIAKLNEFSDNT 465

Query: 646 KPLFT 650
           +    
Sbjct: 466 QVAMA 470


>gi|28867835|ref|NP_790454.1| peptidase, M23/M37 family [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|28851071|gb|AAO54149.1| peptidase, M23/M37 family [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|331017520|gb|EGH97576.1| peptidase, M23/M37 family protein [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 474

 Score =  360 bits (924), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 101/482 (20%), Positives = 175/482 (36%), Gaps = 36/482 (7%)

Query: 192 PTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKK 251
           P         H      I   +     +  + + ++     A    +  +       +K 
Sbjct: 6   PKAPPLYPKSHLLAASGIAALLSLALLVFPSSEVEAKRTNLALDLEMPDQDVQDQDAAKD 65

Query: 252 IKIIEENR--TITSPQVLIDKIPEFAD------------------DLIPIQHNTTIFDAM 291
            +   E             D+    A                     + +    T+    
Sbjct: 66  TQATPETTESPFAQIDNADDQAQNTATAQPEAEKPAPAAAKDPNHREVTVSKGDTLSTLF 125

Query: 292 VHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTI 351
              G       ++  + K   +  +L   + L+  +        +              +
Sbjct: 126 EKVGLPASTVHEVLASDKQARQFSKLQNGQTLQFELSPDGQLKQLH-----------TKL 174

Query: 352 ALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTL 411
           +  +             +       +R +     I   + ++    G+   +   +    
Sbjct: 175 SELETISLSKSASGFVFNREISKPNVRNAYVHGVINSSLSQSAQRAGLTHTMTMDMANIF 234

Query: 412 ASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSV 471
              ++  + ++  D  +  +     N ++     +L              R+ +    + 
Sbjct: 235 GYDIDFAQDIRKGDEFDVVYEQKVVNGKSVGTGNILSARFTNRGKTYTAVRYTSKQG-TT 293

Query: 472 EYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVG 530
            Y+  +G S R   +RTPV F R++S F M   HPIL   R H GVD+AAPRGTPI A G
Sbjct: 294 NYYTADGNSMRKAFIRTPVDFARISSMFSMGRKHPILNKIRAHKGVDYAAPRGTPIKATG 353

Query: 531 DGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLS 590
           DG V  A   GGYG   +I HG+ Y + Y H    AK ++ G  VKQGQ+IG+IGTTGLS
Sbjct: 354 DGKVLLAGRRGGYGNTVIIQHGDTYRTLYGHMQGFAKGVQTGGTVKQGQVIGYIGTTGLS 413

Query: 591 TGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFT 650
           TGPHLHYE  VNG+ VD    ++P  + +     QRF  + + + + ++  +        
Sbjct: 414 TGPHLHYEFQVNGVHVDPLGQKLPMADPIAKSEKQRFMQQSQPLMARMDQEKATT---LA 470

Query: 651 SH 652
           S+
Sbjct: 471 SN 472


>gi|330955035|gb|EGH55295.1| peptidase M23B [Pseudomonas syringae Cit 7]
          Length = 474

 Score =  360 bits (924), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 102/463 (22%), Positives = 173/463 (37%), Gaps = 25/463 (5%)

Query: 191 FPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSK 250
           FP+     +  +   D E      +Q     + +  +            Q          
Sbjct: 34  FPSSEVEAKRTNIPLDLEA----PDQDVQDQDAQQATQATPETTESPFAQIDTADDQAQD 89

Query: 251 KIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKN 310
            +    +               E     + +    T+       G       ++  + K 
Sbjct: 90  TVNAQPQAEKPAPAAAKDSAHKE-----VTVSKGDTLSTLFEKVGLPAATVHEVLASDKQ 144

Query: 311 EVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDI 370
             +  +L   + L+  +        +              ++  ++            + 
Sbjct: 145 AKQFSKLQNGQTLQFELTPDGQLKQLH-----------TKLSEVESISLSKTATGYAFNR 193

Query: 371 NHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETF 430
                 +R       I   + ++    G+  ++   +       ++  + ++  D  +  
Sbjct: 194 EISKPNVRNVYVHGVINSSLSQSAQRAGLTHSMTMDMANIFGYDIDFAQDIRKGDEFDVV 253

Query: 431 FSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPV 490
           +     N ++     +L              R+ N    +  Y+  +G S R   +RTPV
Sbjct: 254 YEQKVVNGKSVGTGNILSARFTNRGKTYTPVRYTNKQG-NTNYYTADGNSMRKAFIRTPV 312

Query: 491 PFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLI 549
            F R++S F M   HPIL   R H GVD+AAPRGTPI A GDG V  A   GGYG   +I
Sbjct: 313 DFARISSMFSMGRKHPILNKIRAHKGVDYAAPRGTPIKATGDGKVLLAGRRGGYGNTVII 372

Query: 550 HHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDST 609
            HG+ Y + Y H    AK I+ G  VKQGQ+IG+IGTTGLSTGPHLHYE  VNG+ VD  
Sbjct: 373 QHGDTYRTLYGHMQGFAKGIQTGGTVKQGQVIGYIGTTGLSTGPHLHYEFQVNGVHVDPL 432

Query: 610 KVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
             ++P  + +     QRF  + + + + ++  +        S+
Sbjct: 433 GQKLPMADPIAKSEKQRFMQQSQPLMARMDQEKATT---LASN 472


>gi|330963949|gb|EGH64209.1| peptidase, M23/M37 family protein [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 474

 Score =  360 bits (924), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 103/463 (22%), Positives = 177/463 (38%), Gaps = 25/463 (5%)

Query: 191 FPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSK 250
           FP+     +       +        Q      +   +     +    +D   D     + 
Sbjct: 34  FPSSEVEAKR-TNLALDLEMPDQDVQDQDAAKEPQATPETTESPFAQIDNADDQAQDTAA 92

Query: 251 KIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKN 310
                       + +       +     + +    T+       G       ++  + K 
Sbjct: 93  AQP--------EAEKPAPAAAKDPNHREVTVSKGDTLSTLFEKVGLPASTVHEVLASDKQ 144

Query: 311 EVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDI 370
             +  +L   + L+  +        +     + K   L TI+L+ +            + 
Sbjct: 145 AKQFSKLQNGQTLQFELSPDGQLKQL-----HTKLGELETISLSKS------ASGFVFNR 193

Query: 371 NHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETF 430
                 +R +     I   + ++    G+   +   +       ++  + ++  D  +  
Sbjct: 194 EISKPNVRNAYVHGVINSSLSQSAQRAGLTHTMTMDMANIFGYDIDFAQDIRKGDEFDVV 253

Query: 431 FSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPV 490
           +     N +      +L              R+ +    +  Y+  +G S R   +RTPV
Sbjct: 254 YEQKVVNGKNVGTGNILSARFTNRGKTYTAVRYTSKQG-TTNYYTADGNSMRKAFIRTPV 312

Query: 491 PFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLI 549
            F R++S F M   HPIL   R H GVD+AAPRGTPI A GDG V  A   GGYG   +I
Sbjct: 313 DFARISSMFSMGRKHPILNKIRAHKGVDYAAPRGTPIKATGDGKVLLAGRRGGYGNTVII 372

Query: 550 HHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDST 609
            HG+ Y + Y H    AK ++ G  VKQGQ+IG+IGTTGLSTGPHLHYE  VNG+ VD  
Sbjct: 373 QHGDTYRTLYGHMQGFAKGVQTGGTVKQGQVIGYIGTTGLSTGPHLHYEFQVNGVHVDPL 432

Query: 610 KVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
             ++P  + +     QRF  + + + + ++  +        S+
Sbjct: 433 GQKLPMADPIAKSEKQRFMQQSQPLMARMDQEKATT---LASN 472


>gi|213967617|ref|ZP_03395764.1| peptidase, M23/M37 family [Pseudomonas syringae pv. tomato T1]
 gi|301381482|ref|ZP_07229900.1| peptidase, M23/M37 family protein [Pseudomonas syringae pv. tomato
           Max13]
 gi|302058571|ref|ZP_07250112.1| peptidase, M23/M37 family protein [Pseudomonas syringae pv. tomato
           K40]
 gi|302132205|ref|ZP_07258195.1| peptidase, M23/M37 family protein [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|213927393|gb|EEB60941.1| peptidase, M23/M37 family [Pseudomonas syringae pv. tomato T1]
          Length = 474

 Score =  360 bits (924), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 101/482 (20%), Positives = 175/482 (36%), Gaps = 36/482 (7%)

Query: 192 PTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKK 251
           P         H      I   +     +  + + ++     A    +  +       +K 
Sbjct: 6   PKAPPLYPKSHLLAASGIAALLSLALLVFPSSEVEAKRTNLALDLEMPDQDVQDQDAAKD 65

Query: 252 IKIIEENR--TITSPQVLIDKIPEFAD------------------DLIPIQHNTTIFDAM 291
            +   E             D+    A                     + +    T+    
Sbjct: 66  TQATPETTESPFAQIDNADDQAQNTATAQPEAEKPAPAAAKDPNHREVTVSKGDTLSTLF 125

Query: 292 VHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTI 351
              G       ++  + K   +  +L   + L+  +        +              +
Sbjct: 126 EKVGLPASTVHEVLASDKQARQFSKLQNGQTLQFELSPDGQLKQLH-----------TKL 174

Query: 352 ALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTL 411
           +  +             +       +R +     I   + ++    G+   +   +    
Sbjct: 175 SELETISLSKSASGFVFNREISKPNVRNAYVHGVITSSLSQSAQRAGLTHTMTMDMANIF 234

Query: 412 ASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSV 471
              ++  + ++  D  +  +     N ++     +L              R+ +    + 
Sbjct: 235 GYDIDFAQDIRKGDEFDVVYEQKVVNGKSVGTGNILSARFTNRGKTYTAVRYTSKQG-TT 293

Query: 472 EYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVG 530
            Y+  +G S R   +RTPV F R++S F M   HPIL   R H GVD+AAPRGTPI A G
Sbjct: 294 NYYTADGNSMRKAFIRTPVDFARISSMFSMGRKHPILNKIRAHKGVDYAAPRGTPIKATG 353

Query: 531 DGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLS 590
           DG V  A   GGYG   +I HG+ Y + Y H    AK ++ G  VKQGQ+IG+IGTTGLS
Sbjct: 354 DGKVLLAGRRGGYGNTVIIQHGDTYRTLYGHMQGFAKGVQTGGTVKQGQVIGYIGTTGLS 413

Query: 591 TGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFT 650
           TGPHLHYE  VNG+ VD    ++P  + +     QRF  + + + + ++  +        
Sbjct: 414 TGPHLHYEFQVNGVHVDPLGQKLPMADPIAKSEKQRFMQQSQPLMARMDQEKATT---LA 470

Query: 651 SH 652
           S+
Sbjct: 471 SN 472


>gi|85711800|ref|ZP_01042856.1| Peptidase, M23/M37 family protein [Idiomarina baltica OS145]
 gi|85694415|gb|EAQ32357.1| Peptidase, M23/M37 family protein [Idiomarina baltica OS145]
          Length = 438

 Score =  360 bits (923), Expect = 5e-97,   Method: Composition-based stats.
 Identities = 94/415 (22%), Positives = 163/415 (39%), Gaps = 18/415 (4%)

Query: 230 LYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFD 289
           L+    Q    ++          +  + +      Q + ++ PE       ++   ++  
Sbjct: 35  LFVPTEQATASKNSTKPEQLLPGQRYQLDLVFEPEQQVDNQQPELFWQTYVVKSGDSLAK 94

Query: 290 AMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLL 349
                G+S     ++  +     ++  +   + LRI     D+   +V            
Sbjct: 95  IFDTLGFSAQQLYRVTHSGSEAKKLRNMHPGDELRIATDSNDELVQLVHHI----SGLQT 150

Query: 350 TIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMR 409
            I    N ++V        +I  +    RT      I    W A    GM  N +  +  
Sbjct: 151 LIITRQNEDFVS-------EIETREVETRTEFAHAVIDSSFWSAAMNAGMTDNQIMSVAN 203

Query: 410 TLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDG 469
                ++    L+  D     F     + +     ++L                      
Sbjct: 204 IFGWDIDFALDLRKGDEFSVLFEREFVDGEFVGYGKILAAEFVNQGE----VFQAVLNAE 259

Query: 470 SVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVA 528
           +  Y+   G++ R   LR+PV F  ++S F  R  HP+ G  R H G D+ A  GTP+++
Sbjct: 260 NGRYYTPEGRAMRKTFLRSPVNFTYVSSNFNPRRLHPVTGRVRPHNGTDYVAAVGTPVMS 319

Query: 529 VGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTG 588
            GDG V KA++    G    I HG  YV+ Y H     K++K G  V QGQIIG +G+TG
Sbjct: 320 AGDGRVIKASYNSLNGNYVFIQHGERYVTKYLHLSR--KHVKTGDRVSQGQIIGRVGSTG 377

Query: 589 LSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGEN 643
             TG HLHYE +VNG+  +   V +P+ ++L    L  F    +++ ++LN+ + 
Sbjct: 378 RVTGAHLHYEFLVNGVHRNPRTVELPKAKSLSESELPAFRAHAQQLVAVLNDNKR 432


>gi|302189576|ref|ZP_07266249.1| peptidase M23B [Pseudomonas syringae pv. syringae 642]
          Length = 474

 Score =  359 bits (922), Expect = 6e-97,   Method: Composition-based stats.
 Identities = 109/474 (22%), Positives = 184/474 (38%), Gaps = 37/474 (7%)

Query: 180 DSFEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLD 239
            S +V  ++ N P D+     +   QD + ++A           ++    +  AD Q  D
Sbjct: 35  PSSDVEAKRTNIPLDL-----EAPDQDVQDQDAQQATQATPETTESPFAQIDNADVQAQD 89

Query: 240 QRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNG 299
                P                           + A   + +    T+       G    
Sbjct: 90  TADAQPQAEKPA----------------PSAAKDPAHREVTVSKGDTLSTLFEKVGLPAA 133

Query: 300 DSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEY 359
              ++  + K   +  +L   + L+  +        +              ++  ++   
Sbjct: 134 TVHEVLASDKQAKQFSKLQNGQTLQFELTPDGQLKQLH-----------TKLSEVESISL 182

Query: 360 VLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQE 419
                    +       +R +     I   + ++    G+  ++   +       ++  +
Sbjct: 183 SKTATGYAFNREISKPNVRNAYVHGVINSSLSQSAQRAGLTHSMTMDMANIFGYDIDFAQ 242

Query: 420 HLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGK 479
            ++  D  +  +     N ++     +L              R+ N    +  Y+  +G 
Sbjct: 243 DIRKGDEFDVVYEQKVVNGKSVGTGNILSARFTNRGKTYTAVRYTNKQG-NTNYYTADGN 301

Query: 480 SSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKAN 538
           S R   +RTPV F R++S F M   HPIL   R H GVD+AAPRGTPI A GDG V  A 
Sbjct: 302 SMRKAFIRTPVDFARISSMFSMGRKHPILNKIRAHKGVDYAAPRGTPIKATGDGKVLLAG 361

Query: 539 WAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYE 598
             GGYG   +I HG+ Y + Y H    AK I+ G  VKQGQ+IG+IGTTGLSTGPHLHYE
Sbjct: 362 RRGGYGNTVIIQHGDTYRTLYGHMQGFAKGIQTGGTVKQGQVIGYIGTTGLSTGPHLHYE 421

Query: 599 LIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
             VNG+ VD    ++P  + +     QRF  + + + + ++  +        S+
Sbjct: 422 FQVNGVHVDPLGQKLPMADPIAKSEKQRFMQQSQPLMARMDQEKATT---LASN 472


>gi|297182118|gb|ADI18291.1| membrane proteins related to metalloendopeptidases [uncultured
           Chromatiales bacterium HF0200_41F04]
          Length = 507

 Score =  359 bits (922), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 103/449 (22%), Positives = 182/449 (40%), Gaps = 24/449 (5%)

Query: 210 KNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPIT----YSKKIKIIEENRTITSPQ 265
           +  I     +L       FTL +  P +         +       +I    +   +  P 
Sbjct: 46  ERQIAVCALVLSIAIGAIFTLRHILPTSAATSDLRATSSIVLELPEISSTSKISAVKLPN 105

Query: 266 VLIDKIPEFA-------DDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLT 318
             I   P             + +     +       G+S  D  +I         +  + 
Sbjct: 106 DRIPFEPRTYNSAKASNWSTVTVAPGDNLSLIFGRYGFSKKDLHQILALGPEAKNLRSIK 165

Query: 319 KDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMR 378
             + +++          IV+   Y +  H+           V  ++   M I      +R
Sbjct: 166 PGQQIKVRSDGHGRVIEIVQELDYLRSLHV-----------VSELDNYSMAIVEIEPEIR 214

Query: 379 TSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANN 438
            +     I   ++      G++   +  +       ++    ++  D     F     ++
Sbjct: 215 HASAQAEIKHSLFLDGQAAGLSDKTIMELADIFGWDIDFVLDVRVGDRFSVVFEELFKDD 274

Query: 439 QASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSG 498
           +   + ++L         + R   + +  DG+ +Y+++ G++ R   LR PV F R++S 
Sbjct: 275 EKVKNGKILAAEFVNRGEKLRAVYY-SKADGTGDYYSDTGRAMRKAFLRAPVNFTRISSR 333

Query: 499 FG-MRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVS 557
           F   R HP+L   R H GVD+AAP GTPI A  DG +  A   GGYG+  +I HG  Y +
Sbjct: 334 FNLRRRHPVLNTIRAHKGVDYAAPHGTPIRATADGKIIFAGNKGGYGRTVVIQHGESYST 393

Query: 558 SYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERE 617
            + H   I++ +K G+ +KQGQ IG++G TGL+TGPHLHYE  +NG+  +  KVR+PE  
Sbjct: 394 LFAHMSRISRGVKNGSRIKQGQTIGYVGKTGLATGPHLHYEFRINGVHRNPLKVRLPEAL 453

Query: 618 NLKGDLLQRFAMEKKRINSLLNNGENPKK 646
            L+   +  F    + + + LN   +  K
Sbjct: 454 PLEKKYIADFLSRAEPLLTQLNGLSDVAK 482


>gi|330938385|gb|EGH42011.1| peptidase M23B [Pseudomonas syringae pv. pisi str. 1704B]
          Length = 475

 Score =  359 bits (921), Expect = 8e-97,   Method: Composition-based stats.
 Identities = 102/463 (22%), Positives = 175/463 (37%), Gaps = 24/463 (5%)

Query: 191 FPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSK 250
           FP+     +  +   D E      +Q     + +  +            Q  +       
Sbjct: 34  FPSSEVEAKRTNIPLDLEA----PDQDVQDQDAQQATQATPETTESPFAQIDNADDQAQD 89

Query: 251 KIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKN 310
                 +                     + +    T+       G       ++  + K 
Sbjct: 90  TASAQPQAEKPAPAAAKDPAH-----REVTVSKGDTLSTLFEKVGLPAATVHEVLASDKQ 144

Query: 311 EVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDI 370
             +  +L   + L+  +        +        +   ++++      Y         + 
Sbjct: 145 AKQFSKLQNGQTLQFELTPDGQLKQLHT---KLSEVESISLSKTATGGY-------AFNR 194

Query: 371 NHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETF 430
                 +R +     I   + ++    G+  ++   +       ++  + ++  D  +  
Sbjct: 195 EISKPNVRNAYVHGVINSSLSQSAQRAGLTHSMTMDMANIYGYDIDFAQDIRKGDEFDVV 254

Query: 431 FSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPV 490
           +     N ++     +L              R+ N    +  Y+  +G S R   +RTPV
Sbjct: 255 YEQKVVNGKSVGAGNILSARFTNRGKTYTAVRYTNKQG-NTNYYTADGNSMRKAFIRTPV 313

Query: 491 PFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLI 549
            F R++S F M   HPIL   R H GVD+AAPRGTPI A GDG V  A   GGYG   +I
Sbjct: 314 DFARISSMFSMGRKHPILNKIRAHKGVDYAAPRGTPIKATGDGKVLLAGRRGGYGNTVII 373

Query: 550 HHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDST 609
            HG+ Y + Y H    AK I+ G  VKQGQ+IG+IGTTGLSTGPHLHYE  VNG+ VD  
Sbjct: 374 QHGDTYRTLYGHMQGFAKGIQTGGTVKQGQVIGYIGTTGLSTGPHLHYEFQVNGVHVDPL 433

Query: 610 KVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
             ++P  + +     QRF  + + + + ++  +        S+
Sbjct: 434 GQKLPMADPIAKSEKQRFMQQSQPLMARMDQEKATT---LASN 473


>gi|120553630|ref|YP_957981.1| peptidase M23B [Marinobacter aquaeolei VT8]
 gi|120323479|gb|ABM17794.1| peptidase M23B [Marinobacter aquaeolei VT8]
          Length = 459

 Score =  359 bits (920), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 100/471 (21%), Positives = 182/471 (38%), Gaps = 25/471 (5%)

Query: 180 DSFEVTTQKINFPTDITRIQLDHTAQDEEIKNA--IMNQFFLLHNKKNQSFTLYYADPQT 237
               +T            + +  +A  E  + +  +  +  L+    +Q      A P+ 
Sbjct: 6   PKTHITLAAAATVIVSAAVLMSPSADVEAKRMSYTVDLEQGLISGASSQEANTQAAAPEA 65

Query: 238 LDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYS 297
                                      Q  +   P+       I+   T+      AG++
Sbjct: 66  ETTSETTESQSQPMAA-----------QADVAPEPDIQWQEFTIKSGDTLSTLFRKAGFN 114

Query: 298 NGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNN 357
           +G    +        ++ +L   E +R GV  + +   +V   +       L IA  ++ 
Sbjct: 115 DGLMLSVIHGDGEADKLQRLYAGEDIRFGVNSEGE---LVAIELQRSLLESLKIARTEDG 171

Query: 358 EYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNL 417
                      +   +    R +  +  I   ++ +    G+N  L   +       ++ 
Sbjct: 172 --------FLGETVVREPEARPAFAAGVIDGSLYLSARDAGLNDRLTMELAGIFGWDIDF 223

Query: 418 QEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNEN 477
              ++  D  E  +   + + +  D   +L               + +    S +Y++ +
Sbjct: 224 VYDVRKGDSFEVVYEELYIDGEKFDTGRILSARFINRGEDNLALLYTDANGES-DYYSPD 282

Query: 478 GKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKA 537
           GKS R   LR P+     +     R HP+L   R H G D+AAP GTPI A G G V+ A
Sbjct: 283 GKSMRKAFLRVPINARVSSPFNLQRRHPVLDVVRPHEGTDYAAPPGTPIKAAGSGRVKFA 342

Query: 538 NWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHY 597
            W GGYG+  ++ HG+   + Y H   + K IK GT VKQG+ IG++G++G+ TGPHLHY
Sbjct: 343 GWKGGYGRTVVLQHGDNITTLYAHMSRLGKGIKNGTRVKQGETIGYVGSSGMVTGPHLHY 402

Query: 598 ELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPL 648
           E  +NG   +S  V++P+ + +    + RF    ++  +  N      + L
Sbjct: 403 EFRINGAPRNSRTVKLPDAKPVPDSEMARFQKFTEQRLAQFNVFRESNQQL 453


>gi|332535491|ref|ZP_08411272.1| putative peptidase, M23/M37 family protein [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332035101|gb|EGI71616.1| putative peptidase, M23/M37 family protein [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 437

 Score =  357 bits (917), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 90/387 (23%), Positives = 159/387 (41%), Gaps = 18/387 (4%)

Query: 257 ENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQ 316
           E  T  + +   +K+PE+      +++   +      AG+S     K+        ++ +
Sbjct: 61  EKLTELNSEQAAEKLPEYDFVDHKVKNGDNLAIIFKRAGFSAQTLHKLINTNAETRKLTK 120

Query: 317 LTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDY 376
           +   EIL     +      +        +   L + LN+   Y   ++  +++   +   
Sbjct: 121 IHPGEILSFATAEDGSLAQLRYVI---SKTDTLFVTLNEEGNYDTAIDSKEIETLTK--- 174

Query: 377 MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHA 436
                    I +  W +    G++   +          V+    ++  D     +  ++ 
Sbjct: 175 ----TAGGEISNNFWTSAIAAGLSERQIMNFADIFGWDVDFANDIRKGDVFGLIYESHYV 230

Query: 437 NNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMT 496
           + +     +++         R    R  +       ++   G+S +   LR PV F  ++
Sbjct: 231 DGEFIGTGKIIAAEFVNQGQRFAAIRHTDGN-----FYTPEGRSMKKAFLRAPVSFKYIS 285

Query: 497 SGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGY 555
           S F  R  HP+ G  R H G+D+AA  GTP+VA G+G V KA ++   G    I HG  Y
Sbjct: 286 SSFNPRRLHPVTGQVRAHRGIDFAARTGTPVVASGNGKVVKAGYSKYNGNYVFISHGTQY 345

Query: 556 VSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPE 615
           V+ Y H +   K +K G  VKQGQ IG +G+TG  TG HLHYE +VNG+  +   V++P+
Sbjct: 346 VTKYLHLNK--KLVKTGQKVKQGQQIGTVGSTGRVTGAHLHYEFLVNGVHRNPKTVKLPK 403

Query: 616 RENLKGDLLQRFAMEKKRINSLLNNGE 642
            E L    L +F        + L    
Sbjct: 404 SEPLPRSELAKFKPIADNFIAQLERNR 430


>gi|212636578|ref|YP_002313103.1| peptidase, M23/M37 family [Shewanella piezotolerans WP3]
 gi|212558062|gb|ACJ30516.1| Peptidase, M23/M37 family [Shewanella piezotolerans WP3]
          Length = 466

 Score =  357 bits (917), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 107/470 (22%), Positives = 190/470 (40%), Gaps = 29/470 (6%)

Query: 184 VTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHD 243
           VT   +  P+D  +      + + E           L  +         +  Q   +   
Sbjct: 25  VTLIIVLIPSDDVQASKQTVSSNGEYDLNTRYD-VPLAFRTPTPPAGSDSINQHNAETRK 83

Query: 244 HPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAK 303
            P+  S      +      + Q  +D  P   +    ++   T+      AG +  D   
Sbjct: 84  QPLAQSSSSNQAQ------TEQTTVDIEPVLNEKHFQVKSGDTLAALFSRAGLTAKDVYD 137

Query: 304 IAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGV 363
           + +  K++  + ++   + L I    K+D+  +++   +  +   L +   D        
Sbjct: 138 VTQLPKSKKNLLKIMPGDELVIA---KNDEGQLMQLRYHLDKISTLVVNRVDG------- 187

Query: 364 EPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKP 423
              +  I+ +   +R+   +  I +  W A    G+  N +  +       ++    L+ 
Sbjct: 188 -KYQESISTKQVEIRSKFANATIENNFWNAGVAAGLTPNQIMQLATIYGWDIDFALDLRK 246

Query: 424 TDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRP 483
            D     F   +A+ +   +  +L              R+ +       Y++  G+S R 
Sbjct: 247 GDSFSILFEEEYADGEFLRNGNILAAEFTNQGDLYTAVRYKDGN-----YYSAEGRSMRK 301

Query: 484 FLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGG 542
             LR+PV F  ++S F  R  HP+ G  R H GVD+ A  GTPI A G G V K+ +   
Sbjct: 302 AFLRSPVDFKYVSSSFNPRRLHPVTGQVRAHRGVDYVAAVGTPIKAAGKGRVIKSAYNQY 361

Query: 543 YGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVN 602
            G    I H + Y + Y H     + +K G +VKQGQIIG +G+TG  TG HLHYE IVN
Sbjct: 362 NGNYVFIKHNDTYTTKYLHLKK--RKVKTGASVKQGQIIGTLGSTGRVTGAHLHYEFIVN 419

Query: 603 GIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
           G+  +   V++P+ + +      +FA+  K+   L+   E+ K+  F SH
Sbjct: 420 GVHRNPRTVKLPKSQAIAKKEKAQFAIVSKK---LMGELEHNKQVQFASH 466


>gi|297170375|gb|ADI21409.1| membrane proteins related to metalloendopeptidases [uncultured
           gamma proteobacterium HF0010_21A16]
          Length = 431

 Score =  357 bits (917), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 92/378 (24%), Positives = 164/378 (43%), Gaps = 14/378 (3%)

Query: 264 PQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEIL 323
           P     +       +I ++ N T+ + +  AG SN     + KA K   ++  L   + L
Sbjct: 57  PLTSEKEQTSNRTHIIYVEKNNTLIELLDKAGLSNKYIRALIKA-KGSEKLANLKIGDKL 115

Query: 324 RIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEES 383
            I + +      +               A   N  + +G    + D+  +   +      
Sbjct: 116 EIDINRD----QVPENIFLTSDGLNGINANFKNGLFSIGTASRQPDVLERFASVE----- 166

Query: 384 PNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDD 443
             I D ++ +   +G+  +++  ++      ++    ++P D  +  +           +
Sbjct: 167 --IEDSLYSSALKSGIPDSVIMDMVYIFGWDIDFIFDIRPGDSFDILYEEYFLKGNQVKN 224

Query: 444 SELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY 503
            ++     + G+      R+        E+F+  GK+     LR+PV F  ++S + ++ 
Sbjct: 225 GDIKAARFKRGKKVYTAIRYFLKNG-EKEFFSIRGKNVEKAFLRSPVEFSYISSKYNLKR 283

Query: 504 -HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQ 562
            HPIL   + HTGVD+AAP GTP+   GDG V      GGYGK   I H   Y + Y H 
Sbjct: 284 MHPILNKIKAHTGVDYAAPTGTPVRTTGDGTVSFRGNNGGYGKLIEIKHSEDYSTRYAHL 343

Query: 563 DAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGD 622
               KN+K G  V QG++IG++G+TG STGPHLHYE  VNG+  D   V++P  + +  +
Sbjct: 344 SRYKKNLKVGDKVSQGEVIGYVGSTGRSTGPHLHYEFRVNGMHTDPLTVKLPAAKPISEN 403

Query: 623 LLQRFAMEKKRINSLLNN 640
               F        +++++
Sbjct: 404 EKDSFFKTAIEAMNMMDD 421


>gi|254490091|ref|ZP_05103283.1| M23 peptidase domain protein [Methylophaga thiooxidans DMS010]
 gi|224464679|gb|EEF80936.1| M23 peptidase domain protein [Methylophaga thiooxydans DMS010]
          Length = 489

 Score =  357 bits (915), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 109/466 (23%), Positives = 191/466 (40%), Gaps = 22/466 (4%)

Query: 179 VDSFEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTL 238
             S  V+T+  +   ++         Q + +         L                  +
Sbjct: 15  ATSTPVSTETKSQLLNLPNQNAQQQEQSKAVTEKQPLTLSLAEPASLPEVNAPAVQRVPV 74

Query: 239 DQRHDHPITYSKKIKII-----------EENRTITSPQVLIDKIPEFADDLIPIQHNTTI 287
             + +  I    +I+ I           E + T+T     + +        + ++    +
Sbjct: 75  PNQIEAKIAEPDEIERIHLKQDSLDVTTETDITVTPAATAVTEDINLNWQEVTVKGGDNL 134

Query: 288 FDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKH 347
                  G S  D   +A+  ++   +  L  D+ LR G+ + +DK  + +  +      
Sbjct: 135 SLIFPRVGLSARDVYNVAQT-EDIKPLLNLKPDQTLRFGLRETEDKTQLQQLELQLSPVE 193

Query: 348 LLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLI 407
            L + L ++          +     +    R  + +  I   ++ A   +GM+  L+  +
Sbjct: 194 KLQLTLTESG--------YQAQTETRETDKRQKQVAGQIESSLFEAGLMSGMSDKLIMEL 245

Query: 408 MRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPV 467
                  ++    L+  D  +  F  ++ + +  DD ++L        T  R  R+ +  
Sbjct: 246 AHIFGWDIDFALDLRQGDNFKVIFEESYLDGEKFDDGDILAAEFTNRGTTFRAVRYTDAE 305

Query: 468 DGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPI 526
             S  Y    G S R    RTPV F R++S F     HP+L  SR H GVD+AA  GTPI
Sbjct: 306 GNSHFY-APTGDSMRKTFTRTPVHFSRISSRFNPNRKHPVLKTSRPHRGVDYAAATGTPI 364

Query: 527 VAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGT 586
           +A GDG V+     GGYG+  ++ HG  Y + Y H     K +++G  VKQGQ IG+IG+
Sbjct: 365 LATGDGKVDFIGTKGGYGRTVILSHGGKYTTLYAHMSRFKKGMRSGQRVKQGQTIGYIGS 424

Query: 587 TGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKK 632
           +GL+TGPHLHYE  VNG+  +   V +P+ + L    +  F  + +
Sbjct: 425 SGLATGPHLHYEFRVNGVHHNPLTVALPKAKPLNAKYMADFQQKSQ 470


>gi|114048454|ref|YP_739004.1| peptidase M23B [Shewanella sp. MR-7]
 gi|113889896|gb|ABI43947.1| peptidase M23B [Shewanella sp. MR-7]
          Length = 491

 Score =  357 bits (915), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 101/470 (21%), Positives = 177/470 (37%), Gaps = 29/470 (6%)

Query: 182 FEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQR 241
             +TT  + FP++  +         ++ +        L      +               
Sbjct: 48  SVITTITLLFPSEEAQASRQTQGVADQAQVNTRYDVPLAFRSPERPEGAEGQLQDESANA 107

Query: 242 HDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDS 301
                  +     +  + T+ S      +          +++  T+      AG ++ D 
Sbjct: 108 TPLSSADALAAGNVPASETLESAHHRDVEHFN-------VKNGDTLAAVFERAGLTSKDV 160

Query: 302 AKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVL 361
            +I +    +  + ++   E + I    K D   +            L I          
Sbjct: 161 YEITQLPLAKQNLLKIIPGEEIVISKDAKGD---LTEVRYRVDAVSTLVITK-------- 209

Query: 362 GVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHL 421
             +     I+ +   +RT   S  I    W A    G+N+N +  +       ++    L
Sbjct: 210 AQDKYSEKISEKDIEIRTQFTSAKIKSNFWNAAVDAGLNANQIMQLSTVFGWDIDFALDL 269

Query: 422 KPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSS 481
           +  D     +   +A  +   +  +L       + R    R+ +       Y++ENG S 
Sbjct: 270 REGDSFAIIYEQEYAEGEFLRNGNILAAEFINQDERYTAVRYTDGN-----YYSENGTSM 324

Query: 482 RPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWA 540
           R   LR+PV F  ++S F  +  HP+ G  + H GVD+ A  GTPI A G+G V ++ + 
Sbjct: 325 RKAFLRSPVDFKYVSSNFNPKRLHPVTGQVKAHRGVDYVAAIGTPIKAAGNGRVIESGYN 384

Query: 541 GGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELI 600
              G    I H N Y + Y H     +N+  G +VKQGQIIG +G TG  TG HLHYE I
Sbjct: 385 QFNGNYVFIKHNNTYTTKYLHLTK--RNVSKGASVKQGQIIGTLGKTGRVTGAHLHYEFI 442

Query: 601 VNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFT 650
           VNG+  +   V +P+ E++      +F    K+   L+ +    K+    
Sbjct: 443 VNGVHRNPRTVDLPKAESIARKERSQFDALSKQ---LMASISQNKQTQLA 489


>gi|237746827|ref|ZP_04577307.1| conserved hypothetical protein [Oxalobacter formigenes HOxBLS]
 gi|229378178|gb|EEO28269.1| conserved hypothetical protein [Oxalobacter formigenes HOxBLS]
          Length = 451

 Score =  356 bits (914), Expect = 5e-96,   Method: Composition-based stats.
 Identities = 97/412 (23%), Positives = 179/412 (43%), Gaps = 14/412 (3%)

Query: 241 RHDHPITYSKKIKIIEENRTITSPQVLIDKIP---EFADDLIPIQHNTTIFDAMVHAGYS 297
               P T     +IIEE   ++S    ++K+    +F      ++   T+   +   G +
Sbjct: 40  PGTPPDTSDIAFRIIEEEVQLSSLDKQLEKLKKDRQFYIREDKVRSGDTLGTLLSRLGVN 99

Query: 298 NGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNN 357
           + ++A   K  +      QL   ++++     +   +T+             T+    ++
Sbjct: 100 DREAADFIKTHEKSRIFLQLKTGQVVQAKTDNRGRLYTLSTLLPNPDDIQTNTVVTRTDS 159

Query: 358 EYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNL 417
            + +  + V+M+             S  I   ++ AT   G+   + +  +   ++ ++ 
Sbjct: 160 GFTVSNDTVQMEKI-------VEMRSGTIQSSLFAATDAAGVPDPVTRKFIEMFSTDIDF 212

Query: 418 QEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNEN 477
              L+  D     +     N +      +L        T  +   F         Y++ N
Sbjct: 213 NSDLRRGDRFNIVYETYWQNGKFLKTGHILAAEFVNKGTPYQSIWFE-RAPNKGGYYDFN 271

Query: 478 GKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKA 537
           GKS +   L++P+ F R++SGF MR HP+ G  R H G+D+AAP GTPI A  DG +  +
Sbjct: 272 GKSQKKAFLKSPLEFTRVSSGFSMRIHPVTGKIRQHKGIDFAAPTGTPIRAAADGTISFS 331

Query: 538 NWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHY 597
            W  GYG   ++ H   Y ++Y H   IA  +  G  V QG +IG++GTTG+STGPHLHY
Sbjct: 332 GWQNGYGNFIVLKHWGAYSTAYGHMSRIAAGMTRGKKVSQGDVIGYVGTTGISTGPHLHY 391

Query: 598 ELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRIN---SLLNNGENPKK 646
           E  VN ++ +  ++ +P    L    + RF      +    +L+++    ++
Sbjct: 392 EFRVNNVQQNPAQIDMPNAHPLTSREMVRFRTHLADMQHRFALMDSTSANQR 443


>gi|254428893|ref|ZP_05042600.1| M23 peptidase domain protein [Alcanivorax sp. DG881]
 gi|196195062|gb|EDX90021.1| M23 peptidase domain protein [Alcanivorax sp. DG881]
          Length = 441

 Score =  356 bits (914), Expect = 5e-96,   Method: Composition-based stats.
 Identities = 98/430 (22%), Positives = 164/430 (38%), Gaps = 16/430 (3%)

Query: 210 KNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLID 269
                    LL         L    P + +   +     S   +                
Sbjct: 12  VRQFPRTHLLLSMVLLGGVILIAFRPDSTETAPERVQAISLPERTAPAP---KPQTTSKP 68

Query: 270 KIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQ 329
                    + +Q   ++   +   G   G    + K      R+ +L   E L + V  
Sbjct: 69  APATPQWQTLTVQSGDSLSSLLHPLGIGAGQIDALLKGDDKLKRLTRLRPGEALEVIVSD 128

Query: 330 KDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDG 389
                 +     +  +   LT  L              + ++ +    +T     +I   
Sbjct: 129 SGS---LTNVRYHPSKVETLTARLTGGG--------WNVRLSQREYQKQTRFAQADITGS 177

Query: 390 IWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYI 449
           ++ A +  G+   L   +    A  V+    ++  D     +   + + +   + ++L  
Sbjct: 178 LFLAGAAAGITDRLTMQLANLFAWDVDFALDIRKGDRFRILYEELYLDGEKVGEGDILMA 237

Query: 450 HARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILG 508
                      +R+       VEY N  G S R   +RTPV F R++S F +   HP+L 
Sbjct: 238 EFWNQGRHLTAFRYETLSGD-VEYLNIKGDSMRKEFIRTPVAFARISSRFNLSRKHPVLN 296

Query: 509 YSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKN 568
             R H G D+AAP GTPI A GDG V  A   GGYG   ++ HG  Y + Y H  + AK 
Sbjct: 297 RIRAHKGTDYAAPSGTPIKAAGDGKVIFAGVKGGYGNVIILKHGQIYTTLYAHMRSFAKG 356

Query: 569 IKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFA 628
           I+ G  VKQ Q IG++G++GL+TGPHLHYE  +NG+  +   V +P+   +  +    F 
Sbjct: 357 IRVGKRVKQSQTIGYVGSSGLATGPHLHYEFRINGVHRNPQTVPLPKARGINDNERAEFL 416

Query: 629 MEKKRINSLL 638
           +   R+ + +
Sbjct: 417 IAANRLKAQM 426


>gi|237748968|ref|ZP_04579448.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13]
 gi|229380330|gb|EEO30421.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13]
          Length = 473

 Score =  356 bits (914), Expect = 6e-96,   Method: Composition-based stats.
 Identities = 91/414 (21%), Positives = 170/414 (41%), Gaps = 12/414 (2%)

Query: 241 RHDHPITYSKKIKIIEENRTITSPQVLIDK---IPEFADDLIPIQHNTTIFDAMVHAGYS 297
               P   +  +  ++E+  + S    ++K     +F      I+   T+   +   G  
Sbjct: 67  PGSPPDKDNITVTTVKEDIPLPSLSDQLEKLRGEKQFFAREDKIRPGDTLGTLLTRLGVD 126

Query: 298 NGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNN 357
           +  + +  K+ +       L     ++     K   + +   +   ++   + +   D  
Sbjct: 127 DQQAFQFIKSDEKAKAFLHLKAGRTVQAKTDDKGTLYWLSAATTDPQEGVTIVVTRTDAG 186

Query: 358 EYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNL 417
            +    E  K +             S  I   ++ AT   G+   + K ++   ++ ++ 
Sbjct: 187 -FTSSNEVAKTERI-------VEMRSGTIQSSLFGATDTAGVPDAVTKKLIEMFSTHIDF 238

Query: 418 QEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNEN 477
              L+  D     +     N +      +L           +   F        +Y++ +
Sbjct: 239 NSDLRRGDHFNVVYETFWQNGKLLRTGNILAAEFVNAGETHQIIWFERLPG-KGDYYDFS 297

Query: 478 GKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKA 537
           GKS++   L++P+ F R++SGF  R HP+ G  R H G+D+AAP GTPI A  DG +  +
Sbjct: 298 GKSNKKAFLKSPLEFTRVSSGFATRVHPVTGNIRQHKGIDFAAPTGTPIRAAADGTINFS 357

Query: 538 NWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHY 597
            W  GYG   ++ H   Y ++Y H   IA  +  G  V QG IIG++G+TGLSTGPHLHY
Sbjct: 358 GWQNGYGNFIVLKHWGAYSTAYGHMSRIAPGMSRGKKVSQGDIIGYVGSTGLSTGPHLHY 417

Query: 598 ELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTS 651
           E  VN ++ + TK+ +P    L    + +F      +    +  ++       +
Sbjct: 418 EFRVNNVQQNPTKIDMPNAHPLTAREMVKFKANLADMQHRFSLMDSSSHQRQAA 471


>gi|296775657|gb|ADH42934.1| membrane protein [uncultured SAR11 cluster alpha proteobacterium
           H17925_23J24]
          Length = 442

 Score =  356 bits (914), Expect = 6e-96,   Method: Composition-based stats.
 Identities = 103/391 (26%), Positives = 190/391 (48%), Gaps = 17/391 (4%)

Query: 257 ENRTITSPQVLIDK-IPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVD 315
            N+T+     L+++    + +    +Q+N TI   +        +   I + +K + ++ 
Sbjct: 65  NNQTVLLKNYLLNQLKSPYLEYDYIVQNNDTIESILKKFSVKQSEINFIVEKIKKK-KLS 123

Query: 316 QLTKDEILRIGVVQKDDKF--TIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQ 373
            +   + ++  + +  +K    +++ +        + I    +         +++  N  
Sbjct: 124 NIIPKQKMKFILKRTKEKKDMEVLKINYPLSDTTFVNIDKRQDG--------IEIKKNIT 175

Query: 374 MDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSV 433
             + R      NI + ++ +    GM  N++    R     V+ Q  ++  D  E  +  
Sbjct: 176 QLFKRDVVVEGNIKNNLYSSAVKAGMEPNIIVEYARIFGFEVDFQRDIRKGDRFEVMYER 235

Query: 434 N-HANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPF 492
                N+     ++LY +      +   YRF    +   +++++ G+S R  L++TP+  
Sbjct: 236 FLDDRNKKVKTGKILYAYLDVNNQKIELYRFGKKNNY--DFYDKKGRSIRKALMKTPING 293

Query: 493 GRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHG 552
            R++SGFG R HPILG+++ H G D+AAP GTPI+A G+G V KA W G  G    I H 
Sbjct: 294 ARLSSGFGNRKHPILGFTKHHNGTDFAAPTGTPIMASGNGTVIKAGWCGNGGNCVRIRHN 353

Query: 553 NGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVR 612
           + Y + Y H    A   K G  V+QGQIIG++G TG+STGPHLHY +  NG  ++S K++
Sbjct: 354 SSYTTGYGHLSKFAT--KTGRRVRQGQIIGYVGNTGMSTGPHLHYTVSYNGKFINSQKLK 411

Query: 613 IPERENLKGDLLQRFAMEKKRINSLLNNGEN 643
           +P  + LKG+  + F +E+ +++  L   +N
Sbjct: 412 LPSGKILKGEERKLFEVERIKLDVKLAELKN 442


>gi|315125690|ref|YP_004067693.1| peptidase, M23/M37 [Pseudoalteromonas sp. SM9913]
 gi|315014204|gb|ADT67542.1| peptidase, M23/M37 [Pseudoalteromonas sp. SM9913]
          Length = 437

 Score =  356 bits (913), Expect = 7e-96,   Method: Composition-based stats.
 Identities = 85/387 (21%), Positives = 156/387 (40%), Gaps = 18/387 (4%)

Query: 257 ENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQ 316
           E  T  + +    K+PE+      +++   +      AG+S     K+        ++ +
Sbjct: 61  EKLTDLNSEQAAQKLPEYDFVDHQVKNGDNLAIIFKRAGFSAQTLHKLVNTNAETRKLTK 120

Query: 317 LTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDY 376
           +   E L     +      +        +   L + LND  +Y   ++  +++   +   
Sbjct: 121 IHPGETLSFATAEDGSLAQLRYVI---SKTDTLFVTLNDEGQYDTSIDSKEIETLSK--- 174

Query: 377 MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHA 436
                    I    W +    G++   +          V+    ++  D     +  +  
Sbjct: 175 ----TAGGEISSSFWTSAIAAGLSERQIMNFADIFGWDVDFANDIRKGDEFGLIYESHFV 230

Query: 437 NNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMT 496
           + +     +++         R    R  +       ++   G+S +   LR PV F  ++
Sbjct: 231 DGEFIGTGKIIAAEFINQGERYTAIRHTDGN-----FYTPEGRSMKKAFLRAPVNFKYIS 285

Query: 497 SGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGY 555
           S F  R  HP+ G  + H G+D+AA  GTP+V+ G+G V KA ++   G    I HG  Y
Sbjct: 286 SSFNPRRLHPVTGQVKAHRGIDYAARTGTPVVSSGNGKVIKAGYSKYNGNYVFISHGTQY 345

Query: 556 VSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPE 615
           V+ Y H +   + ++ G  VKQG+ IG +G+TG  TG HLHYE +VNG+  +   V++P+
Sbjct: 346 VTKYLHLNK--RLVRTGQKVKQGEKIGTVGSTGRVTGAHLHYEFLVNGVHRNPKTVKLPK 403

Query: 616 RENLKGDLLQRFAMEKKRINSLLNNGE 642
            E L    L +F        + L    
Sbjct: 404 SEPLPRSELAKFKPIADNFIAQLERNR 430


>gi|119472228|ref|ZP_01614407.1| putative peptidase, M23/M37 family protein [Alteromonadales
           bacterium TW-7]
 gi|119445046|gb|EAW26341.1| putative peptidase, M23/M37 family protein [Alteromonadales
           bacterium TW-7]
          Length = 437

 Score =  356 bits (913), Expect = 8e-96,   Method: Composition-based stats.
 Identities = 89/418 (21%), Positives = 163/418 (38%), Gaps = 19/418 (4%)

Query: 227 SFTLYYADPQTLDQRHDHPITYSKKIKIIE-ENRTITSPQVLIDKIPEFADDLIPIQHNT 285
                 A         +    Y  ++K+ + E  T  + +   +K+PE+      ++   
Sbjct: 30  PSEKATASKDNNANALEIGKRYELQVKVDDNEKLTELNSEQAAEKLPEYDLVDHKVKTGD 89

Query: 286 TIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQ 345
            +      AG+S     K+        ++ ++   E+L     +      +        +
Sbjct: 90  NLAIIFKRAGFSAQTLHKLINTNAETRKLTKIHPGEVLSFATGKDGALEQLRYVI---SK 146

Query: 346 KHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVK 405
              L + L+D   Y   ++  +++   +            I    W +    G++   + 
Sbjct: 147 TDTLYVTLDDEGNYNTAIDSKEIETLTK-------TAGGEISSNFWTSAIAAGLSERQIM 199

Query: 406 LIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLN 465
                    V+    ++  D     +  ++   +     +++         R    R  +
Sbjct: 200 NFADIFGWDVDFANDIRKNDQFGLIYESHYVEGEFIGTGKIIAAEFINQGQRFTAIRHTD 259

Query: 466 PVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGT 524
                  ++   G+S +   LR PV F  ++S F  R  HP+ G  + H G+D+AA  GT
Sbjct: 260 GN-----FYTPEGRSMKKAFLRAPVNFKYISSSFNPRRLHPVTGQVKAHRGIDYAARTGT 314

Query: 525 PIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWI 584
           P+VA G+G V KA ++   G    I HG  YV+ Y H +   K ++ G  VKQG  IG +
Sbjct: 315 PVVASGNGKVVKAGYSKYNGNYVFISHGTQYVTKYLHLNK--KLVRTGQKVKQGDKIGTV 372

Query: 585 GTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGE 642
           G TG  TG HLHYE +VNG+  +   V++P+ E L    L +F        + L+   
Sbjct: 373 GATGRVTGAHLHYEFLVNGVHRNPKTVKLPKSEPLPRSELAKFKPIADNFIAQLDRNR 430


>gi|126666489|ref|ZP_01737467.1| Membrane protein [Marinobacter sp. ELB17]
 gi|126628877|gb|EAZ99496.1| Membrane protein [Marinobacter sp. ELB17]
          Length = 480

 Score =  356 bits (913), Expect = 8e-96,   Method: Composition-based stats.
 Identities = 97/471 (20%), Positives = 181/471 (38%), Gaps = 24/471 (5%)

Query: 179 VDSFEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTL 238
             S +V  ++++   D+                A +         +  S           
Sbjct: 27  SPSADVEAKRMSIALDLESGAATTVVTPPPAVPASLVPGAQAKATQASSTATNLNSNLIT 86

Query: 239 DQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSN 298
                  +T   +  ++                P        ++   T+      AG+++
Sbjct: 87  AVTPSTALTAEAEEALL-----------SSPGKPTIDVQSFDVRSGDTLSSLFKKAGFND 135

Query: 299 GDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNE 358
           G    +        ++ +L   E LR     +     +    +   +   L+I   ++  
Sbjct: 136 GIMLSVIHGTGEAKKLQRLYAGETLRFATDSEGS---LAGVELQRSKLESLSITQGEDG- 191

Query: 359 YVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQ 418
                         +   ++T+  S  +   ++ A    GM+  L   +       ++  
Sbjct: 192 -------FIGKKVVREPEVQTAFASGTVDGSLYLAARAAGMDDRLTMEMAGIFGWDIDFV 244

Query: 419 EHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENG 478
             ++  D  E  +   + + +      +L  +            + +      +Y++  G
Sbjct: 245 YDVRKGDRFEVVYEDLYLDGEKFGSGRILSANFVNRGEDNIAMLYTDAQG-ETDYYSPTG 303

Query: 479 KSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKAN 538
            S R   LR P+     +S    R HP+L   R H G D+AAP GTPI AVG+G ++ A 
Sbjct: 304 SSMRKAFLRVPLNARVSSSFNLQRRHPVLDVVRPHEGTDYAAPPGTPIKAVGNGRIKFAG 363

Query: 539 WAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYE 598
           W GGYG+  ++ HG+   + Y H   + K IK G  VKQG+ IG++G++G+ TGPHLHYE
Sbjct: 364 WKGGYGRTVVLSHGDNITTLYAHMSKLGKGIKNGGRVKQGETIGYVGSSGMVTGPHLHYE 423

Query: 599 LIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGE-NPKKPL 648
             VNG   +S  V++P+ + +    L RF    ++  + L++   N K+PL
Sbjct: 424 FRVNGAPRNSRTVKLPDAKPIPKTELARFKKFTQQQLAQLDDLRGNEKQPL 474


>gi|144897750|emb|CAM74614.1| Peptidase M23B [Magnetospirillum gryphiswaldense MSR-1]
          Length = 460

 Score =  356 bits (912), Expect = 9e-96,   Method: Composition-based stats.
 Identities = 108/416 (25%), Positives = 191/416 (45%), Gaps = 14/416 (3%)

Query: 241 RHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGD 300
               P+    + ++    R +T+   L D+     +  + +    T+ D +  AG    +
Sbjct: 45  EGPPPVFMDAEAELSARARPLTTDSELEDRASRPVETQVRVGSGDTLGDVLARAGVEGIE 104

Query: 301 SAKIAKALKNEVRVDQLTKDEILRIGVVQKDDK---FTIVRFSIYHKQKHLLTIALNDNN 357
           + +   AL+       L   + +++   +             S+      ++    +D  
Sbjct: 105 ATQAIDALRGVFNPRALKAGQKVKVTFEKSPHGFGHGGFQMVSLNADPIRVVGAQRDDKG 164

Query: 358 EYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNL 417
            +             +    + +  +  I   ++ +    G+   ++  +++ L+  V+ 
Sbjct: 165 GFSPME-------TMRQVSKQVAHNTGTIKSSLFESAQSAGVPIQIIMAMIKALSYDVDF 217

Query: 418 QEHLKPTDFLETFFSVNHA-NNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNE 476
           Q  ++  D     +   +    +     E+L+       T    YRF +   G+VEYFN+
Sbjct: 218 QRDIQSGDEFTVVYEGFYDTKGKLVRHGEMLFASVNLSGTPIAMYRF-DNGQGTVEYFND 276

Query: 477 NGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEK 536
            G+S +  LL+TPV   +++SGFGMR HPILGYS+MH G+D+A P GTPI A GDG +E 
Sbjct: 277 KGESVKKALLKTPVDGAKISSGFGMRNHPILGYSKMHKGIDFAVPTGTPIQAAGDGTIEI 336

Query: 537 ANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLH 596
           A + G YG    + HG+G+ ++Y H   IA  I  G  V QGQIIG++G+TG STG HLH
Sbjct: 337 AGFNGSYGNYVRLRHGSGFGTAYAHMSRIAAGIGPGKRVSQGQIIGFVGSTGRSTGAHLH 396

Query: 597 YELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
           YE++    +++   V++P    L G  L RF   K+  ++L+     P      ++
Sbjct: 397 YEVLKGSDQINPLSVKMPTSIKLAGRDLDRFKAVKRDTDTLMAKI--PPSTRLAAN 450


>gi|127511954|ref|YP_001093151.1| peptidase M23B [Shewanella loihica PV-4]
 gi|126637249|gb|ABO22892.1| peptidase M23B [Shewanella loihica PV-4]
          Length = 491

 Score =  356 bits (912), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 111/490 (22%), Positives = 179/490 (36%), Gaps = 40/490 (8%)

Query: 182 FEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLY--YADPQTLD 239
             +T   I  P+D                            +   + T    YA P  L 
Sbjct: 23  VMITIGAIFIPSDDAEASRSTNTSLTGKIRLGEQAGSGASGENTTNDTKTNGYAYPVPLA 82

Query: 240 QRHDHPITYSKKIKIIEE------------NRTITSPQVL----IDKIPEFADDLIPIQH 283
            R   P +  +  +  +E            N +  +          +    + +   ++ 
Sbjct: 83  FRTPEPPSADEIARNTQESGSLDLNGSLDLNESALTQVTDNPVVEPEEERESSEEFTVRS 142

Query: 284 NTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYH 343
             T+      AG +  D  +I +  K +  + ++   E + I    KDD   + R   + 
Sbjct: 143 GDTLAALFKRAGLTARDVYEITQLPKAKKNLLKIMPGEEIIIV---KDDAGQLKRVVYHL 199

Query: 344 KQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNL 403
                L I  +D             +I  +    RT   S  I    W A    G+  N 
Sbjct: 200 DPISTLKICKDDKG--------YSEEIIKKTVESRTKFASATISSNFWNAGVGAGLTPNQ 251

Query: 404 VKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRF 463
           +  +       ++    L+  D     F   +A+ +   +  +L         R    R+
Sbjct: 252 IMQLATIFGWDIDFALDLRQGDNFAILFEEEYADGEFLRNGNILAAEFYNQGDRYTAVRY 311

Query: 464 LNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPR 522
            +       Y+++ G+S R   LR+PV F  ++S F  R  HP+ G  + H GVD+ A  
Sbjct: 312 KDGN-----YYSDEGRSMRKAFLRSPVDFKYVSSSFNPRRLHPVTGQVKAHRGVDYVAAV 366

Query: 523 GTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIG 582
           GTPI A G G V K+ +    G    I H   Y + Y H     + +K G  VKQGQIIG
Sbjct: 367 GTPIKAAGKGRVIKSGYNQYNGNYVFIKHNETYTTKYLHLKK--RKVKQGQTVKQGQIIG 424

Query: 583 WIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGE 642
            +G+TG  TG HLHYE IVNG+  +   V++P+   +       F    K+   L+   E
Sbjct: 425 TLGSTGRVTGAHLHYEFIVNGVHRNPRTVKLPQSLPIDSKEKSSFLALSKQ---LMAKLE 481

Query: 643 NPKKPLFTSH 652
             K+    S 
Sbjct: 482 QNKQVQLASQ 491


>gi|56461337|ref|YP_156618.1| M23/M37 family peptidase [Idiomarina loihiensis L2TR]
 gi|56180347|gb|AAV83069.1| Peptidase, M23/M37 family [Idiomarina loihiensis L2TR]
          Length = 458

 Score =  356 bits (912), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 89/382 (23%), Positives = 159/382 (41%), Gaps = 19/382 (4%)

Query: 263 SPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEI 322
                  +  E       I+   ++       G+S     ++ ++      + ++   ++
Sbjct: 89  PSSDESTENSELTWQTYQIKSGDSLAKIFSKVGFSAQQLYRVTESGDEAKYLRKVHPGDL 148

Query: 323 LRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEE 382
           LR      D+   +     +        I    N+ +V        +I  +   +RT   
Sbjct: 149 LRFATDSDDNLVQLA----HQINDTETLIITRQNDSFVA-------EIETKKVEVRTEFT 197

Query: 383 SPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASD 442
              I    W A   +G+  N +  I       ++    L+  D     +  ++ + +   
Sbjct: 198 HAVIDSSFWNAGIDSGLTDNQIMRIANIFGWDIDFALDLRKNDEFSVLYETHYVDGEFVG 257

Query: 443 DSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMR 502
             ++L       +   +          + +Y+  NG++ R   LR+PV F  ++S F  R
Sbjct: 258 YGKILAAEFVNRDENFQAILH-----DNGQYYTPNGRAMRKTFLRSPVNFTYISSSFNPR 312

Query: 503 Y-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNH 561
             HP+ G  R H G+D+AA  GTP+++ GDG V  A +    G    + HG  YV+ Y H
Sbjct: 313 RLHPVTGRVRPHNGIDYAASTGTPVMSSGDGKVIAAGYTSLNGNYIFVQHGERYVTKYLH 372

Query: 562 QDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKG 621
                K++K G  VKQGQ+IG +G TG  TGPHLHYE +V+G+  +   V +PE ++L  
Sbjct: 373 LSR--KHVKTGDRVKQGQVIGRVGATGRVTGPHLHYEFLVDGVHRNPRTVELPEAKSLGE 430

Query: 622 DLLQRFAMEKKRINSLLNNGEN 643
             L  F     ++ ++LN+   
Sbjct: 431 SELPAFRQHADQVMAILNDNRR 452


>gi|149927756|ref|ZP_01916008.1| hypothetical protein LMED105_16163 [Limnobacter sp. MED105]
 gi|149823582|gb|EDM82812.1| hypothetical protein LMED105_16163 [Limnobacter sp. MED105]
          Length = 411

 Score =  355 bits (911), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 92/410 (22%), Positives = 163/410 (39%), Gaps = 13/410 (3%)

Query: 239 DQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIP----IQHNTTIFDAMVHA 294
                   +      I  E   + + ++ +     +  D +     I+   T+   +   
Sbjct: 3   AIAGSVQNSPVDSALINSE-VVVEAVELNLADEGVYTFDPLVAEERIRRGDTLVGLLERM 61

Query: 295 GYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALN 354
           G +    A      K    +  L    +L +      D   +   S   +      +   
Sbjct: 62  GVNTAGLATFLGQDKTARNLVNLRAGRVLTVQQTADGDLQWLRYKSGIDEDSQESILVQK 121

Query: 355 DNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASS 414
            N ++V  +E V  +             S  I   ++ A    GM  ++   +     S 
Sbjct: 122 LNGQFVSKLESVNFEKQIVF-------RSGRIESSLFAAADKAGMPDSVAIQLTEIFGSD 174

Query: 415 VNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYF 474
           ++    L+  D  +  +       +++    +L +         + Y F    + +  Y+
Sbjct: 175 IDFHRELQKGDEFKVVYEDLTLEGRSARSGRVLAVEFVNNNKPYKAYWFAPSGNRNAGYY 234

Query: 475 NENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGI 533
           NE G+S +   LR+P+ F R++SGF  R  HPI    + H GVD+AAP GTPI+A   G 
Sbjct: 235 NEEGRSLKKSFLRSPLAFSRISSGFTPRRFHPIQQRWKAHNGVDYAAPTGTPIMATASGT 294

Query: 534 VEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGP 593
           V+ + W  GYG    I H +GY ++Y H     K +K G  V+QG +IG++G TG +TGP
Sbjct: 295 VKFSGWQNGYGNFVEIQHHSGYSTAYAHLSRFGKGVKVGQKVEQGDVIGYVGATGWATGP 354

Query: 594 HLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGEN 643
           HLHYE  VN +  +   + + + E L  +    F   +  ++  +     
Sbjct: 355 HLHYEFRVNRVPKNPLSITVAQAEPLDRNSFGEFKRVQLALDRRMELATA 404


>gi|297181223|gb|ADI17417.1| membrane proteins related to metalloendopeptidases [uncultured
           Rhodospirillales bacterium HF0070_31K06]
          Length = 434

 Score =  355 bits (911), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 107/414 (25%), Positives = 186/414 (44%), Gaps = 13/414 (3%)

Query: 237 TLDQRHDHPITYSKKIKIIEENRTITSPQVLID--KIPEFADDLIPIQHNTTIFDAMVHA 294
            LD  H    T   +   +       +   + D  ++P   +D   +    T+   +  A
Sbjct: 23  ALDPDHAGLQTAYIEAGRVPSTIHSLASDSVADTVQLPLPYEDARTVGKGDTLMALLKKA 82

Query: 295 GYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKF-TIVRFSIYHKQKHLLTIAL 353
           G S  D+    +A+    +   +   + + + +  +  K   ++  +     +  + +  
Sbjct: 83  GVSTTDADLAIRAMAKIYKPRSIKPGQRILLTLQPQSQKAPKLLSLTFSESVERDVAVRR 142

Query: 354 NDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLAS 413
             +            +I  +  + R++  +  I   ++ A    G+  + +  ++R  + 
Sbjct: 143 TKSG--------YHAEIVLRPLHRRSTHATGRIDSSLYVAGVNAGLPQSTLAELIRIFSF 194

Query: 414 SVNLQEHLKPTDFLETFFSVN-HANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVE 472
            V+ Q  ++  D     F      + +     ++L           R YRF       V+
Sbjct: 195 DVDFQRDIRRGDTFGLLFDEYSDDSGRVVKSGDILLAEMVLSGKPMRLYRFKTHDG-RVD 253

Query: 473 YFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDG 532
           Y++  GKS R  LLRTP+   R++SGFG R HPILGY+RMH G+D+AA RG PI A GDG
Sbjct: 254 YYDAKGKSVRKALLRTPIDGARISSGFGKRRHPILGYTRMHKGLDFAARRGAPIYAAGDG 313

Query: 533 IVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTG 592
           ++E A   GGYGK   I H + Y ++Y H     + I+ G  V+QGQ+IG++G+TG STG
Sbjct: 314 VIEYAGRNGGYGKYVRIRHNDTYKTAYAHLHRYGRGIRNGRHVRQGQVIGYVGSTGRSTG 373

Query: 593 PHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKK 646
           PHLHYE+  +G +V+   V++P    L+   L  F      +         P++
Sbjct: 374 PHLHYEVHKSGQQVNPRLVKLPSGRKLRDRELVAFKAHAATLEDNYAAVVRPQQ 427


>gi|117921497|ref|YP_870689.1| peptidase M23B [Shewanella sp. ANA-3]
 gi|117613829|gb|ABK49283.1| peptidase M23B [Shewanella sp. ANA-3]
          Length = 466

 Score =  355 bits (911), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 101/470 (21%), Positives = 181/470 (38%), Gaps = 29/470 (6%)

Query: 182 FEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQR 241
             +TT  + FP++  +         ++ +        L      +   +           
Sbjct: 23  SVITTITLLFPSEEAQASRQTQGVADQAQVNTRYDVPLAFRSPERPEGVEGQSQDASTNA 82

Query: 242 HDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDS 301
                  +     +  + T+ S      +          +++  T+      AG ++ D 
Sbjct: 83  TPLSSADALAAGNVPASETLESAHHRDVEHFN-------VKNGDTLAAVFERAGLTSKDV 135

Query: 302 AKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVL 361
            +I +    +  + ++   E + I    K D   +     Y        +   D ++Y  
Sbjct: 136 YEITQLPLAKQNLLKIIPGEEIVISKDAKGDLTEVR----YRVDAVSTLVITKDQDKY-- 189

Query: 362 GVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHL 421
                   I+ +   +RT   S  I    W A    G+N+N +  +       ++    L
Sbjct: 190 -----SEKISEKDIEIRTQFTSAKIKSNFWNAAVDAGLNANQIMQLSTVFGWDIDFALDL 244

Query: 422 KPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSS 481
           +  D     +   +A  +   +  +L       + R    R+ +       Y++ENG S 
Sbjct: 245 REGDSFAIIYEQEYAEGEFLRNGNILAAEFINQDERYTAIRYTDGN-----YYSENGTSM 299

Query: 482 RPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWA 540
           R   LR+PV F  ++S F  +  HP+ G  + H GVD+ A  GTPI A G+G V ++ + 
Sbjct: 300 RKAFLRSPVDFKYVSSNFNPKRLHPVTGQVKAHRGVDYVAAIGTPIKAAGNGRVVESGYN 359

Query: 541 GGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELI 600
              G    I H + Y + Y H     +N+  G +VKQGQIIG +G TG  TG HLHYE I
Sbjct: 360 QFNGNYVFIKHNDTYTTKYLHLTK--RNVSKGASVKQGQIIGTLGKTGRVTGAHLHYEFI 417

Query: 601 VNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFT 650
           VNG+  +   V +P+ E++      +F    K+   L+ +    K+    
Sbjct: 418 VNGVHRNPRTVDLPKAESIARKEKPQFDALSKQ---LMASISQNKQTQLA 464


>gi|220935572|ref|YP_002514471.1| Peptidase M23 [Thioalkalivibrio sp. HL-EbGR7]
 gi|219996882|gb|ACL73484.1| Peptidase M23 [Thioalkalivibrio sp. HL-EbGR7]
          Length = 517

 Score =  354 bits (909), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 104/461 (22%), Positives = 177/461 (38%), Gaps = 24/461 (5%)

Query: 179 VDSFEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTL 238
             + + T        +     ++     E+  +    Q  L   +          D +  
Sbjct: 69  AKNQDTTPATALELAEQPIPAVEAVHDTEKHVSGTRIQMALALPEPPSVRASSNIDVEAA 128

Query: 239 DQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSN 298
            Q         +      E  T                + + +Q   T+          +
Sbjct: 129 LQAEAQEDALGEA-----EIDTAPEMATDAG-----EWNEVVVQRGDTLSAIFSRLEI-H 177

Query: 299 GDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNE 358
                I         +  +   E +R          ++        +   L +   D+  
Sbjct: 178 SQLNPILSLGDQVSLLRSIHPGEKIRAL----KVDGSLQELVYEPSRTRQLHVIRGDDG- 232

Query: 359 YVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQ 418
                   +     +    R ++ S  I   +++A    GM+  L+  +       ++  
Sbjct: 233 -------YQAREVERPLETRITQASGVIQSSLFQAGMDAGMSQTLIMSMANIFGWDIDFA 285

Query: 419 EHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENG 478
             ++  D     +     + +   D  +L        T  +  R+  P   + +Y++ +G
Sbjct: 286 LDIREGDQFTVIYEQLFQDGEFVRDGAVLAAEFVNRGTAFQALRYTRPDGHT-DYYSPDG 344

Query: 479 KSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKAN 538
           +S R   LRTPV F R++S FG R HPIL   R H GVD+AAP GTPI A GDG +    
Sbjct: 345 RSMRKAFLRTPVEFARISSRFGSRRHPILHTMRQHRGVDYAAPTGTPIRASGDGRIAYRG 404

Query: 539 WAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYE 598
             GGYGK  +I HG  Y + Y H +  A+N   G  V+QGQ+IG++G+TG++TGPHLHYE
Sbjct: 405 SRGGYGKTIVIQHGQQYQTLYAHMNGFARNTAVGERVRQGQVIGYVGSTGMATGPHLHYE 464

Query: 599 LIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLN 639
            +VNG+  D   VR+P+ E L    +  F  +   + + + 
Sbjct: 465 FLVNGVHRDPLTVRLPDAEPLPDRYMSDFKAKTAPLLAQIE 505


>gi|40062808|gb|AAR37692.1| peptidase, putative [uncultured marine bacterium 440]
          Length = 446

 Score =  354 bits (907), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 108/373 (28%), Positives = 183/373 (49%), Gaps = 12/373 (3%)

Query: 271 IPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQK 330
              F +    I++  TI   +      N +   +    K     +QL    I+ I + + 
Sbjct: 77  NSPFTNLNYEIKNGDTIQKILKKLKVQNNEIQTVINQYKRYGNPNQLLLGNIINIIIEKN 136

Query: 331 --DDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYD 388
              +K  +V+FS+   +   + I  +++N+        K+     +           I  
Sbjct: 137 LTTNKNFVVKFSVPITKSTTIAIIRDEDNKITSQKIITKLYKKKTLAE-------NIITK 189

Query: 389 GIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSV-NHANNQASDDSELL 447
            ++ +     +N + +    R     ++ Q  ++  D+ +  +      N +      +L
Sbjct: 190 NLYSSAIEAKINPDTIIEFARIFGFEIDFQRDIRKNDYFKIIYEKYFDENGEFIKSGSIL 249

Query: 448 YIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPIL 507
           + H          Y+F +  +    YF+ NGKS    L++TP+   R++S FGMR HPI 
Sbjct: 250 FAHMSVNGREISLYKFGDDKNY--GYFDINGKSVEKALMKTPINGARLSSSFGMRKHPIS 307

Query: 508 GYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAK 567
           G+++MH G D+AAP GTPI+A G G V +A W GG G    I H + Y + Y H  + AK
Sbjct: 308 GFTKMHQGTDFAAPMGTPIMASGTGTVTRAKWCGGGGNCIKIKHNSIYDTIYAHMKSFAK 367

Query: 568 NIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRF 627
            IK G  V+QG IIG++G+TG+STGPHLHYE+I+NG KV+S K+++P  + LKGD  ++F
Sbjct: 368 GIKVGKKVRQGHIIGFVGSTGMSTGPHLHYEVIINGQKVNSQKLQLPSGKVLKGDEREKF 427

Query: 628 AMEKKRINSLLNN 640
            + + + + L+  
Sbjct: 428 EIHRIKTDVLIAE 440


>gi|297183486|gb|ADI19617.1| membrane proteins related to metalloendopeptidases [uncultured
           SAR11 cluster bacterium HF0770_37D02]
          Length = 433

 Score =  354 bits (907), Expect = 4e-95,   Method: Composition-based stats.
 Identities = 109/385 (28%), Positives = 177/385 (45%), Gaps = 12/385 (3%)

Query: 259 RTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLT 318
            T     +L      F +    I+   +I   +      N +   I    K     +QL 
Sbjct: 52  LTSIKKFLLKKIKSPFININYEIKSGDSIQKILKKFKIENNEIQNIINQYKKYGNPNQLF 111

Query: 319 KDEILRIGVVQK--DDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDY 376
           K   + I + +       +I++FS+   +   + I  N+  + +      K+        
Sbjct: 112 KKNKIDIVLEENVSKKGNSIIKFSVPITKSTTIEITKNEQGKIISKKIITKLYKKR---- 167

Query: 377 MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVN-H 435
                    I   ++ +     +N N +    R     ++ Q  ++  D+          
Sbjct: 168 ---FLTENVIKKNLYSSAIEAKINPNTIIEFARIFGFEIDFQRDIRKNDYFRILHEKFFD 224

Query: 436 ANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRM 495
            N Q   D  +LY H          Y+F +  +   EYF+ NGKS    L++TP+   R+
Sbjct: 225 ENGQFVKDGSILYAHMSVNNREITLYKFGDSKNY--EYFDINGKSVEKTLMKTPINGARL 282

Query: 496 TSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGY 555
           +S FG R HPILG+++MH G D+AAP GTPI+A G G +  A W GG G    I H + Y
Sbjct: 283 SSPFGKRKHPILGFTKMHKGTDFAAPSGTPIMASGSGHIVHAKWCGGGGNCIKIKHNSTY 342

Query: 556 VSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPE 615
            + Y H  + AK I+    VKQGQIIG++G+TG+STGPHLHYE+IVN  +V+S  +++P 
Sbjct: 343 ETVYGHLKSFAKGIRKNKKVKQGQIIGYVGSTGMSTGPHLHYEVIVNRKRVNSQTLKLPS 402

Query: 616 RENLKGDLLQRFAMEKKRINSLLNN 640
            + LK +  + F + + + + L+  
Sbjct: 403 GKVLKDNERKLFEIHRIKTDVLIAE 427


>gi|77359500|ref|YP_339075.1| peptidase, M23/M37 [Pseudoalteromonas haloplanktis TAC125]
 gi|76874411|emb|CAI85632.1| putative peptidase, M23/M37 family [Pseudoalteromonas haloplanktis
           TAC125]
          Length = 437

 Score =  354 bits (907), Expect = 4e-95,   Method: Composition-based stats.
 Identities = 87/387 (22%), Positives = 159/387 (41%), Gaps = 18/387 (4%)

Query: 257 ENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQ 316
           E  T  + +   DK+PE+      +++   +      AG+S     K+        ++ +
Sbjct: 61  EKLTALNSEQAADKLPEYDFVDHQVKNGDNLAIIFKRAGFSAQTLHKLINTNAETRKLTK 120

Query: 317 LTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDY 376
           +   E L     +  D   +        +   L + LND  +Y   ++  +++   +   
Sbjct: 121 IHPGETLSFATAKDGDLAQLRYVI---SKTDTLFVTLNDEGQYDTSIDSKEIETLTK--- 174

Query: 377 MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHA 436
                    I    W +    G++   +          V+    ++  D     +  ++ 
Sbjct: 175 ----TVGGEISSSFWTSAIAAGLSERQIMNFADIFGWDVDFANDIRKGDGFGLIYESHYV 230

Query: 437 NNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMT 496
           + +     +++         R    R  +       ++   G+S +   LR PV F  ++
Sbjct: 231 DGEFIGTGKIIAAEFVNQGQRYAAIRHTDGS-----FYTPEGRSMKKAFLRAPVSFKYIS 285

Query: 497 SGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGY 555
           S F  R  HP+ G  R H G+D+AA  GTP+VA G+G V K+ ++   G    I HG  Y
Sbjct: 286 SSFNPRRLHPVTGQVRAHRGIDFAARTGTPVVASGNGKVIKSGYSKYNGNYVFISHGTQY 345

Query: 556 VSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPE 615
           V+ Y H +   + +K G  +KQG+ +G +G+TG  TG HLHYE +VNG+  +   V++P+
Sbjct: 346 VTKYLHLNK--RLVKTGQKIKQGEQLGTVGSTGRVTGAHLHYEFLVNGVHRNPKTVKLPK 403

Query: 616 RENLKGDLLQRFAMEKKRINSLLNNGE 642
            E L    L +F        + L    
Sbjct: 404 SEPLPRAELAKFKPIADNFIAQLERNR 430


>gi|71278748|ref|YP_271370.1| M24/M37 family peptidase [Colwellia psychrerythraea 34H]
 gi|71144488|gb|AAZ24961.1| peptidase, M23/M37 family [Colwellia psychrerythraea 34H]
          Length = 498

 Score =  352 bits (904), Expect = 9e-95,   Method: Composition-based stats.
 Identities = 88/447 (19%), Positives = 173/447 (38%), Gaps = 21/447 (4%)

Query: 199 QLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEEN 258
           ++  +  ++ +      +   L  + +          Q            +  +   +  
Sbjct: 57  RIQVSLPEDIVPKGTTPKQSALPQRSSSKANNKITIEQIPSLAKTVSAQNAGSLVSGKLE 116

Query: 259 RTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKA-LKNEVRVDQL 317
           R +     L     + +   + ++   ++   +   G+S   +  ++ A  K    + +L
Sbjct: 117 RKVKIQDSLETLA-QLSWQTVKVRSGDSLALILKRLGFSAQTTYAVSTAKGKESKLLKRL 175

Query: 318 TKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYM 377
              + LRI   ++     +              ++  D     L  +  +     +   +
Sbjct: 176 NVGDKLRIASDEEQQLAAL-----------EYPLSKTDTLFINLVGDSYQSHRETKEVEI 224

Query: 378 RTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHAN 437
           R S     I    W A    G+N + +          ++    ++  D     +   + +
Sbjct: 225 RESFSYGTINSSFWNAGVSAGLNDSQIINFANIFGWDIDFALDIREGDSFHITYEKKYID 284

Query: 438 NQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTS 497
            +      +L       +   +  RF +       Y++ +G+S R   LR PV F  ++S
Sbjct: 285 GEYIGTGNILAAEITNQDEVFQAIRFTDDE-----YYSPDGRSMRKAFLRAPVNFKYISS 339

Query: 498 GFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYV 556
            F  +  HP+    + H G+D+AA  GTP+VA G+G V  A +    G    I HGNG V
Sbjct: 340 SFKRKRFHPVQKRWKAHRGIDYAAKTGTPVVAAGNGKVTHATYNKYNGNYVFIQHGNGIV 399

Query: 557 SSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPER 616
           + Y H     + +K G  VKQGQ+IG++G TGL+ GPHLHYE ++NG+  +   V++P+ 
Sbjct: 400 TKYLHFSK--RAVKKGQRVKQGQVIGYVGATGLAAGPHLHYEFLLNGVHRNPRTVKLPDA 457

Query: 617 ENLKGDLLQRFAMEKKRINSLLNNGEN 643
             +      +F +        L+  +N
Sbjct: 458 RPIAKKYKAKFLLLADERLQALSGAKN 484


>gi|158426140|ref|YP_001527432.1| putative peptidase M23B protein [Azorhizobium caulinodans ORS 571]
 gi|158333029|dbj|BAF90514.1| putative peptidase M23B protein [Azorhizobium caulinodans ORS 571]
          Length = 668

 Score =  352 bits (902), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 136/685 (19%), Positives = 246/685 (35%), Gaps = 65/685 (9%)

Query: 6   ISNKRDILFSFGDT-PPILGNN---DAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSL 61
           ++    +        PP+  +            R + + RWLS T   G  +  ++ G+L
Sbjct: 1   MTAAVFLKADLSYEAPPLGLDGAEHGEAGSRPARARFNRRWLSATGLMGGVALALMCGAL 60

Query: 62  LTALDGHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLI 121
             ++    +      +    +   +     +   +   +           K  ++V  L 
Sbjct: 61  FASITRDSRHV----VRPVLAGRRSGVEKPRGDRLHTQQ---ARADASALKREVKVEQLT 113

Query: 122 KDHNKDIIKKIPFAYARMTFATPYP------------------------KVKDHPKFDPL 157
                       F +     AT                              D P   P+
Sbjct: 114 ASG------MHAFVHVATKLATVVAAAADQPPAPRPRPPLPAEDGELPDAGADVPP--PM 165

Query: 158 KIFSEGKIESSSQMLMDTIHNVDSFEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQF 217
                    +S++       +               +      +                
Sbjct: 166 AANMSAHAVASARRAGLKAAHSR-VAEAQAAAAAALEAMARHPNTAPPPPPTALGFAPPP 224

Query: 218 FLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEE---------NRTITSPQVLI 268
               +   +  T     P             +  + + E+         N ++ +     
Sbjct: 225 PPPSHLPPEILTGASVPPPPTPAPPPQEGPPAPSLAMFEDDLTAIGEPVNVSVLAKH--- 281

Query: 269 DKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQ--LTKDEILRIG 326
              P   D ++  +      D +  AG  + D+  +A AL+      +      E L + 
Sbjct: 282 PHEPATVDRVLVAKPGDAPEDMLRAAGLDSEDAQVLATALRKAAMAGKPAFAGGEELVLS 341

Query: 327 ---VVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVE-PVKMDINHQMDYMRTSEE 382
                +       ++ S+    K +  +   D   YV   + P           +  S  
Sbjct: 342 EPKGEESARPPRPIKASLARAGKPVARLVATDAGAYVPMPDAPPVTPTALADGEVDPSLI 401

Query: 383 SP-NIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQAS 441
              +I DG+++    + ++  +V+ I+R     V+L   L   D ++  +     N+   
Sbjct: 402 DGLSIRDGLYKLADAHVVDEGMVEAILRLAEHDVDLDAPLGAEDSIDLVYGPPDRNDNRP 461

Query: 442 D--DSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGF 499
           +    ++ ++  +      R+YRF    DG+ +Y++ +G S    LLR P   GR+  GF
Sbjct: 462 EAFQQDIAFVRLKADGKERRYYRFRTADDGATDYYDSDGHSVTKMLLRKPFAAGRLNDGF 521

Query: 500 GMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSY 559
           G R HPIL   R H GVD+  P G+PIVA G G+VEK ++  GYGK   + H  GY ++Y
Sbjct: 522 GWRIHPILHDRRFHNGVDYTGPAGSPIVAAGAGVVEKIDYEWGYGKYVRVRHDGGYETTY 581

Query: 560 NHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENL 619
            H +     +K G  V+QGQ+I ++G+TGLSTGPHL+YEL +NG   D T+V++     L
Sbjct: 582 AHVEGFPSGLKVGQRVRQGQVIAYVGSTGLSTGPHLYYELRINGHYADPTRVKLAGGRIL 641

Query: 620 KGDLLQRFAMEKKRINSLLNNGENP 644
           +GDL   F  E+ R+++L      P
Sbjct: 642 QGDLADAFRKERARMDALAAAVPTP 666


>gi|297182638|gb|ADI18796.1| membrane proteins related to metalloendopeptidases [uncultured
           SAR11 cluster bacterium HF4000_37C10]
          Length = 447

 Score =  351 bits (900), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 105/393 (26%), Positives = 185/393 (47%), Gaps = 12/393 (3%)

Query: 257 ENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQ 316
           E+ T     +L      F +    I+   +I   +      N +   +    K     +Q
Sbjct: 64  EDLTSIKEFLLTLIKSPFININYEIKSGDSIQKILKKFKVHNNEIQAVINQYKKYSNPNQ 123

Query: 317 LTKDEILRIGVVQK--DDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQM 374
           L  +  + + + +   +  ++I +F+I   +   + I  ++  +        K+     +
Sbjct: 124 LLMNNKIDLIIEENLSEKNYSIAKFAIPITKSTTIEITKDEQGKIASRKIITKLYEKRIL 183

Query: 375 DYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSV- 433
                      I + ++ +     +N + +    R     ++ Q  ++  D+ +  +   
Sbjct: 184 SE-------NVIKNNLYSSAIEAKINPDAIIEFARIFGFEIDFQRDIRENDYFKIIYDKY 236

Query: 434 NHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFG 493
              N +      + Y H          Y+F +  + S  YF+ NGKS    L++TP+   
Sbjct: 237 FDENGEFVKSGSIHYAHMSVNGREITLYKFGDDKNYS--YFDINGKSVEKALMKTPINGA 294

Query: 494 RMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGN 553
           R++S FGMR HPILG+++ HTG D+AAP  TPI+A G G +  A W GG G    I H +
Sbjct: 295 RLSSSFGMRKHPILGFNKKHTGTDFAAPSETPIMASGSGTIVLAKWCGGGGNCIKIKHNS 354

Query: 554 GYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRI 613
            Y + Y H  + AK +K G  V+QG+IIG++G+TG+STGPHLHYE+ VNG KV+S K+++
Sbjct: 355 TYETIYAHMKSFAKGMKKGKKVRQGEIIGYVGSTGISTGPHLHYEVTVNGKKVNSQKLKL 414

Query: 614 PERENLKGDLLQRFAMEKKRINSLLNNGENPKK 646
           P  + LK +  + F + + + + L+      KK
Sbjct: 415 PSGKVLKDNERKLFEVHRIKTDVLIAEMFAEKK 447


>gi|113971216|ref|YP_735009.1| peptidase M23B [Shewanella sp. MR-4]
 gi|113885900|gb|ABI39952.1| peptidase M23B [Shewanella sp. MR-4]
          Length = 466

 Score =  351 bits (899), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 100/470 (21%), Positives = 181/470 (38%), Gaps = 29/470 (6%)

Query: 182 FEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQR 241
             +TT  + FP++  +         ++ +        L      +   +           
Sbjct: 23  SVITTITLLFPSEEAQASRQTQGVADQAQVNTRYDVPLAFRSPERPEGVEGQSQDASTNA 82

Query: 242 HDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDS 301
                  +     +  + T+ S      +          +++  T+      AG ++ D 
Sbjct: 83  TPLSSADALAAGNVSASETLESAHHRDVEHFN-------VKNGDTLAAVFERAGLTSKDV 135

Query: 302 AKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVL 361
            +I +    +  + ++   E + I    K D   +     Y        +   D ++Y  
Sbjct: 136 YEITQLPLAKQNLLKIIPGEEIVISKNAKGDLTEVR----YRVDAVSTLVITKDQDKY-- 189

Query: 362 GVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHL 421
                   I+ +   +RT   S  I    W A    G+N+N +  +       ++    L
Sbjct: 190 -----SEKISEKDIEIRTQFTSAKIKSNFWNAAVDAGLNANQIMQLSTVFGWDIDFALDL 244

Query: 422 KPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSS 481
           +  D     +   +A  +   +  +L       + R    R+ +       Y++ENG S 
Sbjct: 245 REGDSFAIIYEQEYAEGEFLRNGNILAAEFINQDERYTAIRYTDGN-----YYSENGTSM 299

Query: 482 RPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWA 540
           R   LR+PV F  ++S F  +  HP+ G  + H GVD+ A  GTPI + G+G V ++ + 
Sbjct: 300 RKAFLRSPVDFKYVSSNFNPKRLHPVTGQVKAHRGVDYVAAIGTPIKSAGNGRVIESGYN 359

Query: 541 GGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELI 600
              G    I H + Y + Y H     +N+  G +VKQGQIIG +G TG  TG HLHYE I
Sbjct: 360 QFNGNYVFIKHNDTYTTKYLHLTK--RNVSKGASVKQGQIIGTLGKTGRVTGAHLHYEFI 417

Query: 601 VNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFT 650
           VNG+  +   V +P+ E++      +F    K+   L+ +    K+    
Sbjct: 418 VNGVHRNPRTVDLPKAESIARKEKPQFDALSKQ---LMASISQNKQTQLA 464


>gi|300309747|ref|YP_003773839.1| membrane metalloendopeptidase [Herbaspirillum seropedicae SmR1]
 gi|300072532|gb|ADJ61931.1| membrane metalloendopeptidase protein [Herbaspirillum seropedicae
           SmR1]
          Length = 506

 Score =  351 bits (899), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 99/438 (22%), Positives = 168/438 (38%), Gaps = 17/438 (3%)

Query: 220 LHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRT--------ITSPQVLIDKI 271
             + K +                         +K    N          +      +++ 
Sbjct: 68  ASSPKTRIIGASALFLAAFTIGAAGFAPAEPDMKDAPVNPISKELALPDLQHQISALEEQ 127

Query: 272 PEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKD 331
            ++  +   ++   T+   +   G  + ++    K+      V QL   + +        
Sbjct: 128 SQYYVNEEKVRSGDTLATLLNRLGVDDDEAMAFIKSDTLARSVMQLRAGKRVVAQTDDNG 187

Query: 332 DKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIW 391
           +   +              +    + +     +P  ++        R    S  I+  ++
Sbjct: 188 ELVKLSATLDDGSDAPKNLVISRHDGKLSAEAQPAVLER-------RVEMRSGVIFSSLF 240

Query: 392 RATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHA 451
            AT    +   +   ++   A+++N    L+  D     +     N        +L    
Sbjct: 241 AATDAVQIPDAVAMQLVDMFATNINFASDLRRGDRFNVVYETFWQNGDLVRTGRVLAGEF 300

Query: 452 RFGETRTRFYRFLNP--VDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGY 509
                R +   F +P    G   Y+  +GKS +   L++P+ F R++SGF MR HPILG 
Sbjct: 301 DNAGNRYQAVWFSDPASKTGGGGYYAFDGKSLKKAFLKSPLAFTRISSGFSMRLHPILGK 360

Query: 510 SRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNI 569
            + HTGVD+AAP GTPI A  DG+V+      GYG   +I H +GY ++Y H    A +I
Sbjct: 361 WKQHTGVDFAAPTGTPIHAAADGVVDFVGKQNGYGNIVVIKHWSGYSTAYGHMSRFAPDI 420

Query: 570 KAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAM 629
           K G  V Q  +IG++G TG +TGPHLHYE  VN    +   V +P  + L G  LQRF  
Sbjct: 421 KKGMKVSQNDVIGFVGMTGWATGPHLHYEFRVNNQPRNPLSVDVPNNQALTGPQLQRFRT 480

Query: 630 EKKRINSLLNNGENPKKP 647
               +   +     P  P
Sbjct: 481 VAADMQHRMAMLRVPGAP 498


>gi|297172369|gb|ADI23344.1| membrane proteins related to metalloendopeptidases [uncultured
           Oceanospirillales bacterium HF0770_27O18]
 gi|297172807|gb|ADI23771.1| membrane proteins related to metalloendopeptidases [uncultured
           Oceanospirillales bacterium HF4000_43P14]
          Length = 451

 Score =  350 bits (897), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 92/405 (22%), Positives = 167/405 (41%), Gaps = 13/405 (3%)

Query: 235 PQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHA 294
           P+ L        + S+++   E  + +   +   +   E     I +    T+   +   
Sbjct: 44  PERLQTLELPKPSASEELVRQESAQPVADVRAPAETPDEEQWIKITVASGDTLSGLLQSR 103

Query: 295 GYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALN 354
           G S     ++    +    +  +   + L I V +  +  ++     Y   +     A  
Sbjct: 104 GVSAAQVHRLVTGDERLAELATIRPGDSLNISVDEAGELTSLR----YSPSRVETVEATL 159

Query: 355 DNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASS 414
           ++  + +     +     +            I + ++ A    GM+ NL   +       
Sbjct: 160 EDGNWRVENVVREYQRRTRFAE-------ATIDNSLFLAGHAAGMSDNLTMQLANIFGWD 212

Query: 415 VNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYF 474
           ++    ++  D     +   + + +   + E++             YR+       V YF
Sbjct: 213 IDFVLDIRNGDRFRVLYEELYLDGEKVGEGEIIAAEFWNQGRHLTAYRYQTRDGD-VSYF 271

Query: 475 NENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGI 533
           + +G S R   +RTPV F R++S F     HPIL   R H G+D+AAP GTPI A G G 
Sbjct: 272 DSDGNSMRKEFIRTPVAFSRISSRFSTGRKHPILNKVRAHNGIDYAAPSGTPIKAAGKGK 331

Query: 534 VEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGP 593
           V  A   GGYG   ++ HG  Y + Y H    AK I+ G+ V Q Q IG++G +GL+TGP
Sbjct: 332 VIFAGVKGGYGNVLILKHGQRYSTLYAHMRGFAKGIRVGSRVNQSQTIGYVGASGLATGP 391

Query: 594 HLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLL 638
           HLHYE  ++G+  +   V +P+   +      +F ++  R+ + +
Sbjct: 392 HLHYEFRIDGVHRNPQTVPLPKASGIASSEKPQFRLQSSRLAAQM 436


>gi|256821637|ref|YP_003145600.1| peptidase M23 [Kangiella koreensis DSM 16069]
 gi|256795176|gb|ACV25832.1| Peptidase M23 [Kangiella koreensis DSM 16069]
          Length = 513

 Score =  350 bits (897), Expect = 6e-94,   Method: Composition-based stats.
 Identities = 83/388 (21%), Positives = 158/388 (40%), Gaps = 14/388 (3%)

Query: 257 ENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQ 316
           EN           + P+   + + +++  ++       GYS  D   +  + +    + +
Sbjct: 119 ENEVEEEVVEPEPQEPQIKWESLTVENGDSLAKIFKRKGYSASDLHYMMLSDEKIDILKK 178

Query: 317 LTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDY 376
           +     L       +D  + +     +     L +    + E+ + ++  +++   +   
Sbjct: 179 IRPGHTLEFA---SNDDSSFLGLRYPYNISETLQVTKLADKEFDVAIDEKEIEFKTRF-- 233

Query: 377 MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHA 436
                 +  I    + A    G+   ++  +       ++    ++  D     +     
Sbjct: 234 -----ATATITSSFYMAGKEAGLPDGVIMELAGVFEYDIDFALEIRKDDSFSVLYEEKFI 288

Query: 437 NNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMT 496
             +      +L              R+ +  D +  Y+   GK+ R   LR P+ F  ++
Sbjct: 289 EGEKVGYGNILSAEFTNQGDSFAAVRYTDTNDRTA-YYTPEGKALRKSFLRAPLQFNYVS 347

Query: 497 SGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGY 555
           S F  +  HPI    + H GVD+ AP GTP+ A GDG V  + +    G    I HGN  
Sbjct: 348 SNFNPKRFHPIQKRVKPHRGVDYRAPIGTPVRAAGDGRVTNSAYNKYNGNYVFIKHGNNI 407

Query: 556 VSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPE 615
            + Y H     +++KAG  VKQGQIIG++G+TG+S  PHLHYE +VNG+  +   V++P 
Sbjct: 408 TTKYLHFSK--RSVKAGERVKQGQIIGYVGSTGMSQAPHLHYEFVVNGVHRNPRTVKLPH 465

Query: 616 RENLKGDLLQRFAMEKKRINSLLNNGEN 643
              +  D ++RF  + K + + L     
Sbjct: 466 AAPVPKDEMERFREQSKPLIAQLETERT 493


>gi|134093530|ref|YP_001098605.1| putative endopeptidase [Herminiimonas arsenicoxydans]
 gi|133737433|emb|CAL60476.1| putative peptidase [Herminiimonas arsenicoxydans]
          Length = 456

 Score =  349 bits (894), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 105/416 (25%), Positives = 170/416 (40%), Gaps = 12/416 (2%)

Query: 224 KNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTIT---SPQVLIDKIPEFADDLIP 280
              +  L              P   +  IK I +   +         ++  P+       
Sbjct: 29  SGSALVLAVCAFGAAGVAPMAPDADNLPIKSITQELALPHLAEQIAALEAKPQNYISEER 88

Query: 281 IQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFS 340
           ++   T+   +   G  + ++A   K+      V QL   + ++       +   +    
Sbjct: 89  VRSGDTLATLLDRLGVDDNEAAAFIKSDPIARSVMQLKAGKRVQAQTDANGELNWLSSTV 148

Query: 341 IY-HKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGM 399
                +     +   + N       PV M+        R    S  I   ++ AT    +
Sbjct: 149 TAGRNEALTNIVITREGNRLKAAEVPVAMEK-------RIEMRSGTIRSSLFAATDAAQI 201

Query: 400 NSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTR 459
             N+   I+   +++++    L+  D     +     N +      +L      G    +
Sbjct: 202 PDNIASQIVDMFSTNIDFGSDLRRGDRFNVVYETFWQNGEYVHAGRVLAGEFMNGPATYQ 261

Query: 460 FYRFLNP-VDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDW 518
              F +P    S  Y+  +GKS +   L++P+ F R++SGF +R HPI G  + H GVD+
Sbjct: 262 SVWFEDPASPQSGGYYGFDGKSLKKAFLKSPLEFSRISSGFSLRKHPISGKWKAHKGVDF 321

Query: 519 AAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQG 578
           AA  GTPI A GDG+++ A   GGYG   +I H + Y ++Y H    A N++ GT V QG
Sbjct: 322 AAATGTPIRASGDGVIDFAGTQGGYGNVVVIKHWSKYSTAYAHMSRFAPNMRKGTKVSQG 381

Query: 579 QIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRI 634
           Q+IG++GTTG STGPHLHYE  VN    D   V IP    L    +QRF      +
Sbjct: 382 QVIGYVGTTGWSTGPHLHYEFRVNNEARDPMSVDIPNAAPLAAAQMQRFRNVAGEM 437


>gi|325983357|ref|YP_004295759.1| peptidase M23 [Nitrosomonas sp. AL212]
 gi|325532876|gb|ADZ27597.1| Peptidase M23 [Nitrosomonas sp. AL212]
          Length = 445

 Score =  349 bits (894), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 96/409 (23%), Positives = 176/409 (43%), Gaps = 14/409 (3%)

Query: 237 TLDQRHDHPITYSKKIKIIEENRTITSPQVLID-KIPEFADDLIPIQHNTTIFDAMVHAG 295
                 + P      ++ I  +  ++ P  L + +  +       I+   TI   +    
Sbjct: 42  AFGIAPNSPSFGEIPVEEIVLDLDLSIPDALAEAQSNQSFWRQESIRRGDTIGAILNRLD 101

Query: 296 YSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALND 355
            S+ DS    +A ++   + QL   + +      + +  ++  F         L +    
Sbjct: 102 VSSEDSTYFLQAARDSRAMRQLRPGKTVYAQTTAEGELLSLRYFF----GNEELFLMEKT 157

Query: 356 NNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSV 415
           ++ + +  +P+++D            +S  I   ++ AT   G+ +N+   +    AS +
Sbjct: 158 DDAFKMTEQPIELDAQ-------IHMKSGVINSSLFGATDNAGIPNNIAMQLTEIFASEI 210

Query: 416 NLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFN 475
           +    L+  D     +    ++ + +    +L +         +   F +    +  Y+ 
Sbjct: 211 DFYRDLRQGDRFTIVYETFSSDGRRAKTGRVLAVEFVNKGKSHQAVYFKSYNG-AEGYYT 269

Query: 476 ENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIV 534
             G+S R     +P+ F R++SGF  R  HPIL   R H G+D+AAP GTP+ A   GIV
Sbjct: 270 PEGESLRKAFWLSPLAFTRISSGFTNRRFHPILKEWRAHRGIDYAAPTGTPVKATASGIV 329

Query: 535 EKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPH 594
             +    GYG   ++ H   Y ++Y H    A  +  G  V QG +IG++G+TG++TGPH
Sbjct: 330 AFSGSQRGYGNLIVLKHNGKYETAYGHLSRFAAGLSKGKRVNQGDVIGYVGSTGMATGPH 389

Query: 595 LHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGEN 643
           LHYEL V+G++ D TKV +P    +    L  F  E   + + LN   +
Sbjct: 390 LHYELRVDGVQRDPTKVVLPTAPPIAKRDLNTFKDETHALLTRLNIMRS 438


>gi|239947259|ref|ZP_04699012.1| membrane-bound metallopeptidase [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239921535|gb|EER21559.1| membrane-bound metallopeptidase [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 454

 Score =  349 bits (894), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 102/397 (25%), Positives = 182/397 (45%), Gaps = 6/397 (1%)

Query: 259 RTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLT 318
            T+  P    ++   F +  + ++   TI   ++       +  KI   +K       L 
Sbjct: 56  ITLVQPDSSEEETISFKE--VVVKKGDTIKSILIEQNIPKNEIEKIVSLVKEGKLSSALK 113

Query: 319 KDEILRIGVVQKDDKFTIVRFSIYHK--QKHLLTIALNDNNEYVLGVEPVKMDINHQMDY 376
             + +      K  +      +       K ++ I      E +   +  K++       
Sbjct: 114 IGQQITFEYETKITENEDEDLTSEVTFLNKIVIIIDKLKTIEVIREGDNFKVEEIVVPLS 173

Query: 377 MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNH- 435
            + ++ S +I      A    G+++N +  ++   A  ++ Q  +K  D           
Sbjct: 174 KKVAKSSVSIESNFMSALKKLGLSNNSIIELINAYAYQIDFQRQIKSGDTATVITEKYVT 233

Query: 436 ANNQASDDSELLYIHARFGETRTRFYRF-LNPVDGSVEYFNENGKSSRPFLLRTPVPFGR 494
            + + S   ++LY+           YR+  +    +  +F+E+GKS +  LL+TP+   +
Sbjct: 234 EDGKFSHHGKILYVSLNLSGKEYNIYRYSHDNNANNHAFFSEDGKSVKRSLLKTPLKVIK 293

Query: 495 MTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNG 554
           ++S +G R HPILGY++MH GVD+AAP GTPI +VG+G++ +  W  GYG    + H   
Sbjct: 294 VSSHYGNRKHPILGYTKMHKGVDFAAPTGTPIYSVGNGVITEIGWKSGYGNFIQVKHSGT 353

Query: 555 YVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIP 614
             ++Y H    AKN+K G+ VKQGQII ++G+TG +TGPHLHYE+ ++G  V+   V+  
Sbjct: 354 LSTAYAHASNFAKNLKVGSIVKQGQIIAYVGSTGRATGPHLHYEVKIDGKHVNPMSVKTT 413

Query: 615 ERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTS 651
               L G  L++F   KK I +L    +   +    +
Sbjct: 414 PGIELNGKNLEKFKQFKKEIKTLNVKLDKELQVEKAA 450


>gi|167041276|gb|ABZ06032.1| putative peptidase family M23/M37 [uncultured marine microorganism
           HF4000_005D21]
 gi|167045781|gb|ABZ10427.1| putative peptidase family M23 [uncultured marine bacterium
           HF4000_APKG3108]
          Length = 433

 Score =  349 bits (894), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 105/393 (26%), Positives = 187/393 (47%), Gaps = 12/393 (3%)

Query: 257 ENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQ 316
           E+ T     +L      F +    I+   +I   +      N +   +    K     +Q
Sbjct: 50  EDLTSIKEFLLTLIKSPFININYEIKSGDSIQKILKKFKVHNNEIQAVINQYKKYSNPNQ 109

Query: 317 LTKDEILRIGVVQK--DDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQM 374
           L     + + + +   +  ++I +F+I   +   + IA ++  + V      K+     +
Sbjct: 110 LLMSHKIDLIIEENLSEKNYSIAKFAIPITKSTTIEIAKDEQGKIVSRKIITKLYEKRIL 169

Query: 375 DYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSV- 433
                      I + ++ +     +N + +    R     ++ Q  ++  D+ +  +   
Sbjct: 170 SE-------NVIKNNLYSSAMEAKINPDTIIEFARIFGFEIDFQRDIRENDYFKIIYDKY 222

Query: 434 NHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFG 493
              N +      + Y H          Y+F +  + S  YF+ NGKS    L++TP+   
Sbjct: 223 FDENGEFVKSGSIYYAHMSVNGREITLYKFGDDKNYS--YFDINGKSVEKALMKTPINGA 280

Query: 494 RMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGN 553
           R++S FGMR HPILG+++ HTG D+AAP  TPI+A G G +  A W GG G    I H +
Sbjct: 281 RLSSSFGMRKHPILGFNKKHTGTDFAAPSETPIMASGSGTIVLAKWCGGGGNCIKIKHNS 340

Query: 554 GYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRI 613
            Y + Y H  + A+ +K G  ++QG+IIG++G+TG+STGPHLHYE++VNG KV+S K+++
Sbjct: 341 TYETIYAHMKSFARGMKKGKKIRQGEIIGYVGSTGISTGPHLHYEVVVNGKKVNSQKLKL 400

Query: 614 PERENLKGDLLQRFAMEKKRINSLLNNGENPKK 646
           P  + LK +  + F + + + + L+      KK
Sbjct: 401 PSGKVLKDNERKLFEVHRIKTDVLIAEMIAKKK 433


>gi|163751947|ref|ZP_02159159.1| peptidase, M23/M37 family protein [Shewanella benthica KT99]
 gi|161328163|gb|EDP99329.1| peptidase, M23/M37 family protein [Shewanella benthica KT99]
          Length = 476

 Score =  349 bits (894), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 106/470 (22%), Positives = 184/470 (39%), Gaps = 39/470 (8%)

Query: 185 TTQKINFPTDITRIQLDHTAQ---------DEEIKNAIMNQFFLLHNKKNQSFTLY--YA 233
           T   +  P+       D  ++          +   ++ M+   L   K   SF      +
Sbjct: 26  TLIIVILPSGDPHASKDTNSKLSGTIKLGNGDSSDSSNMSADKLAQLKTPLSFRTPTPPS 85

Query: 234 DPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVH 293
           D +      + P +   +  I   NR          ++P+       ++   T+      
Sbjct: 86  DLRQTITDSNTPSSPQPERSIDGLNR---------QQVPKKHVKHFKVESGDTLAALFNR 136

Query: 294 AGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIAL 353
           AG S+ D  +I +  K +  + ++   E + I      +   +   S +      L I  
Sbjct: 137 AGLSSRDVYEITQLPKAKKNLLRIIPGEEIIIVKDDAGEFLQL---SYHINPISTLVIDR 193

Query: 354 NDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLAS 413
           +D   +          I+++    R    S  I +  W A    G+  N +  +      
Sbjct: 194 DDKGYFE--------HISNKKVDSRNKFSSATINNNFWNAGVSAGLTPNQIMQLATIFGW 245

Query: 414 SVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEY 473
            ++    ++  D     F   +A+ +   +  +L         R    R+ +       Y
Sbjct: 246 DIDFALDIRRGDNFSIIFEEEYADGEFLRNGNILAAEFSNQGDRYTAVRYTDGN-----Y 300

Query: 474 FNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDG 532
           ++E+G+S R   LR+PV F  ++S F  +  HP+ G  R H GVD+ A  GTPI A G G
Sbjct: 301 YSEDGRSMRKAFLRSPVDFKYVSSSFNPKRLHPVTGQVRAHRGVDYVAAVGTPIKAAGKG 360

Query: 533 IVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTG 592
            V K+ +    G    I H + Y + Y H     + ++ G  VKQGQIIG +G+TG  TG
Sbjct: 361 RVIKSAYNQYNGNYVFIKHNDTYTTKYLHLKK--RKVRQGETVKQGQIIGTLGSTGRVTG 418

Query: 593 PHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGE 642
            HLHYE IVNG   +   V++P+   +      +F    K+I + L   +
Sbjct: 419 AHLHYEFIVNGTHRNPRTVKLPKSLPITKSEKSKFLALSKQIMAKLQQDK 468


>gi|296775698|gb|ADH42974.1| Membrane protein [uncultured SAR11 cluster alpha proteobacterium
           H17925_38M03]
          Length = 425

 Score =  348 bits (893), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 101/344 (29%), Positives = 171/344 (49%), Gaps = 11/344 (3%)

Query: 271 IPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQK 330
              + +    +++N TI   +      + D   I+  LK + ++  +     + + + + 
Sbjct: 86  NSPYEEISYTVKNNDTIEKILKSYNIRSDDINDISIKLKEK-KLASIYTGRKISLIIKKL 144

Query: 331 DDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGI 390
            DK   +   +Y              +++++    ++++    +           I + +
Sbjct: 145 GDKTNTLISFLYPVNNTTSVKIRKSKDKFIVKETILQLNKKEVVVK-------NVIKNNL 197

Query: 391 WRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSV-NHANNQASDDSELLYI 449
           + + +  G+  N++    R     ++ Q  ++  D+ E  +      NN+  D  +++Y 
Sbjct: 198 YSSATSVGVEPNIIVEFARIFGFEIDFQRDIRKGDWFEILYEKFEDDNNKVRDTGKIIYA 257

Query: 450 HARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGY 509
                      Y F+       EY++  GKS    L++TP+   R++S FGMR HPILGY
Sbjct: 258 SMYVNGKEINLYNFIYKN--EEEYYDIKGKSITKSLMKTPINGARLSSSFGMRKHPILGY 315

Query: 510 SRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNI 569
           ++MH G D+AAP GTPI+A G G V +A W GG G    I H + Y + Y H  A AK I
Sbjct: 316 NKMHRGTDFAAPSGTPIMASGSGTVTRARWCGGGGNCVKIKHNSTYETIYAHMKAFAKGI 375

Query: 570 KAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRI 613
           K G  V+QGQIIG++G+TGLSTGPHL YE+IVNG KV+S K+++
Sbjct: 376 KEGRKVRQGQIIGYVGSTGLSTGPHLXYEVIVNGKKVNSQKLKL 419


>gi|294139676|ref|YP_003555654.1| M23/M37 family peptidase [Shewanella violacea DSS12]
 gi|293326145|dbj|BAJ00876.1| peptidase, M23/M37 family [Shewanella violacea DSS12]
          Length = 481

 Score =  348 bits (892), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 98/453 (21%), Positives = 174/453 (38%), Gaps = 32/453 (7%)

Query: 191 FPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSK 250
               I     D +A+  +    + +    L  +       +    Q      + P     
Sbjct: 57  LSGSIDLSNDDVSAKSNKSTAKLEHLKTPLSIRTPTPAANH----QENIADTNSPSKPEP 112

Query: 251 KIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKN 310
           +  I          ++   + P+       ++   T+      AG S+ D  +I +  + 
Sbjct: 113 ESSI---------DELHSQQAPKTHVKHFKVKSGDTLAALFNRAGLSSRDVYEITQLPRA 163

Query: 311 EVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDI 370
           +  + ++   E + I      +   +   S +      L I  ND              I
Sbjct: 164 KKNLLKIMPGEEIIIVKDDSGNFLQL---SYHITPISTLVIDKNDKG--------YAEHI 212

Query: 371 NHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETF 430
           +++    R    +  I +  W A     +  N +  +       ++    ++  D     
Sbjct: 213 SNKEVESRNKFANATINNNFWNAGVNADLTPNQIMQLATIFGWDIDFALDIRKGDNFSII 272

Query: 431 FSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPV 490
           F   +A+ +   +  +L         R    R+ +       Y++E+G+S R   LR+PV
Sbjct: 273 FEEEYADGKFLRNGNILAAEFSNQGDRYTAVRYTDGN-----YYSEDGRSMRKAFLRSPV 327

Query: 491 PFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLI 549
            F  ++S F  +  HP+ G  R H GVD+ A  GTPI A G G V K+ +    G    I
Sbjct: 328 DFKYVSSSFNPKRLHPVTGQVRAHRGVDYVAAVGTPIKAAGKGRVIKSAYNRFNGNYVFI 387

Query: 550 HHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDST 609
            H + Y + Y H +   + ++ G  VKQGQIIG +G+TG  TG HLHYE IVNG   +  
Sbjct: 388 KHNDTYTTKYLHLNK--RKVRQGETVKQGQIIGTLGSTGRVTGAHLHYEFIVNGTHRNPR 445

Query: 610 KVRIPERENLKGDLLQRFAMEKKRINSLLNNGE 642
            V++P+   +      +F    K+I + L   +
Sbjct: 446 TVKLPKSLPIAKSQKSKFLALSKQIMAKLQQNK 478


>gi|149376104|ref|ZP_01893869.1| Membrane protein [Marinobacter algicola DG893]
 gi|149359509|gb|EDM47968.1| Membrane protein [Marinobacter algicola DG893]
          Length = 474

 Score =  348 bits (892), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 90/444 (20%), Positives = 167/444 (37%), Gaps = 19/444 (4%)

Query: 190 NFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYS 249
           +   +  R+       +  +K +      L    +  +           +          
Sbjct: 29  SADVEANRMAYSLDLDEGTVKASGKPAPRLSEKPEPAADKTPEEATAAPELASIGSEPQL 88

Query: 250 KKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALK 309
            +          T+  +     P        I+   T+      AG+++G    +     
Sbjct: 89  PEAL-------DTAAAMAEVSEPVLQWQEYKIKSGDTLSSLFGKAGFNDGIMLSVIHGSG 141

Query: 310 NEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMD 369
              ++ +L   E +        D   +    +       L +   ++            +
Sbjct: 142 EADKLQRLYAGETIAFATD---DAGELAAIDLQRNLLETLHVEKTEDG--------YSGE 190

Query: 370 INHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLET 429
              +   ++ +  S  I   ++ A    GM+  L   +      +++    ++  D  E 
Sbjct: 191 TVVREPDVKPAFASGVIDGSLYVAAREAGMSDRLAMEMAGIFGWNIDFVYDVRKGDRFEV 250

Query: 430 FFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTP 489
            +   + + +  D   +L                    +G  +Y++ +G S R   LRTP
Sbjct: 251 VYEELYLDGEKFDTGNILSARFINRGKEV-IALQYTDSNGDTDYYSPDGSSMRKAFLRTP 309

Query: 490 VPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLI 549
           +     +S    R HP+L   R H G D+AAP GTPI A G G V+ A W GGYG+  ++
Sbjct: 310 INARVSSSFNLQRRHPVLDVVRPHEGTDYAAPPGTPIKAAGHGRVQFAGWKGGYGRTVIL 369

Query: 550 HHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDST 609
            HG+   + Y H   + K IK GT VKQG  +G +G++G+ TGPHLHYE  +NG   +S 
Sbjct: 370 KHGDNITTLYAHMSRLGKGIKTGTKVKQGDTVGHVGSSGMVTGPHLHYEFRINGSPRNSR 429

Query: 610 KVRIPERENLKGDLLQRFAMEKKR 633
            V++P+ + +    + RF    ++
Sbjct: 430 TVKLPDAKPVPKSEMARFKGFAEQ 453


>gi|156975678|ref|YP_001446585.1| hypothetical protein VIBHAR_03413 [Vibrio harveyi ATCC BAA-1116]
 gi|156527272|gb|ABU72358.1| hypothetical protein VIBHAR_03413 [Vibrio harveyi ATCC BAA-1116]
          Length = 429

 Score =  347 bits (891), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 90/409 (22%), Positives = 159/409 (38%), Gaps = 19/409 (4%)

Query: 234 DPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVH 293
            P   D           +   +  +                  +   +++  +       
Sbjct: 30  LPDPQDLDPQQSRLKVGEHYSVPISVESPERSTSSTLPSVLRWETYKVKNGESAAVLFNR 89

Query: 294 AGYSNGDSAKIAKALKNEVR-VDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIA 352
            G S     ++  + K     + +L   + L+ G  + +D   + R              
Sbjct: 90  VGLSPRLLHELITSDKEIKEQLTRLRPGDRLQFGFDENNDFIQLKRTL----NAFETFRI 145

Query: 353 LNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLA 412
                +YV        +++ +    + +     I    W A   +G+N+N +  +     
Sbjct: 146 KLQGGKYVS-------EVDKKEVDYQYNYAEATIKSNFWNAGISSGLNANQIMELAGIFG 198

Query: 413 SSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVE 472
             ++    ++  D     +       +     +++                    + S +
Sbjct: 199 WDIDFALDIRKNDTFRVLYQEEVVEGEVIGRGKIIAAIFNNQGDTFTAIL----DEKSGK 254

Query: 473 YFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGD 531
           Y++ENG++ +   LR P+ F R+TS F  R  HP+ G  R H G D+AAP GTPI A G+
Sbjct: 255 YYDENGRAMKKAFLRAPLDFRRVTSNFNPRRLHPVTGRVRPHRGTDYAAPVGTPIWAAGN 314

Query: 532 GIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLST 591
           G+V+K+ +    G    I H N Y++ Y H     + +K G  VKQGQ IG +G TG  T
Sbjct: 315 GVVQKSAYNKFNGNYVFIKHSNTYITKYLHLTK--RTVKTGQRVKQGQTIGTLGGTGRVT 372

Query: 592 GPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNN 640
           GPHLHYE +VNG+  +   V +P+ ++L G   Q F    K   + L+ 
Sbjct: 373 GPHLHYEFLVNGVHKNPRTVNLPQSKSLTGKAKQTFLANAKISMAKLDR 421


>gi|83592109|ref|YP_425861.1| peptidase M23B [Rhodospirillum rubrum ATCC 11170]
 gi|83575023|gb|ABC21574.1| Peptidase M23B [Rhodospirillum rubrum ATCC 11170]
          Length = 533

 Score =  347 bits (891), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 114/523 (21%), Positives = 194/523 (37%), Gaps = 23/523 (4%)

Query: 142 ATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVTTQK-----INFPTDIT 196
           A     +  +P      +F+     +             +            +  P    
Sbjct: 19  AALGATLYFNPPVSATPLFALSPKPAEIGSAASAFSPAFAATPPFAPSLADRVPEPALPA 78

Query: 197 RIQLDH-----TAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKK 251
                           +      +      + +    +L            D  +  +  
Sbjct: 79  LAMTGANHPFRGLSSHDSSYPRRSLDATALDWQGSGDSLTATVGAEFLAELDIMVPPAPG 138

Query: 252 IKIIEENRTITSPQVLIDKI-PEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKN 310
           +           P            D  I +    T+ + +        ++    +AL+ 
Sbjct: 139 LDEDLAAALAALPAGKAGAGDSSAVDLTITVSRGDTLMELLSEQDVPLTEAHDAIEALRA 198

Query: 311 EVRVDQLTKDEILRIGVVQKDDKFTIVR-FSIYHKQKHLLTIALNDNNEYVLGVEPVKMD 369
                ++     L +    +D+   + R  S        +T+     N +          
Sbjct: 199 SFDPREIRPGHELTLSFEPRDEGAPLFRGLSFEPTIGTTITLTRTAENGFAS-------T 251

Query: 370 INHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLET 429
                   + +     I   ++ A    G+    +  ++R  +  V+ Q  L+  D    
Sbjct: 252 KQEAKLVRKVARYDGEISSSLFEAGIKAGIEQTALSELIRIYSYDVDFQRDLQKGDRFSM 311

Query: 430 FFSVNH-ANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRT 488
           F+   +  + +      +L+       T    YRF +     V+Y+N  G+  R  LLRT
Sbjct: 312 FYEQYYTDDGRLVRAGNVLFASMTLSGTVMPLYRFEDTEGF-VDYYNGKGEGIRKALLRT 370

Query: 489 PVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTL 548
           P+   R++SGFG+R HP+LG+S+MH GVD+AAP GTPI A GDG+VEKA     YG    
Sbjct: 371 PINGARLSSGFGLRRHPVLGFSKMHKGVDFAAPPGTPIYAAGDGVVEKAGPFSSYGNYVR 430

Query: 549 IHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDS 608
           + H   Y ++Y H    A  I AG  V+QGQ+IG++GTTG STGPHLHYE++    +V+ 
Sbjct: 431 LRHTEDYKTAYAHMKGFAAGITAGKKVRQGQVIGYVGTTGRSTGPHLHYEILRQNAQVNP 490

Query: 609 TKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTS 651
             VR P  ++L+G  L  F  E+ R++  +     P      S
Sbjct: 491 MGVRFPSGKSLRGKELAAFQKERARVD--MAFQATPSGTKLAS 531


>gi|170725573|ref|YP_001759599.1| peptidase M23B [Shewanella woodyi ATCC 51908]
 gi|169810920|gb|ACA85504.1| peptidase M23B [Shewanella woodyi ATCC 51908]
          Length = 475

 Score =  347 bits (890), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 99/476 (20%), Positives = 171/476 (35%), Gaps = 29/476 (6%)

Query: 185 TTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDH 244
               +     +        +++   + +   +   L      +      D   +      
Sbjct: 21  VLVSVTLIILVLPADDAQASKNANSQLSGTIELNHLDESTTTTSEFNNQDKLKVPLAFRT 80

Query: 245 PITYSKKI---KIIEENRTITSPQVLIDKIPEFADDLIP----IQHNTTIFDAMVHAGYS 297
           P   S      K+ +E   +     +     E  +        ++   T+      A  S
Sbjct: 81  PTPPSSASVIPKMNDEANLVKPEVSIAALRAEKVEQDHTETFKVKSGDTLAALFKRADLS 140

Query: 298 NGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNN 357
             D  +I    K +  + ++   + + I    + +   +     +      L I  +D  
Sbjct: 141 ARDVYEITLLPKAKKHLLKIMPGQEIMISKSSEGEFTQLK---FHLDPVSTLVINKDDKG 197

Query: 358 EYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNL 417
                    +  + ++    RT   S  I    W A    G+  N +  +       ++ 
Sbjct: 198 --------YEEKVVNKQIESRTKFASATISSNFWNAGVGAGLTPNQIMQLATIFGWDIDF 249

Query: 418 QEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNEN 477
              L+  D     F    A+ +   +  +L         R    R+ +       Y++E 
Sbjct: 250 ALDLRKDDNFSIIFEEEFADGKFLRNGNILAAEFVNQGDRYTAVRYTDGN-----YYSEE 304

Query: 478 GKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEK 536
           G+S R   LR+PV F  ++S F  +  HP+ G  R H GVD+ A  GTPI A G G V K
Sbjct: 305 GRSMRKAFLRSPVDFKYVSSSFNPKRLHPVTGQVRAHRGVDYVAAVGTPIKAAGKGRVIK 364

Query: 537 ANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLH 596
           + +    G    I H + Y + Y H     + +K G +VKQGQIIG +G TG  TG HLH
Sbjct: 365 SAYNKYNGNYVFIKHNDTYTTKYLHLKK--RKVKQGQSVKQGQIIGTLGATGRVTGAHLH 422

Query: 597 YELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
           YE IVNG   +   V++P+   +       F    K+I   +   +  K+    S 
Sbjct: 423 YEFIVNGTHRNPRTVKLPKSLPIANKEKPAFLALSKQI---MAKLQQNKQVQLASQ 475


>gi|119773986|ref|YP_926726.1| M24/M37 family peptidase [Shewanella amazonensis SB2B]
 gi|119766486|gb|ABL99056.1| peptidase, M23/M37 family [Shewanella amazonensis SB2B]
          Length = 462

 Score =  347 bits (890), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 105/461 (22%), Positives = 179/461 (38%), Gaps = 40/461 (8%)

Query: 191 FPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSK 250
           FP++           ++ I   +            Q+  +  A P     +   P   + 
Sbjct: 32  FPSEDAEASRQTPTANDNIDFTLPLSQRTPTPPMGQAADIDIAAPNGESVQEAMPSAKAS 91

Query: 251 KIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKN 310
                  NR +   +               +    T+      AG S+ D  +I +  + 
Sbjct: 92  A---TPSNREVEHFE---------------VSRGDTLAALFQRAGLSSRDVYEITRLPEA 133

Query: 311 EVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDI 370
           +  + ++   E + I    KDDK      S        LT+   ++             I
Sbjct: 134 KNNLLKIMPGEEIVIM---KDDKGEFAELSYRIDGVSTLTVQRTESG--------YSERI 182

Query: 371 NHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETF 430
           + +    RT      I+   W A    G+NS  +  +       ++  + L+  D     
Sbjct: 183 DVKQLTTRTDFAQGKIFSNFWTAAVDAGLNSGQIMDLATVFGWDIDFAQDLQKGDTFALL 242

Query: 431 FSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPV 490
           +  ++A+ +   +  +L         R    R+ +       Y++E+G+S R   LR+PV
Sbjct: 243 YEKHYADGEFVRNGAILAAEFINDGKRYTAVRYEDGN-----YYSESGQSMRKAFLRSPV 297

Query: 491 PFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLI 549
            F  ++S F  +  HP+ G  + H GVD+ A  GTPI A G G V +A +    G    I
Sbjct: 298 DFNYVSSNFNPKRLHPVTGQVKAHRGVDYVAAIGTPIKAAGAGKVIEAGYNQYNGNYVFI 357

Query: 550 HHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDST 609
            H   Y + Y H +   + +K G +VKQGQIIG +G TG  TG HLHYE IVNG+  +  
Sbjct: 358 RHNGTYTTKYLHLNK--RRVKKGDSVKQGQIIGTLGKTGRVTGAHLHYEFIVNGVHRNPR 415

Query: 610 KVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFT 650
            + +P+ E++    L +F+   K    L+      K+    
Sbjct: 416 TIDLPKAESIGKKELAKFSRISK---DLMAKISFNKQQQLA 453


>gi|297180682|gb|ADI16891.1| membrane proteins related to metalloendopeptidases [uncultured
           gamma proteobacterium HF0010_16J05]
          Length = 429

 Score =  347 bits (890), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 93/410 (22%), Positives = 162/410 (39%), Gaps = 16/410 (3%)

Query: 232 YADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAM 291
                  D     P       K   +   I      +      ++ +  ++   ++    
Sbjct: 24  SGLGDGSDTITSTPEPVVATFKTDPQG-AIDPDAKELTSESATSETVDMVKAGDSLASIF 82

Query: 292 VHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTI 351
              G+S  D   I++    +  +  +     L         +  +   +    +      
Sbjct: 83  NRNGFSAKDLHTISQTNVGKQ-LKDIFPGHRLSFL----HHEGQLKTLTYKTDRLTSYVF 137

Query: 352 ALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTL 411
              D             +          +     I   ++ A+   G+  NL   + +  
Sbjct: 138 QRADKG--------FSGEKIEFQPEKVVTYTHSTIDSSLFLASQRAGLPDNLTMRLAQIF 189

Query: 412 ASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSV 471
              ++    ++P D     +   +   +     ++L         R    +++       
Sbjct: 190 QWDIDFVLDIRPGDEFFVLYEELYFEGELIGYGDILAAEFVNQGKRYEAVQYVTETGRK- 248

Query: 472 EYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVG 530
           +YF   G S R   LR PV F R++S F MR  HP+    R H G+D+AAPRGTPI+A G
Sbjct: 249 DYFTPAGVSMRKAFLRAPVEFSRISSRFNMRRLHPVRKTVRPHRGIDYAAPRGTPILAAG 308

Query: 531 DGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLS 590
           DG ++KA+     G   +I HG  +V+ Y H     + IK G  V QGQIIG++G+TGL+
Sbjct: 309 DGRIQKASRNSANGNYIIISHGQQFVTKYLHLSKFGRGIKTGKKVTQGQIIGYVGSTGLA 368

Query: 591 TGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNN 640
           TGPHLHYE +VNG+ ++   V +P+ +++    L  FA   ++ + LL  
Sbjct: 369 TGPHLHYEFLVNGVHMNPRTVALPKAQSVAQRELPLFAKATRQHSLLLKA 418


>gi|90415202|ref|ZP_01223136.1| hypothetical membrane protein [marine gamma proteobacterium
           HTCC2207]
 gi|90332525|gb|EAS47695.1| hypothetical membrane protein [marine gamma proteobacterium
           HTCC2207]
          Length = 448

 Score =  347 bits (889), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 88/409 (21%), Positives = 163/409 (39%), Gaps = 22/409 (5%)

Query: 245 PITYSKKIKIIEENRTITSPQVLID------KIPEFADDLIPIQHNTTIFDAMVHAGYSN 298
           P+T ++  + + E   + +              P+       +    ++      A  S 
Sbjct: 37  PVTEAEANRQVSEQLVLPAKSASETIPAIEAPEPQLRWVEQTVGSGDSLSLLFNRAKLSA 96

Query: 299 GDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNE 358
            D  K++ + K+   +  L   E    G+ +  +   +     Y + + +  I   +   
Sbjct: 97  ADVYKVSSS-KDGKLLRNLYPGESFHFGLNKTGELQELH----YIQSRLVSRIYNLEGGS 151

Query: 359 YVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQ 418
           Y         ++         S     I D ++ +     +   L+  +    A  ++  
Sbjct: 152 YSS-------ELIELEPDTLLSYREGIIEDSLYLSAQQANLPDKLIMELANIFAWDIDFV 204

Query: 419 EHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENG 478
             ++  D     F   + + +     +++               + +    S  Y+   G
Sbjct: 205 FDIRQGDSFAILFQEKYLDGEKFAVGDIVAASFTNRGKTYEAVLYKDSSGRS-SYYTPEG 263

Query: 479 KSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKA 537
            S R   LR P+   R++SGF ++  HPI    + H GVD+AAPRGTP+ + GDG V  A
Sbjct: 264 LSMRKAFLRAPLDIFRISSGFNLKRKHPIHKMIKAHRGVDYAAPRGTPVFSAGDGKVLAA 323

Query: 538 NWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHY 597
            ++   G    + HG  YV+ Y H D   K ++ G  VKQ Q IG +G+TG +TGPHLHY
Sbjct: 324 GYSKANGNYVFVQHGQTYVTKYLHLDK--KKVRKGQTVKQRQTIGTVGSTGYATGPHLHY 381

Query: 598 ELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKK 646
           E +VNG+  +   V++P+   +  + L  F +    + + L       +
Sbjct: 382 EFLVNGVHRNPRTVKLPQANPISTNELAAFKLATTPVLTQLAQAGASSE 430


>gi|67459023|ref|YP_246647.1| membrane proteins related to metalloendopeptidase [Rickettsia felis
           URRWXCal2]
 gi|67004556|gb|AAY61482.1| Membrane proteins related to metalloendopeptidases [Rickettsia
           felis URRWXCal2]
          Length = 454

 Score =  346 bits (887), Expect = 7e-93,   Method: Composition-based stats.
 Identities = 101/397 (25%), Positives = 181/397 (45%), Gaps = 6/397 (1%)

Query: 259 RTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLT 318
            T+  P    ++   F +  + ++   TI   ++       +  KI   +K       L 
Sbjct: 56  ITLVQPDSNEEETISFKE--VVVKKGDTIKSILIEQHIPKNEIEKIVSLIKEGKLSSALK 113

Query: 319 KDEILRIGVVQKDDKFTIVRFSIYHK--QKHLLTIALNDNNEYVLGVEPVKMDINHQMDY 376
             + +      K  +      +       K ++ I      E +   +  K+        
Sbjct: 114 IGQQITFEYETKITENKDEDLTSEVTFLNKIVIIIDKLKTIEVIREGDNFKVAEIIVPLT 173

Query: 377 MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNH- 435
            + ++ S +I      A    G+++N +  ++   A  ++ Q  +K  D           
Sbjct: 174 KKVAKSSVSIESNFMSALKKLGLSNNSIIELINAYAYQIDFQRQIKSGDTATVITEKYVT 233

Query: 436 ANNQASDDSELLYIHARFGETRTRFYRF-LNPVDGSVEYFNENGKSSRPFLLRTPVPFGR 494
            + + S   ++LY+           YR+  +    +  +F+E+GKS +  LL+TP+   +
Sbjct: 234 EDGKFSHHGKILYVSLNLSGKEYNIYRYSHDNKANNQVFFSEDGKSVKRSLLKTPLKVIK 293

Query: 495 MTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNG 554
           ++S +G R HPILGY++MH GVD+AAP GTPI + G+G++ +  W  GYGK   + H   
Sbjct: 294 VSSHYGNRKHPILGYTKMHKGVDFAAPTGTPIYSAGNGVITEIGWKSGYGKFIQVKHSGT 353

Query: 555 YVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIP 614
             ++Y H    AKN+K G+ VKQGQ+I ++G+TG +TGPHLHYE+ ++G  V+   V+  
Sbjct: 354 LSTAYAHASNFAKNLKVGSIVKQGQVIAYVGSTGRATGPHLHYEVKIDGKHVNPMSVKTT 413

Query: 615 ERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTS 651
               L G  L++F   KK I +L    +   +    +
Sbjct: 414 PGVELNGKNLEKFKQFKKEIKTLNVKLDKELQVEKAA 450


>gi|90413142|ref|ZP_01221138.1| hypothetical membrane protein [Photobacterium profundum 3TCK]
 gi|90325833|gb|EAS42285.1| hypothetical membrane protein [Photobacterium profundum 3TCK]
          Length = 430

 Score =  346 bits (887), Expect = 7e-93,   Method: Composition-based stats.
 Identities = 92/382 (24%), Positives = 155/382 (40%), Gaps = 20/382 (5%)

Query: 258 NRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQL 317
           N+   + +     IPE       +    ++       G S+    ++  A +    +  L
Sbjct: 47  NQLRPAQEDDRPNIPELTWKKHQVASGESLAVVFNKIGLSSSTLHRLINADEGTKELTAL 106

Query: 318 TKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYM 377
              +  + G+ +K++   +    I  K      I     + +   +E  K+D        
Sbjct: 107 RPGDTFQFGIDEKNELIQL----IQPKSPTEKLIITRAGDTFKSNIEKKKVD-------T 155

Query: 378 RTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHAN 437
           + +     I    W A    G+ +N +  I       ++    ++  D     F      
Sbjct: 156 QLNFAQATITSSFWNAADRAGLTANQIMEIAGIFGWDIDFALDIREGDTFSVLFEERFVE 215

Query: 438 NQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTS 497
            +      +L              R  +       Y+++NG + R   LR+P+ F  ++S
Sbjct: 216 GEQIGRGNILAATFSNLGQTFTAVRSEDGK-----YYDQNGSAMRKAFLRSPINFRYVSS 270

Query: 498 GFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYV 556
            F  R  HP+ G  R H G D+ AP GTPI A GDGIV K+ +    G    I H + Y+
Sbjct: 271 NFNPRRLHPVTGRVRAHRGTDYVAPVGTPIWAAGDGIVMKSAYNKFNGNYVFIRHSSTYI 330

Query: 557 SSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPER 616
           + Y H     +++K G  VKQGQ +G +G+TG  TG HLHYE +VNG   +   V++P+ 
Sbjct: 331 TKYLHMTK--RSVKTGQRVKQGQTVGTLGSTGRVTGAHLHYEFLVNGTHKNPRTVKLPQA 388

Query: 617 ENLKGDLLQRFAMEK-KRINSL 637
            +LKG     F      R++ L
Sbjct: 389 NSLKGKEKSAFKKHANDRLSQL 410


>gi|297181133|gb|ADI17330.1| membrane proteins related to metalloendopeptidases [uncultured
           Oceanospirillales bacterium HF0070_21F08]
          Length = 452

 Score =  346 bits (887), Expect = 8e-93,   Method: Composition-based stats.
 Identities = 91/406 (22%), Positives = 167/406 (41%), Gaps = 14/406 (3%)

Query: 235 PQTLDQRHDHPITYSKKIKIIEENR-TITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVH 293
           P+ L          + +    +E+   +   +   +   E     + +    T+   +  
Sbjct: 44  PERLQTLDLPKKPSASQELTRQESVQPVADVRAPAETSEEDRWIKLTVASGDTLSGLLQS 103

Query: 294 AGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIAL 353
            G S     ++    +    +  +   + L I V +  +  ++     Y   +     A 
Sbjct: 104 RGVSAAQVHRLVTGDERLAELATIRPGDSLNISVDEAGELTSLR----YSPSRVETVEAT 159

Query: 354 NDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLAS 413
            ++  + +     +     +            I + ++ A    GM+ NL   +      
Sbjct: 160 LEDGNWRVENVVREYQRRTRFAE-------ATIDNSLFLAGHAAGMSDNLTMQLANIFGW 212

Query: 414 SVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEY 473
            ++    ++  D     +   + + +   + E++             YR+       V Y
Sbjct: 213 DIDFVLDIRNGDRFRVLYEELYLDGEKVGEGEIIAAEFWNQGRHLTAYRYQTRDGD-VSY 271

Query: 474 FNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDG 532
           F+ +G S R   +RTPV F R++S F     HPIL   R H G+D+AAP GTPI A G G
Sbjct: 272 FDSDGNSMRKEFIRTPVAFSRISSRFSTGRKHPILNKVRAHNGIDYAAPSGTPIKAAGKG 331

Query: 533 IVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTG 592
            V  A   GGYG   ++ HG  Y + Y H    AK I+ G+ VKQ Q IG++G +GL+TG
Sbjct: 332 KVIFAGVKGGYGNVLILKHGQRYSTLYAHMRGFAKGIRVGSRVKQSQTIGYVGASGLATG 391

Query: 593 PHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLL 638
           PHLHYE  ++G+  +   V +P+   +  +   +F ++  R+ + +
Sbjct: 392 PHLHYEFRIDGVHRNPQTVPLPKASGIASNEKPQFRVQSSRLAAQM 437


>gi|217974301|ref|YP_002359052.1| peptidase M23 [Shewanella baltica OS223]
 gi|217499436|gb|ACK47629.1| Peptidase M23 [Shewanella baltica OS223]
          Length = 468

 Score =  346 bits (886), Expect = 9e-93,   Method: Composition-based stats.
 Identities = 101/462 (21%), Positives = 179/462 (38%), Gaps = 24/462 (5%)

Query: 182 FEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQR 241
             +T   +  P++  +     T+ D++ +        L      +   L           
Sbjct: 23  SVITMITMLLPSEEAQASRQTTSIDDQAQINTRYDVPLAFRSPERPELLEGQTDNAATNA 82

Query: 242 HDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDS 301
                T +             + + L        +    +++  T+      AG ++ D 
Sbjct: 83  APLSSTDALAAGDANN----PATESLESAHHRDVEHFN-VKNGDTLAAVFDRAGLTSKDV 137

Query: 302 AKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVL 361
            +I +    +  + ++   E + I      D   +            L I  N N     
Sbjct: 138 YEITQLPLAKQNLLKIMPGEEIVISKDINGD---LTEVRYRVNAISTLIITKNQNQ---- 190

Query: 362 GVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHL 421
                +  I+ +   +R+   S  I    W A    GMN+N +  +       ++    L
Sbjct: 191 ----YQEKISEKDVEIRSHFTSAKIKSNFWNAAVDAGMNANQIMQLSTVFGWDIDFALDL 246

Query: 422 KPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSS 481
           +  D     +   +A+ +   +  +L       + R    R+ +       Y++ENG S 
Sbjct: 247 REGDSFAIIYEQEYADGEFLRNGNILAAEFVNQDERYTAIRYTDGN-----YYSENGTSM 301

Query: 482 RPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWA 540
           R   LR+PV F  ++S F  R  HP+ G  + H GVD+ A  GTPI A G G V +A + 
Sbjct: 302 RKAFLRSPVDFKYVSSNFNPRRLHPVTGQVKAHRGVDYVAAIGTPIKAAGSGRVIEAGYN 361

Query: 541 GGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELI 600
              G    I H + Y + Y H     +N+  G +VKQGQIIG +G TG  TG HLHYE I
Sbjct: 362 QFNGNYVFIKHNDTYTTKYLHLTK--RNVSKGASVKQGQIIGTLGKTGRVTGAHLHYEFI 419

Query: 601 VNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGE 642
           VNG+  +   + +P+ E++      +F    +++ + L+  +
Sbjct: 420 VNGVHRNPRTITLPKAESIARKEKNQFDALSQQLMTTLSQNK 461


>gi|54307737|ref|YP_128757.1| hypothetical protein PBPRA0532 [Photobacterium profundum SS9]
 gi|46912160|emb|CAG18955.1| hypothetical membrane protein [Photobacterium profundum SS9]
          Length = 441

 Score =  346 bits (886), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 93/392 (23%), Positives = 158/392 (40%), Gaps = 21/392 (5%)

Query: 248 YSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKA 307
           Y  +I I   N+   + +     IP        +    ++       G S+    ++  A
Sbjct: 49  YPLEINIEP-NQLRPAQEDDRPNIPALTWKKHQVASGESLAVVFNKIGLSSSTLHRLINA 107

Query: 308 LKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVK 367
            +    +  L   +  + G+  K++   +    I  K      I     + +   +E  K
Sbjct: 108 DEGTKELTALRPGDTFQFGIDDKNELIQL----IQPKSPTEKLIITRAGDTFKSNIEKKK 163

Query: 368 MDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFL 427
           +D        + +     I    W A    G+ +N +  I       ++    ++  D  
Sbjct: 164 VD-------TQLNFAQATITSSFWNAADRAGLTANQIMEIAGIFGWDIDFALDIRAGDTF 216

Query: 428 ETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLR 487
              F       +      +L              R  +       Y+++NG + R   LR
Sbjct: 217 SVLFEERFVEGEQIGRGNILAATFSNLGQTFTAIRSEDGK-----YYDQNGSAMRKAFLR 271

Query: 488 TPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQ 546
           +P+ F  ++S F  +  HP+ G  R H G D+ AP GTPI A GDGIV K+ +    G  
Sbjct: 272 SPINFRYVSSNFNPKRLHPVTGRVRAHRGTDYVAPVGTPIWAAGDGIVMKSAYNKFNGNY 331

Query: 547 TLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKV 606
             I H + Y++ Y H     +++K G  VKQGQ +G +G+TG  TG HLHYE +VNG   
Sbjct: 332 VFIRHSSTYITKYLHMTK--RSVKTGQRVKQGQTVGTLGSTGRVTGAHLHYEFLVNGTHK 389

Query: 607 DSTKVRIPERENLKGDLLQRFAMEK-KRINSL 637
           +   V++P+ ++LKG     F      R++ L
Sbjct: 390 NPRTVKLPQADSLKGKEKSAFKKYANDRLSQL 421


>gi|152999746|ref|YP_001365427.1| peptidase M23B [Shewanella baltica OS185]
 gi|151364364|gb|ABS07364.1| peptidase M23B [Shewanella baltica OS185]
          Length = 468

 Score =  346 bits (886), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 100/462 (21%), Positives = 178/462 (38%), Gaps = 24/462 (5%)

Query: 182 FEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQR 241
             +T   +  P++  +     T+ D++ +        L      +   L           
Sbjct: 23  SVITMITMLLPSEEAQASRQTTSIDDQAQINTRYDVPLAFRSPERPELLEGQTDNAPTNA 82

Query: 242 HDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDS 301
                T               + + L        +    +++  T+      AG ++ D 
Sbjct: 83  APLSSTDVLAAGDANN----PATESLESAHHRDVEHFN-VKNGDTLAAVFDRAGLTSKDV 137

Query: 302 AKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVL 361
            +I +    +  + ++   E + I      D   +            L I  N       
Sbjct: 138 YEITQLPLAKQNLLKIMPGEEIVISKDVNGD---LTEVRYRVNAISTLVITKN------- 187

Query: 362 GVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHL 421
             E  +  I+ +   +R+   S  I    W A    GM++N +  +       ++    L
Sbjct: 188 -QEQYQEKISEKDVEIRSHFTSAKIKSNFWNAAVDAGMSANQIMQLSTVFGWDIDFALDL 246

Query: 422 KPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSS 481
           +  D     +   +A+ +   +  +L       + R    R+ +       Y++ENG S 
Sbjct: 247 REGDNFAIIYEQEYADGEFLRNGNILAAEFVNQDERYTAIRYTDGN-----YYSENGTSM 301

Query: 482 RPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWA 540
           R   LR+PV F  ++S F  R  HP+ G  + H GVD+ A  GTPI A G G V +A + 
Sbjct: 302 RKAFLRSPVDFKYVSSNFNPRRLHPVTGQVKAHRGVDYVAAIGTPIKAAGSGRVIEAGYN 361

Query: 541 GGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELI 600
              G    I H + Y + Y H     +N+  G +VKQGQIIG +G TG  TG HLHYE I
Sbjct: 362 QFNGNYVFIKHNDTYTTKYLHLTK--RNVSKGASVKQGQIIGTLGKTGRVTGAHLHYEFI 419

Query: 601 VNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGE 642
           VNG+  +   + +P+ E++      +F    +++ + L+  +
Sbjct: 420 VNGVHRNPRTITLPKAESIARKEKHQFDALSQQLMTTLSQNK 461


>gi|24372892|ref|NP_716934.1| M24/M37 family peptidase [Shewanella oneidensis MR-1]
 gi|24347013|gb|AAN54379.1|AE015575_5 peptidase, M23/M37 family [Shewanella oneidensis MR-1]
          Length = 482

 Score =  345 bits (885), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 100/470 (21%), Positives = 176/470 (37%), Gaps = 30/470 (6%)

Query: 182 FEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQR 241
             +T   + FP++  +            +        L     ++   +    P   +  
Sbjct: 40  SVITMITLLFPSEEAQASRQTQGVTNH-QVNTRYDVPLAFRSPDRPEGIEGQTPDAPNNV 98

Query: 242 HDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDS 301
                  +          T+ S      +  +       +++  T+      AG ++ D 
Sbjct: 99  TPLSSAEALAAGNHSATETLESAHHRDVEHFD-------VKNGDTLAAVFERAGLTSKDV 151

Query: 302 AKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVL 361
            +I +    +  + ++   E + I      D   +            L I          
Sbjct: 152 YEITQLPLAKQNLLKIIPGEEIVISKDANGD---LTEVRYRVDAISTLVITK-------- 200

Query: 362 GVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHL 421
             +     I+ +   +R    S  I    W A    G+N+N +  +       ++    L
Sbjct: 201 AQDKYSEKISEKDIEIRPKFTSAKIKSNFWNAAVDAGLNANQIMQLSTVFGWDIDFALDL 260

Query: 422 KPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSS 481
           +  D     +   +A  +   +  +L       + R    R+ +       Y++ENG S 
Sbjct: 261 REGDSFAIIYEQEYAEGEFLRNGNILAAEFINQDERYTAVRYTDGN-----YYSENGTSM 315

Query: 482 RPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWA 540
           R   LR+PV F  ++S F  R  HP+ G  + H GVD+ A  GTPI A G+G V ++ ++
Sbjct: 316 RKAFLRSPVDFKYVSSNFNPRRLHPVTGQVKAHRGVDYVAAIGTPIKAAGNGRVIESGYS 375

Query: 541 GGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELI 600
              G    I H + Y + Y H     +N+  G +VKQGQIIG +G TG  TG HLHYE I
Sbjct: 376 QFNGNYVFIKHNDTYTTKYLHLTK--RNVNKGASVKQGQIIGTLGKTGRVTGAHLHYEFI 433

Query: 601 VNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFT 650
           VNG+  +   V +P+ E++      +F    K+   L+ N    K+    
Sbjct: 434 VNGVHRNPRTVDLPKSESIARKEKSQFDALSKQ---LMANISQNKQTQLA 480


>gi|160874365|ref|YP_001553681.1| peptidase M23B [Shewanella baltica OS195]
 gi|160859887|gb|ABX48421.1| peptidase M23B [Shewanella baltica OS195]
 gi|315266600|gb|ADT93453.1| Peptidase M23 [Shewanella baltica OS678]
          Length = 468

 Score =  345 bits (884), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 102/462 (22%), Positives = 180/462 (38%), Gaps = 24/462 (5%)

Query: 182 FEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQR 241
             +T   +  P++  +     T+ D++ +        L      +   L      T    
Sbjct: 23  SVITMITMLLPSEEAQASRQTTSIDDQAQINTRYDVPLAFRSPERPELLEGQTDNTPTNA 82

Query: 242 HDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDS 301
                T +             + + L        +    +++  T+      AG ++ D 
Sbjct: 83  APLSSTDALAAGDANN----PATESLESAHHRDVEHFN-VKNGDTLAAVFDRAGLTSKDV 137

Query: 302 AKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVL 361
            +I +    +  + ++   E + I      D   +            L I  N N     
Sbjct: 138 YEITQLPLAKQNLLKIMPGEEIVISKDINGD---LTEVRYRVNAVSTLIITKNQNQ---- 190

Query: 362 GVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHL 421
                +  I+ +   +R+   S  I    W A    GMN+N +  +       ++    L
Sbjct: 191 ----YQEKISEKDVEIRSHFTSAKIKSNFWNAAVDAGMNANQIMQLSTVFGWDIDFALDL 246

Query: 422 KPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSS 481
           +  D     +   +A+ +   +  +L       + R    R+ +       Y++ENG S 
Sbjct: 247 REGDSFAIIYEQEYADGEFLRNGNILAAEFVNQDERYTAIRYTDGN-----YYSENGTSM 301

Query: 482 RPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWA 540
           R   LR+PV F  ++S F  R  HP+ G  + H GVD+ A  GTPI A G G V +A + 
Sbjct: 302 RKAFLRSPVDFKYVSSNFNPRRLHPVTGQVKAHRGVDYVAAIGTPIKAAGSGRVIEAGYN 361

Query: 541 GGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELI 600
              G    I H + Y + Y H     +N+  G +VKQGQIIG +G TG  TG HLHYE I
Sbjct: 362 QFNGNYVFIKHNDTYTTKYLHLTK--RNVSKGASVKQGQIIGTLGKTGRVTGAHLHYEFI 419

Query: 601 VNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGE 642
           VNG+  +   + +P+ E++      +F    +++ + L+  +
Sbjct: 420 VNGVHRNPRTITLPKAESIARKEKNQFDALSQQLMTTLSQNK 461


>gi|229586682|ref|YP_002845183.1| Membrane-bound metallopeptidase [Rickettsia africae ESF-5]
 gi|228021732|gb|ACP53440.1| Membrane-bound metallopeptidase [Rickettsia africae ESF-5]
          Length = 454

 Score =  345 bits (884), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 101/397 (25%), Positives = 181/397 (45%), Gaps = 6/397 (1%)

Query: 259 RTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLT 318
            T+  P    ++   F +  + ++   TI   ++       +  KI   +K       L 
Sbjct: 56  ITLVQPDSSEEETISFKE--VVVKKGDTIKSILIEQHIPKNEIDKIVSLIKEGKLSSALK 113

Query: 319 KDEILRIGVVQKDDKFTIVRFSIYHK--QKHLLTIALNDNNEYVLGVEPVKMDINHQMDY 376
             + +      K  +      +       K ++ I      E +   +  K++       
Sbjct: 114 IGQQITFEYETKIIENEDEDLTSEVAFLNKIVIIIDKLKTIEVIREGDNFKVEEIVVPLS 173

Query: 377 MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNH- 435
            + ++ S +I      A    G++ N +  ++   A  ++ Q  +K  D           
Sbjct: 174 KKVAKSSVSIEANFMSALKKLGLSDNSIIELINAYAYQIDFQRQIKRGDTATVITEKYVT 233

Query: 436 ANNQASDDSELLYIHARFGETRTRFYRF-LNPVDGSVEYFNENGKSSRPFLLRTPVPFGR 494
            + + S   ++LY+           YR+  +    +  +F+E+GKS +  LL+TP+   +
Sbjct: 234 EDGKFSHHGKILYVSLNLSGKEYNIYRYSHDNNANNHAFFSEDGKSVKRSLLKTPLKVIK 293

Query: 495 MTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNG 554
           ++S +G R HPILGY++MH GVD+AAP GTPI + G+G++ +  W  GYGK   + H   
Sbjct: 294 VSSHYGNRKHPILGYTKMHRGVDFAAPTGTPIYSAGNGVITEIGWKSGYGKFIQVKHSGT 353

Query: 555 YVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIP 614
             ++Y H    AKN+K G+ VKQGQII ++G+TG +T PHLHYE+ ++G  V+   V+  
Sbjct: 354 LSTAYAHASNFAKNLKVGSIVKQGQIIAYVGSTGRATAPHLHYEVKIDGKHVNPMSVKTT 413

Query: 615 ERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTS 651
               L G  L++F   KK I +L+   +   +    +
Sbjct: 414 PGIELNGKNLEKFKQFKKEIKTLIVKLDKELQADKAA 450


>gi|269961966|ref|ZP_06176321.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269833289|gb|EEZ87393.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 429

 Score =  345 bits (884), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 90/409 (22%), Positives = 165/409 (40%), Gaps = 19/409 (4%)

Query: 234 DPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVH 293
            P   D           +   +  +          +       +   +++  +       
Sbjct: 30  LPDPQDLDPQQSRLKVGEHYSVPISVESPERSTSSNLPSVLRWETYKVKNGESAAVLFQR 89

Query: 294 AGYSNGDSAKIAKALKN-EVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIA 352
            G S     ++  + K  + ++ +L   + L+ G  + +D   + R              
Sbjct: 90  VGLSPRLLHELITSDKEIKQQLTRLRPGDRLQFGFDENNDFIQLKRTL----NAFETFRI 145

Query: 353 LNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLA 412
               ++YV        +++ +    + +     I    W A   +G+N+N +  +     
Sbjct: 146 KLQGSKYVS-------EVDKKEVDYQFNYAEATIKSNFWNAGISSGLNANQIMELAGIFG 198

Query: 413 SSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVE 472
             ++    ++  D     +       +     +++    +               + S +
Sbjct: 199 WDIDFALDIRKNDTFRVLYQEEVVEGEVIGRGKIIAAVFKNQGDTFTAIL----DEKSGK 254

Query: 473 YFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGD 531
           YF+ENG++ +   LR P+ F R++S F  R  HP+ G  R H G D+AAP GTPI A G+
Sbjct: 255 YFDENGRAMKKAFLRAPLDFRRVSSNFNPRRLHPVTGRVRPHRGTDYAAPVGTPIWAAGN 314

Query: 532 GIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLST 591
           G+V+K+ +    G    I H N Y++ Y H     + +K G  VKQGQ IG +G TG  T
Sbjct: 315 GVVQKSAYNKFNGNYVFIKHSNTYITKYLHLTK--RTVKTGQRVKQGQTIGTLGGTGRVT 372

Query: 592 GPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNN 640
           GPHLHYE +VNG+  +   V++P+ ++L G   Q F    K   + L+ 
Sbjct: 373 GPHLHYEFLVNGVHKNPRTVKLPQSKSLTGKAKQTFMANAKISMAKLDR 421


>gi|297181533|gb|ADI17719.1| membrane proteins related to metalloendopeptidases [uncultured
           Oceanospirillales bacterium HF0130_25G24]
          Length = 454

 Score =  344 bits (883), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 90/417 (21%), Positives = 170/417 (40%), Gaps = 19/417 (4%)

Query: 236 QTLDQRHDHPITYSKKIKIIEENRTITSPQVLI----DKIPEFADDLIPIQHNTTIFDAM 291
                +   PI  +   +I  EN  +++ Q  I        E       I+    + D  
Sbjct: 46  SGESNKISIPIRSAASEEIQRENSELSNVQDEIVANIQTPTEDLWQNFVIKGGDNLSDIF 105

Query: 292 VHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTI 351
              G ++ D  ++  + +    ++++     L   V         +      K      +
Sbjct: 106 SKVGLTDQDLFRVLNSSEQAQILNRIYPGYELGFFVPNPGQLDKFLVL----KSPLEGIV 161

Query: 352 ALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTL 411
            + DN  Y       K++   +   +  + +   I D ++ A     + +  +  +    
Sbjct: 162 FIRDNESY-------KVEEIAKEAQILPTFKLGVIEDSLFLAGQREQIPAIHLMEMANIF 214

Query: 412 ASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSV 471
              ++     +  D     +   +   +     ++L              R++N     +
Sbjct: 215 GGVIDFILDPREGDSFSILYDEKYLEGELIGHDDILVTQFINQGETFTAVRYVNNDG-EL 273

Query: 472 EYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVG 530
            Y++ +G+S R   LR P+   R++S F  R  HPIL   R H G D+AAP GTPI A  
Sbjct: 274 GYYSPDGESMRKAFLRNPLDVFRISSNFNPRRRHPILNTIRAHKGTDYAAPTGTPIRATS 333

Query: 531 DGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLS 590
           DG + +A+  G +G   +I H  G+ + Y H    A  I  G  ++QG++IG++G+TG +
Sbjct: 334 DGRITRASRYGSFGNLVIIQHSGGFETKYAHLSKFAAGISRGDRIRQGEVIGYVGSTGGA 393

Query: 591 TGPHLHYELIVNGIKVDSTKV--RIPERENLKGDLLQRFAMEKKRINSLLNNGENPK 645
           TGPHLHYE +VNG+  +   +  ++P+ E+L  + +  F  + KR+          +
Sbjct: 394 TGPHLHYEFLVNGVHQNPRTILDKLPKAESLHPNEMASFNEQTKRLLDQFEELSKSR 450


>gi|126173408|ref|YP_001049557.1| peptidase M23B [Shewanella baltica OS155]
 gi|125996613|gb|ABN60688.1| peptidase M23B [Shewanella baltica OS155]
          Length = 468

 Score =  344 bits (883), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 101/462 (21%), Positives = 179/462 (38%), Gaps = 24/462 (5%)

Query: 182 FEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQR 241
             +T   +  P++  +     T+ D++ +        L      +   L           
Sbjct: 23  SVITMITMLLPSEEAQASRQTTSIDDQAQINTRYDVPLAFRSPERPELLEGQTDNAPTNA 82

Query: 242 HDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDS 301
                T +             + + L        +    +++  T+      AG ++ D 
Sbjct: 83  TPLSSTDALAAGDANN----PATESLESAHHRDVEHFN-VKNGDTLAAVFDRAGLTSKDV 137

Query: 302 AKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVL 361
            +I +    +  + ++   E + I      D   +            L I  N N     
Sbjct: 138 YEITQLPLAKQNLLKIMPGEEIVISKDINGD---LTEVRYRVNAISTLIITKNQN----- 189

Query: 362 GVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHL 421
                +  I+ +   +R+   S  I    W A    GMN+N +  +       ++    L
Sbjct: 190 ---QYQEKISEKDVEIRSHFTSAKIKSNFWNAAVDAGMNANQIMQLSTVFGWDIDFALDL 246

Query: 422 KPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSS 481
           +  D     +   +A+ +   +  +L       + R    R+ +       Y++ENG S 
Sbjct: 247 REGDSFAIIYEQEYADGEFLRNGNILAAEFVNQDERYTAIRYTDGN-----YYSENGTSM 301

Query: 482 RPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWA 540
           R   LR+PV F  ++S F  R  HP+ G  + H GVD+ A  GTPI A G G V +A + 
Sbjct: 302 RKAFLRSPVDFKYVSSNFNPRRLHPVTGQVKAHRGVDYVAAIGTPIKAAGSGRVIEAGYN 361

Query: 541 GGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELI 600
              G    I H + Y + Y H     +N+  G +VKQGQIIG +G TG  TG HLHYE I
Sbjct: 362 QFNGNYVFIKHNDTYTTKYLHLTK--RNVSKGASVKQGQIIGTLGKTGRVTGAHLHYEFI 419

Query: 601 VNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGE 642
           VNG+  +   + +P+ E++      +F    +++ + L+  +
Sbjct: 420 VNGVHRNPRTITLPKAESIARKEKNQFDTLSQQLMTTLSQNK 461


>gi|91774419|ref|YP_544175.1| peptidase M23B [Methylobacillus flagellatus KT]
 gi|91708406|gb|ABE48334.1| peptidase M23B [Methylobacillus flagellatus KT]
          Length = 448

 Score =  344 bits (883), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 100/456 (21%), Positives = 176/456 (38%), Gaps = 17/456 (3%)

Query: 192 PTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKK 251
            T+ ++ ++  T      +  +  ++ L  +       +            D  I+   +
Sbjct: 3   QTEQSQRKVILTQNPALKERKLRLRWLLAISSLPLFGIITAFGIAPQTSTQDVAISTIVE 62

Query: 252 IKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNE 311
              + E   I++P V  +   E       ++ + T+   M      N ++    +   + 
Sbjct: 63  DVELPE---ISTPFVSENLESENYWQADQVRRDDTLASLMSRLNVQNSEALDFLRKNPDA 119

Query: 312 VRV-DQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDI 370
             +  QL     ++  V    +   +++          LT+   D+       EP     
Sbjct: 120 RALASQLRPGRAIQAQVNASGE---LLKLQYQLNPTSTLTVERTDSGYQAKTAEPT---- 172

Query: 371 NHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETF 430
                      ++  I   ++ AT    +  ++   +    +S ++    L+  D     
Sbjct: 173 ----LETHNVLKTAEIKSSLFAATDSVDIPDSIAIQMAEIFSSDIDFHSDLRKGDRFVVI 228

Query: 431 FSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPV 490
           +   + N    +  ++L           +   + NP    V Y+   GKS     LR+P+
Sbjct: 229 YEAKYNNGNLVNTGQVLAAEFTNQGKTYKAVMYRNPEG-KVAYYTPEGKSLHKSFLRSPL 287

Query: 491 PFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLI 549
            F R++SGF +   HPIL   R H GVD AAP GT I A  DG+V+     GGYG    +
Sbjct: 288 EFTRISSGFTLGRFHPILQKMRAHKGVDLAAPIGTRIKAPADGVVQFVGVKGGYGNVIYL 347

Query: 550 HHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDST 609
            H  G  + Y H    A  ++ G  V QG IIG +G TG++TGPHLHYE ++NG+  D  
Sbjct: 348 QHNGGVTTVYGHLSRFAPGLRQGMKVSQGDIIGHVGMTGMATGPHLHYEFLLNGVHRDPL 407

Query: 610 KVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPK 645
           KV +P  + L     + F      +N+ L       
Sbjct: 408 KVALPAAQPLAPQYREDFLAHSANLNAQLQLLSAST 443


>gi|119475788|ref|ZP_01616141.1| hypothetical membrane protein [marine gamma proteobacterium
           HTCC2143]
 gi|119451991|gb|EAW33224.1| hypothetical membrane protein [marine gamma proteobacterium
           HTCC2143]
          Length = 450

 Score =  344 bits (883), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 98/434 (22%), Positives = 176/434 (40%), Gaps = 23/434 (5%)

Query: 209 IKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLI 268
           +         +     +  F      P    Q     +    K++  +     T+P    
Sbjct: 17  VAEFPRKHLAIASTAISAIFVAMLLVPGETAQAKRISLPVDLKLEAKQLTAKATAP---- 72

Query: 269 DKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVV 328
              P    +   +Q    +      A  S  D  +I     N   + +L   + L   + 
Sbjct: 73  --RPVLVWEEQSVQKGDNLSLIFQRASLSASDVHEIMYNSDNSKSLLKLYPGQKLAFQID 130

Query: 329 QKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYD 388
            +     +       K              +    +        +   +R +  S  I  
Sbjct: 131 SEGTLQQLKHIQSQLKSTL-----------FARNGDSFITTHIEREPEIRQNYSSAFISS 179

Query: 389 GIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLY 448
            ++ A   +G++ NL+  +       ++    ++  D     +     +++ + +  +L 
Sbjct: 180 NLFSAAQRSGLSQNLIMELASVFGGVIDFVYDVRAGDNFTVLYEEQFLDDEKTGNGPILA 239

Query: 449 IHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPIL 507
                       YR++ P   SV Y+NENG S R   LR P+ F R++SGF  +  HP+ 
Sbjct: 240 AQFTNRGETYSAYRYVYPDG-SVGYYNENGVSMRKAFLRAPLDFTRISSGFNPKRLHPVF 298

Query: 508 GYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAK 567
             +R H G+D+AA RGTP+ A GDG + K+ +    G   +I+HG+ Y + Y H +   +
Sbjct: 299 KTTRPHRGIDYAASRGTPVYAAGDGRIAKSGYTKANGHYVVINHGSNYTTKYLHLNK--R 356

Query: 568 NIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKV--RIPERENLKGDLLQ 625
            +K G  VKQ QIIGW+G+TG +TGPHLHYE +VNG+  +   +  ++P+ +++ G    
Sbjct: 357 GVKQGQKVKQRQIIGWVGSTGYATGPHLHYEFLVNGVHRNPRTILKKLPKAKSIDGQEKV 416

Query: 626 RFAMEKKRINSLLN 639
           RF  +   +   L 
Sbjct: 417 RFTAQISGLQLQLA 430


>gi|304409331|ref|ZP_07390951.1| Peptidase M23 [Shewanella baltica OS183]
 gi|307303689|ref|ZP_07583442.1| Peptidase M23 [Shewanella baltica BA175]
 gi|304351849|gb|EFM16247.1| Peptidase M23 [Shewanella baltica OS183]
 gi|306912587|gb|EFN43010.1| Peptidase M23 [Shewanella baltica BA175]
          Length = 468

 Score =  344 bits (883), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 100/462 (21%), Positives = 178/462 (38%), Gaps = 24/462 (5%)

Query: 182 FEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQR 241
             +T   +  P++  +     T+ D++ +        L      +   L           
Sbjct: 23  SVITMITMLLPSEEAQASRQTTSIDDQAQINTRYDVPLAFRSPERPELLEGQTDNASTNA 82

Query: 242 HDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDS 301
                T +             + + L        +    +++  T+      AG ++ D 
Sbjct: 83  TPLSSTDALAAGDANN----PATESLESAHHRDVEHFN-VKNGDTLAAVFDRAGLTSKDV 137

Query: 302 AKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVL 361
            +I +    +  + ++   E + I      D   +            L I  N N     
Sbjct: 138 YEITQLPLAKQNLLKIMPGEEIVISKDINGD---LTEVRYRVNAISTLIITKNQN----- 189

Query: 362 GVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHL 421
                +  I+ +   +R+   S  I    W A    GM +N +  +       ++    L
Sbjct: 190 ---QYQEKISEKDVEIRSHFTSAKIKSNFWNAAVDAGMTANQIMQLSTVFGWDIDFALDL 246

Query: 422 KPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSS 481
           +  D     +   +A+ +   +  +L       + R    R+ +       Y++ENG S 
Sbjct: 247 REGDSFAIIYEQEYADGEFLRNGNILAAEFVNQDERYTAIRYTDGN-----YYSENGTSM 301

Query: 482 RPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWA 540
           R   LR+PV F  ++S F  R  HP+ G  + H GVD+ A  GTPI A G G V +A + 
Sbjct: 302 RKAFLRSPVDFKYVSSNFNPRRLHPVTGQVKAHRGVDYVAAIGTPIKAAGSGRVIEAGYN 361

Query: 541 GGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELI 600
              G    I H + Y + Y H     +N+  G +VKQGQIIG +G TG  TG HLHYE I
Sbjct: 362 QFNGNYVFIKHNDTYTTKYLHLTK--RNVSKGASVKQGQIIGTLGKTGRVTGAHLHYEFI 419

Query: 601 VNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGE 642
           VNG+  +   + +P+ E++      +F    +++ + L+  +
Sbjct: 420 VNGVHRNPRTITLPKAESIARKEKNQFDALSQQLMTTLSQNK 461


>gi|297170577|gb|ADI21604.1| membrane proteins related to metalloendopeptidases [uncultured
           Oceanospirillales bacterium HF0130_06B06]
          Length = 454

 Score =  344 bits (883), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 87/417 (20%), Positives = 168/417 (40%), Gaps = 19/417 (4%)

Query: 236 QTLDQRHDHPITYSKKIKIIEENRTITSPQVLI----DKIPEFADDLIPIQHNTTIFDAM 291
                +   PI  +   +   EN  +++ Q  I        E       I+    + D  
Sbjct: 46  SAESNKISIPIRSAASEETQRENSELSNAQEEIVANVQTPTEDLWQNFVIKSGDNLSDIF 105

Query: 292 VHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTI 351
              G ++ D  ++  + +    ++++     L   V         +      K      +
Sbjct: 106 SKVGLTDQDLFRVLNSSEQAQILNRIYPGYELGFFVPNPGQLDKFLVL----KSPLEGIV 161

Query: 352 ALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTL 411
                  +V   E  K++   +   +  + +   I D ++ A     + +  +  +    
Sbjct: 162 -------FVRENESYKVEEIAKEAQILPTFKLGVIEDSLFLAGQREQIPAVHLMEMANIF 214

Query: 412 ASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSV 471
              ++     +  D     +   +   +     ++L              R++N     +
Sbjct: 215 GGVIDFILDPREGDSFSILYGEKYLEGELIGHDDILVTQFINQGETFTAVRYVNKDGD-L 273

Query: 472 EYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVG 530
            Y++ +G+S R   LR P+   R++S F  R  HPIL   R H G D+AAP GTPI A  
Sbjct: 274 GYYSPDGESMRKAFLRNPLDVFRISSNFNPRRRHPILNTIRAHKGTDYAAPTGTPIRATS 333

Query: 531 DGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLS 590
           DG + +A+  G +G   +I H  G+ + Y H    A  I  G  ++QG++IG++G+TG +
Sbjct: 334 DGRITRASRYGSFGNLVIIQHSGGFETKYAHLSKFAAGISRGDRIRQGEVIGYVGSTGGA 393

Query: 591 TGPHLHYELIVNGIKVDSTKV--RIPERENLKGDLLQRFAMEKKRINSLLNNGENPK 645
           TGPHLHYE +VNG+  +   +  ++P+ E++  + +  F  + KR+          +
Sbjct: 394 TGPHLHYEFLVNGVHQNPRTILDKLPKAESIHPNEMASFNEQTKRLLDQFEELSKSR 450


>gi|157826839|ref|YP_001495903.1| membrane-bound metallopeptidase [Rickettsia bellii OSU 85-389]
 gi|157802143|gb|ABV78866.1| Membrane-bound metallopeptidase [Rickettsia bellii OSU 85-389]
          Length = 455

 Score =  344 bits (883), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 104/384 (27%), Positives = 180/384 (46%), Gaps = 7/384 (1%)

Query: 259 RTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLT 318
            T+  P+    +    +   + ++   TI   +        D  KI   +K    +  L 
Sbjct: 56  ITLVHPEAEEVQE-AISFKEVTVKKGDTINSILSGQNIPRNDIEKILSLVKENKLLPSLK 114

Query: 319 KDEILRIGVVQK---DDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMD 375
             + +      K   +D   +   +++   K +L I      E +   +  K+       
Sbjct: 115 IGQQITFEYETKITENDNEDLTSETVFLN-KIILAIDKLKTIEIIRKNDNFKITEIIVPL 173

Query: 376 YMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNH 435
               ++ S NI      A    G+++N +  ++   A  ++ Q  +K  D          
Sbjct: 174 TKTVAKSSVNIESNFMSALKKLGLSNNNIIELINAYAYQIDFQRQIKSGDTATVITEKYV 233

Query: 436 -ANNQASDDSELLYIHARFGETRTRFYRFLNPVD-GSVEYFNENGKSSRPFLLRTPVPFG 493
             + + S   ++LY+           YR+ +  +  +  +F+E+GKS +  LLRTP+   
Sbjct: 234 TEDGKFSHHGKILYVSLNLSGKEYNIYRYSHDNNVNNHAFFSEDGKSVKRSLLRTPLKVI 293

Query: 494 RMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGN 553
           +++S +G+R HPILGY++MH GVD+AAP GTPI + G+G++ +  W  GYGK   I H  
Sbjct: 294 KVSSQYGIRKHPILGYTKMHKGVDFAAPTGTPIYSAGNGVITEIGWKSGYGKFIQIKHSG 353

Query: 554 GYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRI 613
              ++Y H    AK +K G+ VKQG II ++G+TG +TGPHLHYE+ ++G  V+   V+ 
Sbjct: 354 TLSTAYAHASNFAKGLKVGSLVKQGDIIAYVGSTGRATGPHLHYEVKIDGKHVNPMSVKT 413

Query: 614 PERENLKGDLLQRFAMEKKRINSL 637
                L G  L++F   KK + +L
Sbjct: 414 TPGVELSGKKLEKFKQFKKEVKTL 437


>gi|91205702|ref|YP_538057.1| membrane-bound metallopeptidase [Rickettsia bellii RML369-C]
 gi|91069246|gb|ABE04968.1| Membrane-bound metallopeptidase [Rickettsia bellii RML369-C]
          Length = 455

 Score =  344 bits (883), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 104/384 (27%), Positives = 180/384 (46%), Gaps = 7/384 (1%)

Query: 259 RTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLT 318
            T+  P+    +    +   + ++   TI   +        D  KI   +K    +  L 
Sbjct: 56  ITLVHPEAEEVQE-AISFKEVTVKKGDTINSILSGQNIPRNDIEKILSLVKENKLLPSLK 114

Query: 319 KDEILRIGVVQK---DDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMD 375
             + +      K   +D   +   +++   K +L I      E +   +  K+       
Sbjct: 115 IGQQITFEYETKITENDNEDLTSETVFLN-KIILAIDKLKTIEIIRKNDNFKITEIIVPL 173

Query: 376 YMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNH 435
               ++ S NI      A    G+++N +  ++   A  ++ Q  +K  D          
Sbjct: 174 TKTVAKSSVNIESNFMSALKKLGLSNNNIIELINAYAYQIDFQRQIKSGDTATVITEKYV 233

Query: 436 -ANNQASDDSELLYIHARFGETRTRFYRFLNPVD-GSVEYFNENGKSSRPFLLRTPVPFG 493
             + + S   ++LY+           YR+ +  +  +  +F+E+GKS +  LLRTP+   
Sbjct: 234 TEDGKFSHHGKILYVSLNLSGKEYNIYRYSHDNNVNNHAFFSEDGKSVKRSLLRTPLKVI 293

Query: 494 RMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGN 553
           +++S +G+R HPILGY++MH GVD+AAP GTPI + G+G++ +  W  GYGK   I H  
Sbjct: 294 KVSSQYGIRKHPILGYTKMHKGVDFAAPTGTPIYSAGNGVITEIGWKSGYGKFIQIKHSG 353

Query: 554 GYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRI 613
              ++Y H    AK +K G+ VKQG II ++G+TG +TGPHLHYE+ ++G  V+   V+ 
Sbjct: 354 TLSTAYAHASNFAKGLKVGSLVKQGDIIAYVGSTGRATGPHLHYEVKIDGKHVNPMSVKT 413

Query: 614 PERENLKGDLLQRFAMEKKRINSL 637
                L G  L++F   KK + +L
Sbjct: 414 TPGVELSGKKLEKFKQFKKEVKTL 437


>gi|157964488|ref|YP_001499312.1| membrane-bound metallopeptidase [Rickettsia massiliae MTU5]
 gi|157844264|gb|ABV84765.1| Membrane-bound metallopeptidase [Rickettsia massiliae MTU5]
          Length = 485

 Score =  344 bits (882), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 102/383 (26%), Positives = 178/383 (46%), Gaps = 6/383 (1%)

Query: 259 RTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLT 318
            T+  P    ++   F +  + ++   TI   ++       +  KI   +K       L 
Sbjct: 87  ITLVQPDSSEEETISFKE--VVVKKGDTIKSILIEQHIPKNEIDKIVSLIKEGRLSSALK 144

Query: 319 KDEILRIGVVQKDDKFTIVRFSIYHK--QKHLLTIALNDNNEYVLGVEPVKMDINHQMDY 376
             + +      K  +      +       K ++ I      E +   +  K++       
Sbjct: 145 IGQQITFEYETKITENEDEDLTSEVAFLNKIVIIIDKLKTIEVIREGDNFKVEEIVVPLN 204

Query: 377 MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNH- 435
            + ++ S +I      A    G+++N +  ++   A  ++ Q  +K  D           
Sbjct: 205 KKVAKSSVSIEANFMSALKKLGLSNNSIIELINAYAYQIDFQRQIKSGDTATVITEKYVT 264

Query: 436 ANNQASDDSELLYIHARFGETRTRFYRF-LNPVDGSVEYFNENGKSSRPFLLRTPVPFGR 494
            + + S   ++LY+           YR+  +    +  +F+E+GKS +  LL+TP+   +
Sbjct: 265 EDGKFSHHGKILYVSLNLSGKEYNIYRYSHDNDANNYAFFSEDGKSVKRSLLKTPLKVIK 324

Query: 495 MTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNG 554
           ++S +G R HPILGY++MH GVD+AAP GTPI A G+G++ +  W  GYGK   + H   
Sbjct: 325 VSSHYGNRKHPILGYTKMHKGVDFAAPTGTPIYAAGNGVITEIGWKSGYGKFIQVKHSGT 384

Query: 555 YVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIP 614
             ++Y H    AKN+K G+ VKQGQII ++G+TG +T PHLHYE+ ++G  V+   V+  
Sbjct: 385 LSTAYAHASNFAKNLKVGSIVKQGQIIAYVGSTGRATAPHLHYEVKIDGKHVNPMSVKTT 444

Query: 615 ERENLKGDLLQRFAMEKKRINSL 637
               L G  L++F   KK I +L
Sbjct: 445 PGIELNGKNLEKFKQFKKEIKTL 467


>gi|332286791|ref|YP_004418702.1| metallopeptidase [Pusillimonas sp. T7-7]
 gi|330430744|gb|AEC22078.1| metallopeptidase [Pusillimonas sp. T7-7]
          Length = 455

 Score =  344 bits (882), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 97/403 (24%), Positives = 156/403 (38%), Gaps = 16/403 (3%)

Query: 243 DHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSA 302
                   + +   +      PQ   +    F      I+   T+   +           
Sbjct: 48  PSQAPVVYEARQTLD-LPSPFPQAQNNFTAPFISQT-QIRAGDTLAVLLQRLHVQEPGLL 105

Query: 303 KIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVR----FSIYHKQKHL--LTIALNDN 356
                 K+   + +L     L+  + Q  +   +      +++   +     L I  +D+
Sbjct: 106 PFLIQSKDARSIYKLYPGRSLQAALDQDGNLAWLRYNHTPYTVDQGKPVSRWLEIKPDDD 165

Query: 357 NEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVN 416
             +           + Q    +       I   ++ AT   G+   +   +   L S ++
Sbjct: 166 GGFSAAE-------HTQAASAQIQMAEGVIRSSLFGATDAAGIPDAITMQMTEILGSKID 218

Query: 417 LQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNE 476
               L+  D+    +     N        +L +             F  P   S  Y++ 
Sbjct: 219 FIRDLRSDDYFRIVYETYSHNGHEVGSGRVLALEFSNRNKTYEAVWF-TPEGESGSYYDF 277

Query: 477 NGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEK 536
            G S +   LRT + F R++S FGMR HP+ G  R H GVD+AAP GTPI A  DG+VE 
Sbjct: 278 EGASLKGAFLRTALKFTRISSTFGMRKHPVHGVWRGHKGVDYAAPSGTPIHATADGVVEF 337

Query: 537 ANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLH 596
                GYG   ++ H NGY + Y HQ   AK ++ G  V QGQ+IG++G+TG +TGPHLH
Sbjct: 338 KGKKNGYGNTIILKHHNGYSTLYAHQSRYAKGLRKGNKVSQGQLIGYVGSTGWATGPHLH 397

Query: 597 YELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLN 639
           YE  VN   +D   + +P    L     + F     R    L+
Sbjct: 398 YEFRVNNKPIDPLSIDLPVARTLDKSQRKAFEQTVVRYQDHLH 440


>gi|269103472|ref|ZP_06156169.1| hypothetical membrane protein [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268163370|gb|EEZ41866.1| hypothetical membrane protein [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 433

 Score =  344 bits (882), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 87/386 (22%), Positives = 159/386 (41%), Gaps = 18/386 (4%)

Query: 259 RTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLT 318
            T    +   +   +       I+   T+  A    G S  +  ++ +  K   ++ +LT
Sbjct: 60  ITDNDDRPTTNLKNQLDWRYHTIRRGETLAIAFDKMGLSGQELHRLLQDDKGAKQLTELT 119

Query: 319 KDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMR 378
             + L  G         +   ++       L +   D+ ++   +E        +     
Sbjct: 120 PGDTLEFGFEPSG---QLTHITLKQSPIKTLVVEKQDDGQFESRIE-------QKAVDTH 169

Query: 379 TSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANN 438
           T+     I    W A    G+ +N +  I       ++    ++  D     +  +  + 
Sbjct: 170 TNFAQATISSSFWSAADKAGLTANQIMEIAGIFGWDIDFALDIRAGDKFAVLYEEHFVDG 229

Query: 439 QASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSG 498
           +  D   +L              R  +       Y++++G++ R   LR+P+ F  ++S 
Sbjct: 230 ERIDRGNILAATFTNMGQTFTAVRSKDGS-----YYSQDGEAMRKAFLRSPINFRYVSSN 284

Query: 499 FGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVS 557
           F  R  HP+ G  + H G D+ AP GTPI + GDGIV ++++    G    + H + YV+
Sbjct: 285 FNPRRLHPVTGKVKAHRGTDYVAPIGTPIWSAGDGIVMESSYNRFNGNYVFVRHSSKYVT 344

Query: 558 SYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERE 617
            Y H     +++K G  VKQGQ++G +G TG  TGPHLHYE +VNGI  +   V++P+ E
Sbjct: 345 KYLHMTK--RSVKKGQRVKQGQVVGTLGGTGRVTGPHLHYEFLVNGIHKNPRTVQLPQAE 402

Query: 618 NLKGDLLQRFAMEKKRINSLLNNGEN 643
            L G     F     +    ++  + 
Sbjct: 403 ALHGKKKAEFKQMANKRMEQISLLKT 428


>gi|152981639|ref|YP_001351991.1| hypothetical protein mma_0301 [Janthinobacterium sp. Marseille]
 gi|151281716|gb|ABR90126.1| Uncharacterized conserved protein [Janthinobacterium sp. Marseille]
          Length = 455

 Score =  344 bits (881), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 100/425 (23%), Positives = 170/425 (40%), Gaps = 12/425 (2%)

Query: 211 NAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDK 270
                           +F      P   D   D PI    +   +     +      +DK
Sbjct: 23  RKTRIVSASALLLAVCAFGAAGVAPMAPD-ADDLPIKSITQELQLPH---LADQIAALDK 78

Query: 271 IPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQK 330
           + +       ++   T+   +   G  +  +    K+      V QL   + +++   + 
Sbjct: 79  LQQNYISEERVRSGDTLATLLGRLGVDDDAATAFIKSDAVARNVMQLKAGKRVQVQTNED 138

Query: 331 DDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGI 390
            +   +   +              +   +    + V M+        R    S  I   +
Sbjct: 139 GELNWLSSTTGTGVGNLKNIEIRREGKSFKASEKAVAMER-------RIEMRSGEIRSSL 191

Query: 391 WRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIH 450
           + AT    +  N+   I+   +++++    L+  D     +     N +      +L   
Sbjct: 192 FAATDAAQIPDNVASQIVDMFSTNIDFGSDLRRGDRFNVVYETFWQNGEYVYAGRVLAGE 251

Query: 451 ARFGETRTRFYRFLNPV-DGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGY 509
              G    +   F +P    S  Y+  +GKS +   L++P+ F R++SGF +R HPI G 
Sbjct: 252 FMNGPATYQSVWFDDPSVASSGGYYGFDGKSLKKAFLKSPLEFSRISSGFSVRKHPISGL 311

Query: 510 SRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNI 569
            + H GVD+AA  GTPI A GDG+++ A    GYG   +I H + Y ++Y H    A N+
Sbjct: 312 WKAHKGVDFAAAIGTPIRASGDGVIDFAGTQRGYGNVVIIKHWSKYSTAYAHMSRFATNL 371

Query: 570 KAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAM 629
           + G+ V QGQ+IG++G TG STGPHLHYE  VN    D   V IP  + L    +Q+F  
Sbjct: 372 RKGSKVSQGQVIGYVGMTGWSTGPHLHYEFRVNNEARDPMTVDIPNAQPLTASQMQKFRN 431

Query: 630 EKKRI 634
               +
Sbjct: 432 VANDM 436


>gi|163802288|ref|ZP_02196182.1| hypothetical protein 1103602000417_AND4_14371 [Vibrio sp. AND4]
 gi|159173817|gb|EDP58631.1| hypothetical protein AND4_14371 [Vibrio sp. AND4]
          Length = 429

 Score =  343 bits (880), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 93/419 (22%), Positives = 166/419 (39%), Gaps = 19/419 (4%)

Query: 224 KNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQH 283
             Q     +  P   D           +   +  +  ++              +   +++
Sbjct: 20  SVQIIATLFFLPDPQDLDPQQNRLKVGEHYSVPISVNLSEQGASSTLSSVLRWETYKVKN 79

Query: 284 NTTIFDAMVHAGYSNGDSAKIAKALKN-EVRVDQLTKDEILRIGVVQKDDKFTIVRFSIY 342
             +        G S     K+  + K  + ++ +L   + L  G  + ++   + R    
Sbjct: 80  GESAAVLFNRVGLSPRLLHKLITSDKEIKQQLTRLRPGDKLLFGFDEHNNFVQLKRTL-- 137

Query: 343 HKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSN 402
                         ++YV  V+  ++D  +     R       I    W A   +G+N+N
Sbjct: 138 --NAFETFRVRLQGDKYVSEVDKKEVDYQYNYAEAR-------IESNFWNAGITSGLNAN 188

Query: 403 LVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYR 462
            +  +       ++    ++  D     +       +     +++               
Sbjct: 189 QIMELAGMFGWDIDFALDIRKNDSFRVLYQEEVVEGEVIGRGKIIAAIFNNQGDTFTAIL 248

Query: 463 FLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAP 521
                + S +Y++ENG++ +   LR P+ F R++S F  R  HP+ G  R H G D+AAP
Sbjct: 249 ----DEKSGKYYDENGRAMKKAFLRAPLDFRRVSSNFNPRRLHPVTGRIRPHRGTDYAAP 304

Query: 522 RGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQII 581
            GTPI A G+G+V+K+ +    G    I H N Y++ Y H     + +K G  VKQGQ I
Sbjct: 305 VGTPIWAAGNGVVQKSAYNKFNGNYVFIKHSNTYITKYLHLTK--RTVKTGQRVKQGQTI 362

Query: 582 GWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNN 640
           G +G TG  TGPHLHYE +VNG+  +   V +P+ ++L G   Q F    K   + L+ 
Sbjct: 363 GTLGGTGRVTGPHLHYEFLVNGVHKNPRTVNLPQSKSLTGKAKQTFLANAKISMAKLDR 421


>gi|109896841|ref|YP_660096.1| peptidase M23B [Pseudoalteromonas atlantica T6c]
 gi|109699122|gb|ABG39042.1| peptidase M23B [Pseudoalteromonas atlantica T6c]
          Length = 439

 Score =  343 bits (880), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 97/455 (21%), Positives = 182/455 (40%), Gaps = 27/455 (5%)

Query: 190 NFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYS 249
           NFP           A    + +       L     ++      A      +     I   
Sbjct: 5   NFPVVKKAFSQLPKAHKWAVASLASIVLILALFPSDR------ASASRNTEAALLEIGKR 58

Query: 250 KKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALK 309
            ++ I  ++ +++S + + D   +   +   ++   T+      AG S  D+  ++ A +
Sbjct: 59  YELPISTDHLSVSSEEHVSD---DVEWNTYQVKRGDTLAKIFKRAGLSARDTYNVSSAGE 115

Query: 310 NEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMD 369
               + ++   +++ + V +          S        L I  ++ N+    V+  K+D
Sbjct: 116 LAKMLLKIRPGQLVSLQVDENGS---FAGLSYAFSNTETLLIHPDEKNQLTARVDKKKVD 172

Query: 370 INHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLET 429
                   R +     I    W A     ++ + +  +       ++    ++  D    
Sbjct: 173 -------TRLNYAQGEINSSFWNAGVKAHLSESQIMSLAAIFGWDIDFALEIRQGDNFNV 225

Query: 430 FFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTP 489
            F   + + +  +  +++      G       R+ +       Y+   G+S R   LR P
Sbjct: 226 VFEEKYIDGEFVEYGDIVSAEFTNGGNTFTAIRYSDGN-----YYTPEGRSMRKSFLRAP 280

Query: 490 VPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTL 548
           V F  ++S F  R  HP+    + H GVD+AA RGTP++A GDG V ++++    G    
Sbjct: 281 VSFKYISSSFTKRRFHPVQKRWKAHRGVDYAANRGTPVMAAGDGKVIRSSYDKYNGNHVF 340

Query: 549 IHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDS 608
           I HG  YV+ Y H     + +K G  VKQG +IG +G+TGL++GPHLHYE +V+G+  + 
Sbjct: 341 IQHGEKYVTKYLHFTK--RKVKVGQTVKQGDVIGTVGSTGLASGPHLHYEFLVDGVHRNP 398

Query: 609 TKVRIPERENLKGDLLQRFAMEKKRINSLLNNGEN 643
             V +P+   +       F +  K    LL N + 
Sbjct: 399 RTVSLPKALPIAKKERSAFELVAKEQLELLTNSKR 433


>gi|34580525|ref|ZP_00142005.1| hypothetical protein [Rickettsia sibirica 246]
 gi|28261910|gb|EAA25414.1| unknown [Rickettsia sibirica 246]
          Length = 454

 Score =  343 bits (879), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 101/383 (26%), Positives = 178/383 (46%), Gaps = 6/383 (1%)

Query: 259 RTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLT 318
            T+  P    ++   F +  + ++   TI   ++       +  KI   +K       L 
Sbjct: 56  ITLVQPDSSAEETISFKE--VVVKKGDTIKSILIEQHIPKNEIDKIVSLIKEGKLSSALK 113

Query: 319 KDEILRIGVVQKDDKFTIVRFSIYHK--QKHLLTIALNDNNEYVLGVEPVKMDINHQMDY 376
             + +      K  +      +       K ++ I      E +   +  K++       
Sbjct: 114 IGQQITFEYETKIIENEDEDLTSEVAFLNKIVIVIDKLKTIEIIREGDNFKVEEIVVPLS 173

Query: 377 MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNH- 435
            + ++ S +I      A    G++ N +  ++   A  ++ Q  +K  D           
Sbjct: 174 KKVAKSSVSIEANFMSALKKLGLSDNSIIELINAYAYQIDFQRQIKRGDTATVITEKYVT 233

Query: 436 ANNQASDDSELLYIHARFGETRTRFYRFLNPVD-GSVEYFNENGKSSRPFLLRTPVPFGR 494
            + + S   ++LY+           YR+ +  +  +  +F+E+GKS +  LL+TP+   +
Sbjct: 234 EDGKFSHHGKILYVSLNLSGKEYNIYRYSHDNNTNNHAFFSEDGKSVKRSLLKTPLKVIK 293

Query: 495 MTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNG 554
           ++S +G R HPILGY++MH GVD+AAP GTPI + G+G++ +  W  GYGK   + H   
Sbjct: 294 VSSHYGNRKHPILGYTKMHRGVDFAAPTGTPIYSAGNGVITEIGWKSGYGKFIQVKHSGT 353

Query: 555 YVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIP 614
             ++Y H    AKN+K G+ VKQGQII ++G+TG +T PHLHYE+ ++G  V+   V+  
Sbjct: 354 LSTAYAHASNFAKNLKVGSIVKQGQIIAYVGSTGRATAPHLHYEVKIDGKHVNPMSVKTT 413

Query: 615 ERENLKGDLLQRFAMEKKRINSL 637
               L G  L++F   KK I +L
Sbjct: 414 PGIELNGKNLEKFKQFKKEIKTL 436


>gi|83310001|ref|YP_420265.1| hypothetical protein amb0902 [Magnetospirillum magneticum AMB-1]
 gi|82944842|dbj|BAE49706.1| Membrane protein [Magnetospirillum magneticum AMB-1]
          Length = 462

 Score =  343 bits (879), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 115/462 (24%), Positives = 202/462 (43%), Gaps = 29/462 (6%)

Query: 200 LDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENR 259
           L        +   +   +        +  TL  A P  +D   +     S ++       
Sbjct: 16  LAIALVVAGVAVMVSRPYVSFSPFGEEGGTLDSAPPSYVDMESEGSAQPSPEL------- 68

Query: 260 TITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTK 319
              S   L D+     D ++ +    T+   +  AG  + D++++ +AL        L  
Sbjct: 69  ---SDGELEDRSGRPVDHVLQVGSGETLASLLGRAGIPSADTSQVIEALVKVFDPRDLKA 125

Query: 320 DEILRIGVVQKD---DKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDY 376
            + + +          +    +  +       + +  N    ++   E  ++        
Sbjct: 126 GQKVTVTFDPSPWGFGQGPFSQVGLAADPIREIQVRRNPKGGFIGREERRQVTRQVA--- 182

Query: 377 MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHA 436
                 S  I   ++ + +  G+ +  +  ++R L+  V+ Q  ++  D  E  F   + 
Sbjct: 183 ----HFSGKIKSSLFESATAAGIPAQAIINMIRVLSYDVDFQRDIQAGDSFEVLFDGWYD 238

Query: 437 -NNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRM 495
              +     ++LY            YRF +    S ++FN  G+S++  LL+TPV   ++
Sbjct: 239 TKGKLVKSGDILYAGLDLSGAEVTLYRFEDGSGAS-DFFNGKGESAKKALLKTPVDGAKI 297

Query: 496 TSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGY 555
           TSGFG+R+HPILG+S+MH GVD+  P GTPI+A GDG V+ A   G YG    I HGNG+
Sbjct: 298 TSGFGLRHHPILGFSKMHKGVDFGVPPGTPIMAAGDGSVDMAGPNGAYGNYVRIRHGNGF 357

Query: 556 VSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPE 615
            ++Y H   IA+ +  G  + QGQIIG++G+TG STGPHLHYE++    +V+   +++P 
Sbjct: 358 STAYAHMQRIAQGVHTGRRIMQGQIIGFVGSTGRSTGPHLHYEVLQGNNQVNPLSIKVPT 417

Query: 616 RENLKGDLLQRFAMEKKRINSLLNN-------GENPKKPLFT 650
              L G  + R+   K+  + L+           NP KP+  
Sbjct: 418 GIKLAGRDMDRYQAHKRATDLLMAQIPSGAHVASNPGKPVQA 459


>gi|120599834|ref|YP_964408.1| peptidase M23B [Shewanella sp. W3-18-1]
 gi|120559927|gb|ABM25854.1| peptidase M23B [Shewanella sp. W3-18-1]
          Length = 468

 Score =  343 bits (879), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 99/470 (21%), Positives = 179/470 (38%), Gaps = 27/470 (5%)

Query: 182 FEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQR 241
             +T   +  P++  +         E+ +        L      +  ++           
Sbjct: 23  SVITMITMLLPSEEAQASRQTAGISEQTQINTRYDVPLAFRSPQRPESIEGESSDVPANA 82

Query: 242 HDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDS 301
                T +        N+ + S +  + +      +   +++  T+      AG ++ D 
Sbjct: 83  EPLSSTDALAAGNA-NNQAVESIESALHR----DVEHFNVKNGDTLAAVFDRAGLTSKDV 137

Query: 302 AKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVL 361
            +I +    +  + ++   E + I    K D   +            L I+ N       
Sbjct: 138 YEITQLPLAKQNLLKIMPGEEIVISKDAKGD---LTEVRYRINAISTLVISKN------- 187

Query: 362 GVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHL 421
             E     I+ +   +RT   S  I    W +    G+N+N +  +       ++    L
Sbjct: 188 -QEQYHEKISEKDVEIRTHFTSAKIKSNFWNSAVDAGLNANQIMQLSTVFGWDIDFALDL 246

Query: 422 KPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSS 481
           +  D     +   +A  +   +  +L       + R    R+ +       Y++ENG S 
Sbjct: 247 REGDSFAIIYEQEYAEGEFLRNGNILAAEFINQDERYTAIRYTDGN-----YYSENGTSM 301

Query: 482 RPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWA 540
           R   LR+PV F  ++S F  +  HP+ G  + H GVD+ A  GTPI A G G V ++ + 
Sbjct: 302 RKAFLRSPVDFKYVSSNFNPKRLHPVTGQVKAHRGVDYVAAIGTPIKAAGSGRVIESGYN 361

Query: 541 GGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELI 600
              G    I H + Y + Y H     +N+  G  VKQGQIIG +G TG  TG HLHYE I
Sbjct: 362 QFNGNYVFIKHNDTYTTKYLHLTK--RNVSKGANVKQGQIIGTLGKTGRVTGAHLHYEFI 419

Query: 601 VNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFT 650
           VNG+  +   + +P+ E++      +F    ++   L+      K+    
Sbjct: 420 VNGVHRNPRTITLPKAESIARKEKPQFDALSRQ---LMATISQNKQTQLA 466


>gi|319425530|gb|ADV53604.1| Peptidase M23 [Shewanella putrefaciens 200]
          Length = 468

 Score =  343 bits (879), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 99/470 (21%), Positives = 179/470 (38%), Gaps = 27/470 (5%)

Query: 182 FEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQR 241
             +T   +  P++  +         E+ +        L      +  ++           
Sbjct: 23  SVITMITMLLPSEEAQASRQTAGMSEQTQINTRYDVPLAFRSPQRPESIEGESSDVPANA 82

Query: 242 HDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDS 301
                T +        N+ + S +  + +      +   +++  T+      AG ++ D 
Sbjct: 83  EPLSSTDALAAGNA-NNQAVESIESALHR----DVEHFNVKNGDTLAAVFDRAGLTSKDV 137

Query: 302 AKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVL 361
            +I +    +  + ++   E + I    K D   +            L I+ N       
Sbjct: 138 YEITQLPLAKQNLLKIMPGEEIVISKDAKGD---LTEVRYRINAISTLVISKN------- 187

Query: 362 GVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHL 421
             E     I+ +   +RT   S  I    W +    G+N+N +  +       ++    L
Sbjct: 188 -QEQYHEKISEKDVEIRTHFTSAKIKSNFWNSAVDAGLNANQIMQLSTVFGWDIDFALDL 246

Query: 422 KPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSS 481
           +  D     +   +A  +   +  +L       + R    R+ +       Y++ENG S 
Sbjct: 247 REGDSFAIIYEQEYAEGEFLRNGNILAAEFINQDERYTAIRYTDGN-----YYSENGTSM 301

Query: 482 RPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWA 540
           R   LR+PV F  ++S F  +  HP+ G  + H GVD+ A  GTPI A G G V ++ + 
Sbjct: 302 RKAFLRSPVDFKYVSSNFNPKRLHPVTGQVKAHRGVDYVAAIGTPIKAAGSGRVIESGYN 361

Query: 541 GGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELI 600
              G    I H + Y + Y H     +N+  G  VKQGQIIG +G TG  TG HLHYE I
Sbjct: 362 QFNGNYVFIKHNDTYTTKYLHLTK--RNVSKGANVKQGQIIGTLGKTGRVTGAHLHYEFI 419

Query: 601 VNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFT 650
           VNG+  +   + +P+ E++      +F    ++   L+      K+    
Sbjct: 420 VNGVHRNPRTITLPKAESIARKEKPQFDALSRQ---LMATISQNKQTQLA 466


>gi|146292230|ref|YP_001182654.1| peptidase M23B [Shewanella putrefaciens CN-32]
 gi|145563920|gb|ABP74855.1| peptidase M23B [Shewanella putrefaciens CN-32]
          Length = 468

 Score =  343 bits (879), Expect = 7e-92,   Method: Composition-based stats.
 Identities = 99/470 (21%), Positives = 179/470 (38%), Gaps = 27/470 (5%)

Query: 182 FEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQR 241
             +T   +  P++  +         E+ +        L      +  ++           
Sbjct: 23  SVITMITMLLPSEEAQASRQTAGISEQTQINTRYDVPLAFRSPQRPESIEGESSDVPANA 82

Query: 242 HDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDS 301
                T +        N+ + S +  + +      +   +++  T+      AG ++ D 
Sbjct: 83  EPLSSTDALAAGNA-NNQAVESIESALHR----DVEHFNVKNGDTLAAVFDRAGLTSKDV 137

Query: 302 AKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVL 361
            +I +    +  + ++   E + I    K D   +            L I+ N       
Sbjct: 138 YEITQLPLAKQNLLKIMPGEEIVISKDAKGD---LTEVRYRINAISTLVISKN------- 187

Query: 362 GVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHL 421
             E     I+ +   +RT   S  I    W +    G+N+N +  +       ++    L
Sbjct: 188 -QEQYHEKISEKDVEIRTHFTSAKIKSNFWNSAVDAGLNANQIMQLSTVFGWDIDFALDL 246

Query: 422 KPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSS 481
           +  D     +   +A  +   +  +L       + R    R+ +       Y++ENG S 
Sbjct: 247 REGDSFAIIYEQEYAEGEFLRNGNILAAEFINQDERYTAIRYTDGN-----YYSENGTSM 301

Query: 482 RPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWA 540
           R   LR+PV F  ++S F  +  HP+ G  + H GVD+ A  GTPI A G G V ++ + 
Sbjct: 302 RKAFLRSPVDFKYVSSNFNPKRLHPVTGQIKAHRGVDYVAAIGTPIKAAGSGRVIESGYN 361

Query: 541 GGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELI 600
              G    I H + Y + Y H     +N+  G  VKQGQIIG +G TG  TG HLHYE I
Sbjct: 362 QFNGNYVFIKHNDTYTTKYLHLTK--RNVSKGANVKQGQIIGTLGKTGRVTGAHLHYEFI 419

Query: 601 VNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFT 650
           VNG+  +   + +P+ E++      +F    ++   L+      K+    
Sbjct: 420 VNGVHRNPRTITLPKAESIARKEKPQFDALSRQ---LMATISQNKQTQLA 466


>gi|308050796|ref|YP_003914362.1| peptidase M23 [Ferrimonas balearica DSM 9799]
 gi|307632986|gb|ADN77288.1| Peptidase M23 [Ferrimonas balearica DSM 9799]
          Length = 432

 Score =  342 bits (878), Expect = 7e-92,   Method: Composition-based stats.
 Identities = 93/420 (22%), Positives = 163/420 (38%), Gaps = 22/420 (5%)

Query: 225 NQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHN 284
               T+    P        H        +   E  T+    +   + PE       +Q  
Sbjct: 23  TLLVTIALLLPSGKSLAARHSDPIPLATRQALE-FTLPPVAIEASQ-PELDWQRFEVQSG 80

Query: 285 TTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHK 344
            ++      AG S      I++  +    + ++   +++ +G         + +      
Sbjct: 81  DSLARLFDRAGLSPQTLYAISQLPQAGKSLTRIMPGQMIELGFAS----GELAQLRYQID 136

Query: 345 QKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLV 404
            +  L ++   +          +  ++ +    R    S  I    W A    G++ N +
Sbjct: 137 AQRTLVVSAEGDG--------YQEQLDEKAVEKREFFASAEITSNFWNAAVDAGLSPNQI 188

Query: 405 KLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFL 464
             +       V+    ++  D     +  ++ + Q + D ++L           R  R+ 
Sbjct: 189 MRLAEIFGWDVDFALDIRSGDHFAVLYEQDYIDGQYAGDGDILVAEFTNQGDTFRAVRYS 248

Query: 465 NPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRG 523
           +       Y+++ G + R   LR PV F  ++S F  R  HP+ G  R H G D+ AP G
Sbjct: 249 DGN-----YYDDKGNAMRKAFLRAPVQFNYVSSNFNPRRLHPVTGKVRPHRGTDYVAPVG 303

Query: 524 TPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGW 583
           TPI+A GDG V  + +    G    I H N YV+ Y H     + ++ G  VKQGQ IG 
Sbjct: 304 TPIMAAGDGTVIASTYNNLNGHYVFIQHSNTYVTKYLHLSK--RLVRKGQRVKQGQTIGR 361

Query: 584 IGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGEN 643
           +G TG  TGPHLHYE +VNG+  +   V++PE   +       F    +   + L + +N
Sbjct: 362 LGGTGRVTGPHLHYEFLVNGVHRNPRTVKLPESRPIANSERDAFTKLARERLAQLAHRQN 421


>gi|157803840|ref|YP_001492389.1| hypothetical protein A1E_03345 [Rickettsia canadensis str. McKiel]
 gi|157785103|gb|ABV73604.1| hypothetical protein A1E_03345 [Rickettsia canadensis str. McKiel]
          Length = 457

 Score =  342 bits (878), Expect = 7e-92,   Method: Composition-based stats.
 Identities = 102/383 (26%), Positives = 183/383 (47%), Gaps = 6/383 (1%)

Query: 259 RTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLT 318
            T+  P  + ++   F +  + ++   TI   ++       +  KI   +K+      L 
Sbjct: 56  ITLVQPDSIEEETISFKE--VVVKKGDTIKSILIEQNIPKNEIEKIINLVKDGKLSSSLK 113

Query: 319 KDEILRIGVVQKDDKFTIVRFSIYHK--QKHLLTIALNDNNEYVLGVEPVKMDINHQMDY 376
             + +      K ++      +       K ++ I      E +   +  K++       
Sbjct: 114 IGQHITFEYETKINENEDEDLTSEVTFLNKIVIIIDKLKTIEVIRESDNFKVEEIVVPLN 173

Query: 377 MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNH- 435
            + ++ S +I      A    G+++N +  ++   A  ++ Q  +K  D +         
Sbjct: 174 KKVAKASVSIESNFMSALKKLGLSNNSIIELINAYAYQIDFQRQIKSGDTVTVITEKYVT 233

Query: 436 ANNQASDDSELLYIHARFGETRTRFYRFL-NPVDGSVEYFNENGKSSRPFLLRTPVPFGR 494
            + + S   ++LY+           YR+  N    +  +F+E+GKS +  LL+TP+   +
Sbjct: 234 EDGKFSHHGKILYVSLNLSGKEYNIYRYSHNNNANNHAFFSEDGKSVKRSLLKTPLKVIK 293

Query: 495 MTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNG 554
           ++S +G R HPILGY++MH GVD+AAP GTPI + G+G++ +  W  GYGK   + H   
Sbjct: 294 VSSHYGNRKHPILGYTKMHKGVDFAAPVGTPIYSAGNGVITEIGWKSGYGKFIQVKHSGT 353

Query: 555 YVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIP 614
             ++Y H    AKN+K G+ VKQGQII ++G+TG +TGPHLHYE+ ++G  V+   V+  
Sbjct: 354 LSTAYAHASNFAKNLKVGSIVKQGQIIAYVGSTGRATGPHLHYEVKIDGKHVNPMSVKTT 413

Query: 615 ERENLKGDLLQRFAMEKKRINSL 637
               L G  L++F   K+ I +L
Sbjct: 414 PGIELNGKNLEKFQQFKQEIKTL 436


>gi|238650904|ref|YP_002916760.1| hypothetical protein RPR_05740 [Rickettsia peacockii str. Rustic]
 gi|238625002|gb|ACR47708.1| hypothetical protein RPR_05740 [Rickettsia peacockii str. Rustic]
          Length = 454

 Score =  342 bits (878), Expect = 8e-92,   Method: Composition-based stats.
 Identities = 101/383 (26%), Positives = 177/383 (46%), Gaps = 6/383 (1%)

Query: 259 RTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLT 318
            T+  P    ++   F +  + ++   TI   ++       +  KI   +K       L 
Sbjct: 56  ITLVQPDSSEEETISFKE--VVVKKGDTIKSILIEQHIPKNEIDKIVSLIKEGKLSSALK 113

Query: 319 KDEILRIGVVQKDDKFTIVRFSIYHK--QKHLLTIALNDNNEYVLGVEPVKMDINHQMDY 376
             + +      K  +      +       K ++ I      E +   +  K++       
Sbjct: 114 IGQQITFEYETKIIENEDEDLTSEVAFLNKIVIIIDKLKTIEVIREGDNFKVEEIVVPLN 173

Query: 377 MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNH- 435
            + ++ S +I      A    G++ N +  ++   A  ++ Q  +K  D           
Sbjct: 174 KKVAKSSVSIEANFMSALKKLGLSDNSIIELINAYAYQIDFQRQIKSGDTATVIMEKYVT 233

Query: 436 ANNQASDDSELLYIHARFGETRTRFYRF-LNPVDGSVEYFNENGKSSRPFLLRTPVPFGR 494
            + + S   ++LY+           YR+  +    +  +F+E+GKS +  LL+TP+   +
Sbjct: 234 EDGKFSHHGKILYVSLNLSGKEYNIYRYSHDNNANNHAFFSEDGKSVKRSLLKTPLKVIK 293

Query: 495 MTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNG 554
           ++S +G R HPILGY++MH GVD+AAP GTPI + G+G++ +  W  GYGK   + H   
Sbjct: 294 VSSHYGNRKHPILGYTKMHRGVDFAAPTGTPIYSAGNGVITEIGWKSGYGKFIQVKHSGT 353

Query: 555 YVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIP 614
             ++Y H    AKN+K G+ VKQGQII ++G+TG +T PHLHYE+ ++G  V+   V+  
Sbjct: 354 LSTAYAHASNFAKNLKVGSIVKQGQIIAYVGSTGRATAPHLHYEVKIDGKHVNPMSVKTT 413

Query: 615 ERENLKGDLLQRFAMEKKRINSL 637
               L G  L++F   KK I +L
Sbjct: 414 PGIELNGKNLEKFKQFKKEIKTL 436


>gi|15892480|ref|NP_360194.1| hypothetical protein RC0557 [Rickettsia conorii str. Malish 7]
 gi|15619637|gb|AAL03095.1| unknown [Rickettsia conorii str. Malish 7]
          Length = 476

 Score =  342 bits (878), Expect = 8e-92,   Method: Composition-based stats.
 Identities = 101/383 (26%), Positives = 177/383 (46%), Gaps = 6/383 (1%)

Query: 259 RTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLT 318
            T+  P    ++   F +  + ++   TI   ++       +  KI   +K       L 
Sbjct: 78  ITLVQPDSSEEETISFKE--VVVKKGDTIKSILIEQHIPKNEIDKIVSLIKEGKLSSALK 135

Query: 319 KDEILRIGVVQKDDKFTIVRFSIYHK--QKHLLTIALNDNNEYVLGVEPVKMDINHQMDY 376
             + +      K  +      +       K ++ I      E +   +  K++       
Sbjct: 136 IGQQITFEYETKIIENEDEDLTSEVAFLNKIVIIIDKLKTIEVIREGDNFKVEEIVVPLS 195

Query: 377 MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNH- 435
            + ++ S +I      A    G++ N +  ++   A  ++ Q  +K  D           
Sbjct: 196 KKVAKSSVSIEANFMSALKKLGLSDNSIIELINAYAYQIDFQRQIKRGDTATVITEKYVT 255

Query: 436 ANNQASDDSELLYIHARFGETRTRFYRF-LNPVDGSVEYFNENGKSSRPFLLRTPVPFGR 494
            + + S   ++LY+           YR+  +    +  +F+E+GKS +  LL+TP+   +
Sbjct: 256 EDGKFSHHGKILYVSLNLSGKEYNIYRYSHDNNANNHAFFSEDGKSVKRSLLKTPLKVIK 315

Query: 495 MTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNG 554
           ++S +G R HPILGY++MH GVD+AAP GTPI + G+G++ +  W  GYGK   + H   
Sbjct: 316 VSSHYGNRKHPILGYTKMHRGVDFAAPTGTPIYSAGNGVITEIGWKSGYGKFIQVKHSGT 375

Query: 555 YVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIP 614
             ++Y H    AKN+K G+ VKQGQII ++G+TG +T PHLHYE+ ++G  V+   V+  
Sbjct: 376 LSTAYAHASNFAKNLKVGSIVKQGQIIAYVGSTGRATAPHLHYEVKIDGKHVNPMSVKTT 435

Query: 615 ERENLKGDLLQRFAMEKKRINSL 637
               L G  L++F   KK I +L
Sbjct: 436 PGIELNGKNLEKFKQFKKEIKTL 458


>gi|269966930|ref|ZP_06181002.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
 gi|269828413|gb|EEZ82675.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
          Length = 430

 Score =  342 bits (878), Expect = 9e-92,   Method: Composition-based stats.
 Identities = 93/408 (22%), Positives = 167/408 (40%), Gaps = 21/408 (5%)

Query: 234 DPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEF-ADDLIPIQHNTTIFDAMV 292
            P   D           +   +  +  +++       +P     +   +++  +      
Sbjct: 30  LPDPQDLDPQQSRLKVGQHYPVPVSLELSALNSSSPAVPAVLRWETYKVKNGESAAILFS 89

Query: 293 HAGYSNGDSAKIAKALKNEVR-VDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTI 351
             G S     ++  + K   + + +L   + L+ G  + +D   + R             
Sbjct: 90  RVGLSARLLHELVSSDKEVEKQLTRLRPGDRLQFGFDENNDLVQLRRTL----SAFETFR 145

Query: 352 ALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTL 411
               + +YV  V+  ++D          +     I    W A   +G+N N +  +    
Sbjct: 146 ITLKDGKYVSEVDKKEVDFQ-------YNYAEATIKSNFWNAGISSGLNGNQIMELAGIF 198

Query: 412 ASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSV 471
              ++    ++  D     +       +     +++    +                 S 
Sbjct: 199 GWDIDFALDIRKNDSFRVLYQEEVVEGEVIGRGKIIAAIFKNQGDTFTAIL----DQKSG 254

Query: 472 EYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVG 530
           +Y++ENG++ +   LR P+ F R++S F  R  HP+ G  R H G D+AAP GTPI A G
Sbjct: 255 KYYDENGRAMKKAFLRAPLDFRRVSSNFNPRRLHPVTGRVRPHRGTDYAAPVGTPIWAAG 314

Query: 531 DGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLS 590
           DG+V+K+++    G    I H N Y++ Y H     + ++AG  VKQGQ IG +G TG  
Sbjct: 315 DGVVQKSSYNKFNGNYVFIKHSNTYITKYLHLTK--RTVRAGQRVKQGQTIGTLGGTGRV 372

Query: 591 TGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAME-KKRINSL 637
           TGPHLHYE +VNG+  +   V +P+ ++L G   Q F    K  ++ L
Sbjct: 373 TGPHLHYEFLVNGVHKNPRTVNLPQSKSLTGKARQTFMANAKISMDKL 420


>gi|117619145|ref|YP_857618.1| cell wall endopeptidase [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
 gi|117560552|gb|ABK37500.1| cell wall endopeptidase, family M23/M37 [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
          Length = 436

 Score =  342 bits (877), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 91/410 (22%), Positives = 156/410 (38%), Gaps = 20/410 (4%)

Query: 234 DPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVH 293
             Q +  R D         + ++E   +   + +    P +    + ++    +      
Sbjct: 33  SEQAVATRVDDNGNELAMEQQVDEEALLAEAKPVAPPKPSYITKQVKVRSGDNMGVIFQR 92

Query: 294 AGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIAL 353
            G S  D   +   L+    +  L   + L   + +  +  ++     Y           
Sbjct: 93  LGLSTTDLH-LIDQLEGTDTLRLLKPGQELTFKLTKGGELHSL----YYPHSLEQALKVS 147

Query: 354 NDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLAS 413
              + +V     +++D        R       I    W A    GM  + +  +      
Sbjct: 148 RKADSFVARPVKLELD-------TREQVAKGEIRSSFWGAAVDAGMTEDQIMDLAAIFGW 200

Query: 414 SVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEY 473
            ++  + L+P D     +   + +++     ++L           R     +       Y
Sbjct: 201 DIDFAQDLQPGDSFRVVYEEKYQDDERVASGDILAAEFVNQGATYRAVLNEDGN-----Y 255

Query: 474 FNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDG 532
           +  +GK+ R   LR PV F  ++S F  R  HP+ G  R H G+D+ AP GTPI+A G G
Sbjct: 256 YTPDGKAMRKSFLRAPVNFKYISSNFNPRRLHPVTGKVRPHNGIDYVAPVGTPIMAAGSG 315

Query: 533 IVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTG 592
            V  A +    G    I H   YV+ Y H     + +  G  VKQGQ IG +G TG  TG
Sbjct: 316 SVVAAGYNQFNGNYVFIKHAGNYVTKYLHLSK--RTVNKGQRVKQGQTIGNLGGTGRVTG 373

Query: 593 PHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGE 642
           PHLHYE +V G+  +   + +P+ E L G  L  F  +     + L++ E
Sbjct: 374 PHLHYEFVVGGVHKNPRTLNLPQAETLSGRALASFKAQAMPQLAKLDSPE 423


>gi|262274958|ref|ZP_06052769.1| hypothetical membrane protein [Grimontia hollisae CIP 101886]
 gi|262221521|gb|EEY72835.1| hypothetical membrane protein [Grimontia hollisae CIP 101886]
          Length = 422

 Score =  342 bits (877), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 96/422 (22%), Positives = 164/422 (38%), Gaps = 29/422 (6%)

Query: 236 QTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDK---IPEFADDLIPIQHNTTIFDAMV 292
           +T     +      K+  I  +  ++  P+                  +Q   ++     
Sbjct: 16  ETPAPHPEARFEVGKQYPIPLDTLSLLPPESEQQPMTAFAPLEWHKFKVQAGDSLAVIFD 75

Query: 293 HAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIA 352
             G S     ++  + K    +  L   + + +G  +      +    I  K  +   I 
Sbjct: 76  RVGISPTTLYRLINSDKGTKSLASLKVGDEIHLGFDENGLFTQL----IQPKSANEKLIV 131

Query: 353 LNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLA 412
               +++    E +++D        + +  S  I    W A    G+N+N +  +     
Sbjct: 132 TRIGDKFFSKTESIQID-------TQVNFASATITSSFWNAGVSAGLNANQIMELAGIFG 184

Query: 413 SSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVE 472
             ++    ++  D     F       +      +L              R  N       
Sbjct: 185 WDIDFALDIRQGDKFSVLFEEQLVEGELIGRGNILAATFTNQGETFTAIRAENGK----- 239

Query: 473 YFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGD 531
           Y++E G++ R   LR+PV F  ++S F  R  HP+ G  R H G D+ AP GTPI A GD
Sbjct: 240 YYDEKGRAMRKAFLRSPVNFRYVSSNFNPRRLHPVTGRVRAHRGTDYVAPVGTPIWAAGD 299

Query: 532 GIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLST 591
           GIV K+ +    G    I H + Y++ Y H     + +K G  VKQGQ IG +G TG  T
Sbjct: 300 GIVMKSAYNKFNGHYVFIRHSSTYITKYLHLTK--RKVKTGQRVKQGQTIGTLGGTGRVT 357

Query: 592 GPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAM-------EKKRINSLLNNGENP 644
           GPHLHYE +VNG+  +   V++PE ++L G     F         +  ++  LL +    
Sbjct: 358 GPHLHYEFLVNGVHKNPRTVQLPEAKSLAGKEKTAFMALAKDRMTQLNKLAQLLASIGTL 417

Query: 645 KK 646
           ++
Sbjct: 418 ER 419


>gi|88858217|ref|ZP_01132859.1| putative peptidase, M23/M37 family protein [Pseudoalteromonas
           tunicata D2]
 gi|88819834|gb|EAR29647.1| putative peptidase, M23/M37 family protein [Pseudoalteromonas
           tunicata D2]
          Length = 445

 Score =  342 bits (877), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 88/383 (22%), Positives = 161/383 (42%), Gaps = 18/383 (4%)

Query: 262 TSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDE 321
           T+    +   PE       ++    +      AG+S     K+     +   + ++   E
Sbjct: 73  TATVEPVALAPEITYKAFTVKTGDNLAIIFKRAGFSAQTLYKLINLNDDTHSLTKIHPGE 132

Query: 322 ILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSE 381
           +L +     + +  +        Q   L ++L++NN+ +  ++  ++         R   
Sbjct: 133 VLYLA---SNQQKELSHLKYQINQTDTLLVSLDENNQLISHIDSKQI-------ETRNQI 182

Query: 382 ESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQAS 441
            +  I    W A    G+    +          ++    ++  D     +   +   +  
Sbjct: 183 TAGQIKTNFWNAGIEAGLTEKQIMNFADIFGWDIDFANDIRTNDQFVLIYETKYIEGEYI 242

Query: 442 DDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGM 501
              E++              R  +       Y+   G+S R   LR PV F  ++S F  
Sbjct: 243 GTGEVIAAEFINQGEHFAAVRHDDGN-----YYTPEGRSMRKAFLRAPVNFKYISSSFNP 297

Query: 502 RY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYN 560
           +  HP+ G  + H G+D+AA  GTP++A G+G V ++ ++   G    I HG+ YV+ Y 
Sbjct: 298 KRKHPVTGQVKAHRGIDYAAKTGTPVMASGNGKVIESGYSKYNGNYVFIQHGSQYVTKYL 357

Query: 561 HQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLK 620
           H     +N+K+GT VKQGQIIG +G TG  TG HLHYE +VNG+  +   V +P+ E+L 
Sbjct: 358 HLHK--RNVKSGTKVKQGQIIGTVGATGRVTGAHLHYEFLVNGVHRNPKTVALPKSESLA 415

Query: 621 GDLLQRFAMEKKRINSLLNNGEN 643
            + L  F      + + L++  +
Sbjct: 416 KNELATFKPYADTLIAQLSSKRD 438


>gi|313676002|ref|YP_004053998.1| peptidase m23 [Marivirga tractuosa DSM 4126]
 gi|312942700|gb|ADR21890.1| Peptidase M23 [Marivirga tractuosa DSM 4126]
          Length = 432

 Score =  342 bits (877), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 99/374 (26%), Positives = 163/374 (43%), Gaps = 13/374 (3%)

Query: 274 FADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDK 333
           F  +   ++ N +I D ++    S+    ++A   KN   V ++  ++   +   ++D  
Sbjct: 61  FQVEEHAVKRNQSISDILLAYNVSHQTIFQLANLSKNVFDVRKIAPNKKYTVIYQEEDSF 120

Query: 334 FTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRA 393
            +          +  +   L D+         +K+ +  +   +     S  I   ++  
Sbjct: 121 PSAKALVYEPNPEEYVVFNLKDS---------IKVYVEKRPVTIEEKSISGTISSSLYEE 171

Query: 394 TSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARF 453
              NG    LV L+       ++  + + P D  +  +     +       E++      
Sbjct: 172 ILNNGGTPELVDLVADMYGWQIDFTK-IYPGDQFKVLYRERVIDGTPVGIEEIIGAELVH 230

Query: 454 GETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRM 512
                            V+YF+E GKS R   LR PV F R++S +  +  HP+    + 
Sbjct: 231 YNNPFLSI--AFDQGDGVDYFDEEGKSLRKAFLRYPVKFTRISSRYTAKRYHPVQKRYKA 288

Query: 513 HTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAG 572
           H G D+AAP GTPI A GDG++ KA +    G+   I H   Y + Y H   IA  I+ G
Sbjct: 289 HLGTDYAAPNGTPIYAAGDGVITKAQYEKYNGRNVKIRHNATYSTQYLHMSRIASGIRPG 348

Query: 573 TAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKK 632
             VKQGQ+IG++G+TGL+TGPHL Y    NG +VD+ KV +P  E +K D L  F   K 
Sbjct: 349 GKVKQGQLIGYVGSTGLATGPHLCYRFWKNGRQVDAMKVDLPPSEPIKEDYLSNFNRYKG 408

Query: 633 RINSLLNNGENPKK 646
            + S L+    P+ 
Sbjct: 409 FVKSKLDKIPYPES 422


>gi|54401382|gb|AAV34476.1| predicted peptidase, m23/m37 family [uncultured proteobacterium
           RedeBAC7D11]
          Length = 430

 Score =  342 bits (877), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 83/396 (20%), Positives = 165/396 (41%), Gaps = 14/396 (3%)

Query: 247 TYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAK 306
                     +  T+   Q         +   I +  N T+   +      +     + K
Sbjct: 40  PEIIADASFRDEITLQENQSEQIFKGALSKK-IKVDKNDTLIKILSSNEVESKYIKALIK 98

Query: 307 ALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPV 366
             K   ++  +   +I+ I   +      I +     +      +A   +  Y       
Sbjct: 99  T-KGSEKLANIKTGDIVEISFTEN----KIPKEIFVTRNGLKGVLAEFKDKTY------- 146

Query: 367 KMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDF 426
            ++ + ++  +     S  I + ++++    G++ +++  ++      ++    ++  D 
Sbjct: 147 SIENHERIPEVIERFASVTIDESLYQSALKEGISDSVIMDLVFIFGWDIDFVFDIRSGDS 206

Query: 427 LETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLL 486
            E  +       +   + ++     + G+      RF + V G+ EYF+  G++ +   L
Sbjct: 207 FEILYEEYFYKGEKIKNGDIKAARFKRGKKVFSAIRFFSNVSGTKEYFSTRGENVKKAFL 266

Query: 487 RTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGK 545
           RTPV F  ++S + ++  HP+L   R HTGVD+AAP GTP+ +   G V      GGYGK
Sbjct: 267 RTPVEFSYISSRYNLKRKHPVLNKIRAHTGVDYAAPTGTPVRSTSSGTVSFIGNKGGYGK 326

Query: 546 QTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIK 605
              + H   Y + Y H       +  G+ V+QG+ IG++G TGL+TGPHLHYE  V G  
Sbjct: 327 LIEVKHSEDYSTRYAHLSKFNPRLSNGSKVEQGETIGYVGQTGLATGPHLHYEFRVGGKH 386

Query: 606 VDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNG 641
            +   V++P+ + +     + F     ++ + L+  
Sbjct: 387 TNPLTVKLPDAKPISEVEKKEFFDHAIKMINRLDEL 422


>gi|297180641|gb|ADI16851.1| membrane proteins related to metalloendopeptidases [uncultured
           alpha proteobacterium HF0010_13E22]
          Length = 460

 Score =  342 bits (876), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 116/428 (27%), Positives = 188/428 (43%), Gaps = 23/428 (5%)

Query: 211 NAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDK 270
             + +    L   K     LY A+P  +      P   +   +     RT+    +    
Sbjct: 31  EPVRSDGMPLPQSKPDLALLYPAEPVEISLPVPRPDPQTILPRA---TRTVAEMYLRQTG 87

Query: 271 IPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQK 330
                D L  +++   +   +  AGY   D A    A+     +  L     +R+     
Sbjct: 88  TETGKDALYTLKNGEGLGKLLRRAGYEATDVAAAVDAVSGRASLRALPVGLDVRVTDGGF 147

Query: 331 DDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGI 390
                  R            +A +                  +      S     I D I
Sbjct: 148 AFTTRNGRDIFAIDDPEEGWVAFS----------------AIRPVERYLSFAQGVINDSI 191

Query: 391 WRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHA--NNQASDDSELLY 448
           +RA + + +  + +   +R +  SV+ Q  ++  D  E  +       + +     +L Y
Sbjct: 192 YRAAADSNIPDDALAEYVRIMGFSVDFQREIRSGDAFELLYEQQIDQISGEKIAT-KLHY 250

Query: 449 IHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILG 508
                  ++  FYRF +     V +++ NG S+   L+RTP+   R++S +GMR HPI G
Sbjct: 251 AGLMLSGSQLGFYRF-DHDGSRVGWYDRNGNSAARTLIRTPISGARLSSSYGMRKHPISG 309

Query: 509 YSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKN 568
           Y+RMH GVD+AAP GTPI+A G G+V K+ W G YG+   I H + Y ++Y H   IA+ 
Sbjct: 310 YNRMHKGVDFAAPTGTPIIAAGSGVVTKSGWLGSYGRYIRIRHNSTYDTAYAHMSRIARG 369

Query: 569 IKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFA 628
           I  G  V+QGQIIG++G++G STGPHLHYE++VN  KV+   V +P  E +  +LL+ F 
Sbjct: 370 ITPGRRVEQGQIIGYVGSSGRSTGPHLHYEILVNNRKVNPLTVSLPTGEKIPAELLEDFR 429

Query: 629 MEKKRINS 636
            +   + +
Sbjct: 430 NQVDLVEA 437


>gi|88797573|ref|ZP_01113162.1| metalloendopeptidase-like membrane protein [Reinekea sp. MED297]
 gi|88779745|gb|EAR10931.1| metalloendopeptidase-like membrane protein [Reinekea sp. MED297]
          Length = 432

 Score =  342 bits (876), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 85/398 (21%), Positives = 165/398 (41%), Gaps = 14/398 (3%)

Query: 243 DHPITYSKKIKI-IEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDS 301
               +  + + + +     +  P+ ++++ P ++     +Q   T+      AG      
Sbjct: 31  ALWPSQGQSVVVEVPAQIVVPEPEEVVEQAPGYSVTEE-VQSGDTLSSVFERAGAGVSIL 89

Query: 302 AKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVL 361
            ++      +  ++++   +          D+  +V+ +          I ++++     
Sbjct: 90  YRLIANDDIKKPIEKIFPGQEFTFKFD---DQDALVQVNFNATPLLSYQIDIDED----- 141

Query: 362 GVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHL 421
             +  ++    +   + T   +  I D ++ A    G++ N++  +       ++    +
Sbjct: 142 --KNGQISKLEKTPEIHTKYATARIDDSLFMAGMEAGLSDNMIMQLATIFGWDIDFVLDI 199

Query: 422 KPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSS 481
           +  D     +  N+ + +   D  ++              R+ +      +YF  NG S 
Sbjct: 200 REGDEFSLLYEENYLDGEKLSDGPIIAARFMNRGREITAIRYTDESG-RTDYFAPNGDSM 258

Query: 482 RPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWA 540
           R   LRTP+   R++S F     HP+L     H G D+AAP GTPI A GDG + KA ++
Sbjct: 259 RKAFLRTPMDVFRISSSFNPNRRHPVLNKIVAHKGTDYAAPVGTPIKATGDGKIIKAYYS 318

Query: 541 GGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELI 600
             YG   +I HG G  + Y H    +K  + G  +KQGQ+IG++G TG  TG HLHYE  
Sbjct: 319 STYGNVVIIQHGAGIRTLYAHMSKFSKYSRVGNRIKQGQVIGYVGATGRVTGAHLHYEFQ 378

Query: 601 VNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLL 638
           V+G+  +   V +P  + L  + L  F      +   L
Sbjct: 379 VHGVHKNPQTVDLPNAQPLATEYLGDFEQYASNVVGQL 416


>gi|157825685|ref|YP_001493405.1| hypothetical protein A1C_03035 [Rickettsia akari str. Hartford]
 gi|157799643|gb|ABV74897.1| hypothetical protein A1C_03035 [Rickettsia akari str. Hartford]
          Length = 444

 Score =  342 bits (876), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 99/383 (25%), Positives = 179/383 (46%), Gaps = 6/383 (1%)

Query: 259 RTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLT 318
            T+  P    ++   F +  + ++   TI   ++       +  KI   +K       L 
Sbjct: 56  ITLVQPDSDEEETISFKE--VVVKKGDTIKSILIEQHIPKNEIEKIVSLIKERKLSSALK 113

Query: 319 KDEILRIGVVQKDDKFTIVRFSIYHK--QKHLLTIALNDNNEYVLGVEPVKMDINHQMDY 376
             + +      K  +      +   K   K ++ +      + +   +  K++       
Sbjct: 114 IGQQITFEYETKITENEHEDLTSEVKFLNKIIIIVDKLKTIQLIRENDNFKVEEIIVPLT 173

Query: 377 MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNH- 435
            + ++ S NI      A    G+++N +  ++   A  ++ Q  +K  D           
Sbjct: 174 KKIAKSSVNIESNFMSALKKLGLSNNSIIELINAYAYQIDFQRQIKSGDTATVIMEQYVT 233

Query: 436 ANNQASDDSELLYIHARFGETRTRFYRF-LNPVDGSVEYFNENGKSSRPFLLRTPVPFGR 494
            + + S   ++LY+           YR+  +    +  +F+E+GKS +  LL+TP+   +
Sbjct: 234 EDGKFSHHGKILYVSLNLSGKEYNIYRYSHDNNANNHAFFSEDGKSVKRSLLKTPLKIIK 293

Query: 495 MTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNG 554
           ++S +G R HPILGY++MH GVD+AAP GTPI + G+G++ +  W  GYGK   + H   
Sbjct: 294 VSSHYGNRKHPILGYTKMHKGVDFAAPTGTPIYSAGNGVITEMGWKSGYGKFIQVKHSGT 353

Query: 555 YVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIP 614
             ++Y H    AKN+K G+ VKQGQ+I ++G+TG ++G HLHYE+ ++G  V+   V+  
Sbjct: 354 LSTAYAHASNFAKNLKVGSVVKQGQVIAYVGSTGRASGSHLHYEVKIDGKHVNPMSVKTT 413

Query: 615 ERENLKGDLLQRFAMEKKRINSL 637
               L G  L++F   KK I +L
Sbjct: 414 PGVELNGRNLEKFKQFKKEIKAL 436


>gi|165933144|ref|YP_001649933.1| peptidoglycan-specific endopeptidase, M23 family [Rickettsia
           rickettsii str. Iowa]
 gi|165908231|gb|ABY72527.1| peptidoglycan-specific endopeptidase, M23 family [Rickettsia
           rickettsii str. Iowa]
          Length = 476

 Score =  341 bits (875), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 101/383 (26%), Positives = 176/383 (45%), Gaps = 6/383 (1%)

Query: 259 RTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLT 318
            T+  P    ++   F +  + ++   TI   ++       +  KI   +K       L 
Sbjct: 78  ITLVQPDSSEEETILFKE--VVVKKGDTIKSILIEQHIPKNEIDKIVSLIKEGKLSSALK 135

Query: 319 KDEILRIGVVQKDDKFTIVRFSIYHK--QKHLLTIALNDNNEYVLGVEPVKMDINHQMDY 376
             + +      K  +      +       K ++ I      E +   +  K++       
Sbjct: 136 IGQQITFEYETKIIENEDEDLTSEVAFLNKIVIIIDKLKTIEVIREGDNFKVEEIVVPLN 195

Query: 377 MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNH- 435
              ++ S +I      A    G++ N +  ++   A  ++ Q  +K  D           
Sbjct: 196 KTVAKSSVSIEANFMSALKKLGLSDNSIIELINAYAYQIDFQRQIKSGDTATVITEKYVT 255

Query: 436 ANNQASDDSELLYIHARFGETRTRFYRF-LNPVDGSVEYFNENGKSSRPFLLRTPVPFGR 494
            + + S   ++LY+           YR+  +    +  +F+E+GKS +  LL+TP+   +
Sbjct: 256 EDGKFSHHGKILYVSLNLSGKEYNIYRYSHDNNANNHAFFSEDGKSVKRSLLKTPLKVIK 315

Query: 495 MTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNG 554
           ++S +G R HPILGY++MH GVD+AAP GTPI + G+G++ +  W  GYGK   + H   
Sbjct: 316 VSSHYGNRKHPILGYTKMHRGVDFAAPTGTPIYSAGNGVITEIGWKSGYGKFIQVKHSGT 375

Query: 555 YVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIP 614
             ++Y H    AKN+K G+ VKQGQII ++G+TG +T PHLHYE+ ++G  V+   V+  
Sbjct: 376 LSTAYAHASNFAKNLKVGSIVKQGQIIAYVGSTGRATAPHLHYEVKIDGKHVNPMSVKTT 435

Query: 615 ERENLKGDLLQRFAMEKKRINSL 637
               L G  L++F   KK I +L
Sbjct: 436 PGIELNGKNLEKFKQFKKEIKTL 458


>gi|157828432|ref|YP_001494674.1| hypothetical protein A1G_03145 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|157800913|gb|ABV76166.1| hypothetical protein A1G_03145 [Rickettsia rickettsii str. 'Sheila
           Smith']
          Length = 454

 Score =  341 bits (875), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 101/383 (26%), Positives = 176/383 (45%), Gaps = 6/383 (1%)

Query: 259 RTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLT 318
            T+  P    ++   F +  + ++   TI   ++       +  KI   +K       L 
Sbjct: 56  ITLVQPDSSEEETILFKE--VVVKKGDTIKSILIEQHIPKNEIDKIVSLIKEGKLSSALK 113

Query: 319 KDEILRIGVVQKDDKFTIVRFSIYHK--QKHLLTIALNDNNEYVLGVEPVKMDINHQMDY 376
             + +      K  +      +       K ++ I      E +   +  K++       
Sbjct: 114 IGQQITFEYETKIIENEDEDLTSEVAFLNKIVIIIDKLKTIEVIREGDNFKVEEIVVPLN 173

Query: 377 MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNH- 435
              ++ S +I      A    G++ N +  ++   A  ++ Q  +K  D           
Sbjct: 174 KTVAKSSVSIEANFMSALKKLGLSDNSIIELINAYAYQIDFQRQIKSGDTATVITEKYVT 233

Query: 436 ANNQASDDSELLYIHARFGETRTRFYRF-LNPVDGSVEYFNENGKSSRPFLLRTPVPFGR 494
            + + S   ++LY+           YR+  +    +  +F+E+GKS +  LL+TP+   +
Sbjct: 234 EDGKFSHHGKILYVSLNLSGKEYNIYRYSHDNNANNHAFFSEDGKSVKRSLLKTPLKVIK 293

Query: 495 MTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNG 554
           ++S +G R HPILGY++MH GVD+AAP GTPI + G+G++ +  W  GYGK   + H   
Sbjct: 294 VSSHYGNRKHPILGYTKMHRGVDFAAPTGTPIYSAGNGVITEIGWKSGYGKFIQVKHSGT 353

Query: 555 YVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIP 614
             ++Y H    AKN+K G+ VKQGQII ++G+TG +T PHLHYE+ ++G  V+   V+  
Sbjct: 354 LSTAYAHASNFAKNLKVGSIVKQGQIIAYVGSTGRATAPHLHYEVKIDGKHVNPMSVKTT 413

Query: 615 ERENLKGDLLQRFAMEKKRINSL 637
               L G  L++F   KK I +L
Sbjct: 414 PGIELNGKNLEKFKQFKKEIKTL 436


>gi|332304970|ref|YP_004432821.1| Peptidase M23 [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332172299|gb|AEE21553.1| Peptidase M23 [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 432

 Score =  341 bits (875), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 91/420 (21%), Positives = 171/420 (40%), Gaps = 18/420 (4%)

Query: 225 NQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHN 284
                L+ +D  +  +  +  +    K   +  +    S     +   E       ++  
Sbjct: 24  VLILALFPSDRASASRNTEAALLEIGKRYELPISTEHLSTDNQSELSDELEWKTFQVKRG 83

Query: 285 TTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHK 344
            T+      AG S  D+  ++ A     ++ ++   +++ + + +  +          + 
Sbjct: 84  DTLAKIFARAGLSARDTYNVSSAGDLAKKLLKIRPGQLVSLQLGEHGE---FAGLEYAYS 140

Query: 345 QKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLV 404
               L I  N+  + V  V+   +D        R +     I    W A     ++ + +
Sbjct: 141 NTETLLIKPNEAGKLVSSVDKKTVD-------TRLNYAQGEINSSFWNAGVKAHLSESQI 193

Query: 405 KLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFL 464
             +       ++    ++  D     F   + + +  +  +++      G       R+ 
Sbjct: 194 MSLAAIFGWDIDFALEIRQGDNFNVVFEEKYIDGEFVEYGDIVSAEFTNGGNTFTAIRYS 253

Query: 465 NPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRG 523
           +       Y+   G+S R   LR PV F  ++S F  R  HP+    + H GVD+AA RG
Sbjct: 254 DGN-----YYTPEGRSMRKSFLRAPVSFKYISSSFTKRRFHPVQKRWKAHRGVDYAANRG 308

Query: 524 TPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGW 583
           TP++A GDG V ++++    G    I HG  YV+ Y H     + +K G  VKQG IIG 
Sbjct: 309 TPVMAAGDGKVIRSSYDKYNGNHVFIQHGEKYVTKYLHFTK--RKVKVGQTVKQGDIIGT 366

Query: 584 IGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGEN 643
           +G+TGL++GPHLHYE +V+G+  +   V +P+   +       F +  K    LL+N + 
Sbjct: 367 VGSTGLASGPHLHYEFLVDGVHRNPRTVSLPKALPIDKKERSAFELVAKEQLELLSNSKR 426


>gi|297172782|gb|ADI23747.1| membrane proteins related to metalloendopeptidases [uncultured
           Rhodospirillales bacterium HF4000_38H21]
          Length = 433

 Score =  341 bits (875), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 93/445 (20%), Positives = 196/445 (44%), Gaps = 17/445 (3%)

Query: 211 NAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITY-SKKIKIIEENRTITSPQVLID 269
            A  +   ++        T  Y          D  ++  + + +   E+ T T+      
Sbjct: 1   MAGRDLASIVTVMAILGGTAGYLLSDHYSNATDTALSASAAETQHSVESITETASIPDQT 60

Query: 270 KIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGV-- 327
              E     + ++  + +   +  +G     +    +AL++     +L   +   +    
Sbjct: 61  PRHET----VVLEQGSNLMAVLTASGLERTIAYDAIEALRDVYNPRKLRAGQEFELVYSG 116

Query: 328 VQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIY 387
             +D    +   S     + +++++  D+  +    + +++           +  +  I 
Sbjct: 117 DTQDSYELLDVLSFQPDPETIVSVSRTDDG-FNASSDKIELTTAQ-------NVAAGTIE 168

Query: 388 DGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHAN-NQASDDSEL 446
             ++ A   NG+   ++  ++   +  V+ Q  ++P D  E  +   + +  +     ++
Sbjct: 169 QSLFLAAERNGVPLPVLMEMIELYSYEVDFQRDIQPGDSFEVMYQELNNDAGERVRYGDV 228

Query: 447 LYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPI 506
           +Y          R         G  +++N+ G+S R  L+RTP+   R++SG+G R HP+
Sbjct: 229 IYASMTLSGHEVR-LYSYTDSHGDTDFYNQKGESYRRALMRTPINGARLSSGYGGRKHPV 287

Query: 507 LGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIA 566
           LGY++MH GVD+AAP GTPI A G+G + +      YG    I H + Y ++Y H    A
Sbjct: 288 LGYTKMHKGVDFAAPPGTPIFAAGNGNIARIGPYSSYGNYIRIRHNDSYSTAYAHMTGFA 347

Query: 567 KNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQR 626
           K ++ G+ VKQG +IG++G TG  TGPHLHYE++ + ++V+  ++++P  + LK   L+ 
Sbjct: 348 KGLRQGSRVKQGDVIGYVGATGRVTGPHLHYEILKDNVQVNPMRIKMPSGKMLKDKELET 407

Query: 627 FAMEKKRINSLLNNGENPKKPLFTS 651
           F  + + +           + + ++
Sbjct: 408 FLADAQILRKQYAELSLENRKIASA 432


>gi|153838397|ref|ZP_01991064.1| membrane protein [Vibrio parahaemolyticus AQ3810]
 gi|149748204|gb|EDM59063.1| membrane protein [Vibrio parahaemolyticus AQ3810]
          Length = 422

 Score =  341 bits (875), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 93/407 (22%), Positives = 166/407 (40%), Gaps = 20/407 (4%)

Query: 234 DPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVH 293
            P   D           +   +  +  +T+             +   +++  +       
Sbjct: 23  LPDPQDLNPQQSRLKVGQHYPVPISLELTTLNGASQMSSVLRWETYKVKNGESAAILFNR 82

Query: 294 AGYSNGDSAKIAKALKN-EVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIA 352
            G S     ++  + K  E ++ +L   + L+ G  +K+D   + R              
Sbjct: 83  VGLSARLLHELVSSDKEIEQQLTRLRPGDKLQFGFDEKNDLVQLRRTL----SAFETFRI 138

Query: 353 LNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLA 412
              + +YV        +++ +    + +     I    W A   +G+N N +  +     
Sbjct: 139 KLQDGKYVS-------EVDKKEVDYQFNYAEATIKSNFWNAGISSGLNGNQIMELAGIFG 191

Query: 413 SSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVE 472
             ++    ++  D     +       +     +++    +               + + +
Sbjct: 192 WDIDFALDIRKNDSFRVLYQEEVVEGEVIGRGKIIAAIFKNQGDTFTAIL----DEKTGK 247

Query: 473 YFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGD 531
           Y++ENG++ +   LR P+ F R+TS F  R  HP+ G  R H G D+AAP GTPI A GD
Sbjct: 248 YYDENGRAMKKAFLRAPLDFRRVTSNFNPRRLHPVTGRVRPHRGTDYAAPVGTPIWAAGD 307

Query: 532 GIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLST 591
           G+V+K+ +    G    I H N Y++ Y H     + +K G  VKQGQ IG +G TG  T
Sbjct: 308 GVVQKSAYNKFNGNYVFIKHSNTYITKYLHLTK--RTVKTGQRVKQGQTIGTLGGTGRVT 365

Query: 592 GPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKK-RINSL 637
           GPHLHYE +VNG+  +   V +P+ ++L G   Q F    K  ++ L
Sbjct: 366 GPHLHYEFLVNGVHKNPRTVNLPQSKSLTGKARQTFMANAKVSMDKL 412


>gi|291614905|ref|YP_003525062.1| peptidase M23 [Sideroxydans lithotrophicus ES-1]
 gi|291585017|gb|ADE12675.1| Peptidase M23 [Sideroxydans lithotrophicus ES-1]
          Length = 432

 Score =  341 bits (874), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 85/388 (21%), Positives = 153/388 (39%), Gaps = 14/388 (3%)

Query: 257 ENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQ 316
           E+  + + Q +      F      +Q   T+ + +      +  ++   +  K+   + +
Sbjct: 51  EDIALPTAQPVPSNATSF-WRNDRVQRGDTVAELLRRLNVEDPTASDYLRNNKDAAGLRR 109

Query: 317 LTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDY 376
           L   + ++           +     Y        +     N +     P + +       
Sbjct: 110 LPVGKEVQAETDANGALLALR----YLDGNANQVVIEKSGNGFKTHTLPAQTEK------ 159

Query: 377 MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHA 436
            RT   +  I   ++ AT   G+       +       ++    L+  D     + +N+ 
Sbjct: 160 -RTQIRTGEIETNLFAATDEAGLPDPAANQLSDIFGGDIDFHRDLRKGDKFTVIYEMNYI 218

Query: 437 NNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMT 496
           N +      ++           R   F    + S +Y++ +GKS     LR+P+ F R++
Sbjct: 219 NGEPVRTGRIISAEFINRGHIYRAAYFQT-SENSGDYYSPDGKSMHKAFLRSPLEFSRIS 277

Query: 497 SGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGY 555
           S F     HPIL   R H GVD+AAP GT +    DG+V       GYG   ++ H   +
Sbjct: 278 SVFSKSRFHPILNKWRAHKGVDYAAPIGTKVKVTSDGVVAFVGKQHGYGNVVMVDHQGHF 337

Query: 556 VSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPE 615
            + Y H    A  +  G  V QGQ+I ++G TGL+TGPHLHYE  +NG++ D  KV +P+
Sbjct: 338 TTVYGHLSRFAGGLHKGERVSQGQVIAYVGMTGLATGPHLHYEFRMNGVQRDPLKVALPD 397

Query: 616 RENLKGDLLQRFAMEKKRINSLLNNGEN 643
            + +       F      + + L+   N
Sbjct: 398 GKPISETQQAAFTAATSPLFAELDTFHN 425


>gi|308095254|ref|ZP_05904432.2| membrane protein [Vibrio parahaemolyticus Peru-466]
 gi|308125413|ref|ZP_05775158.2| membrane protein [Vibrio parahaemolyticus K5030]
 gi|308085371|gb|EFO35066.1| membrane protein [Vibrio parahaemolyticus Peru-466]
 gi|308111053|gb|EFO48593.1| membrane protein [Vibrio parahaemolyticus K5030]
          Length = 419

 Score =  341 bits (874), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 93/407 (22%), Positives = 166/407 (40%), Gaps = 20/407 (4%)

Query: 234 DPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVH 293
            P   D           +   +  +  +T+             +   +++  +       
Sbjct: 20  LPDPQDLNPQQSRLKVGQHYPVPISLELTTLNGSSQMSSVLRWETYKVKNGESAAILFNR 79

Query: 294 AGYSNGDSAKIAKALKN-EVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIA 352
            G S     ++  + K  E ++ +L   + L+ G  +K+D   + R              
Sbjct: 80  VGLSARLLHELVSSDKEIEQQLTRLRPGDKLQFGFDEKNDLVQLRRTL----SAFETFRI 135

Query: 353 LNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLA 412
              + +YV        +++ +    + +     I    W A   +G+N N +  +     
Sbjct: 136 KLQDGKYVS-------EVDKKEVDYQFNYAEATIKSNFWNAGISSGLNGNQIMELAGIFG 188

Query: 413 SSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVE 472
             ++    ++  D     +       +     +++    +               + + +
Sbjct: 189 WDIDFALDIRKNDSFRVLYQEEVVEGEVIGRGKIIAAIFKNQGDTFTAIL----DEKTGK 244

Query: 473 YFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGD 531
           Y++ENG++ +   LR P+ F R+TS F  R  HP+ G  R H G D+AAP GTPI A GD
Sbjct: 245 YYDENGRAMKKAFLRAPLDFRRVTSNFNPRRLHPVTGRVRPHRGTDYAAPVGTPIWAAGD 304

Query: 532 GIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLST 591
           G+V+K+ +    G    I H N Y++ Y H     + +K G  VKQGQ IG +G TG  T
Sbjct: 305 GVVQKSAYNKFNGNYVFIKHSNTYITKYLHLTK--RTVKTGQRVKQGQTIGTLGGTGRVT 362

Query: 592 GPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKK-RINSL 637
           GPHLHYE +VNG+  +   V +P+ ++L G   Q F    K  ++ L
Sbjct: 363 GPHLHYEFLVNGVHKNPRTVNLPQSKSLTGKARQTFMANAKVSMDKL 409


>gi|260903447|ref|ZP_05911842.1| membrane protein [Vibrio parahaemolyticus AQ4037]
 gi|308106577|gb|EFO44117.1| membrane protein [Vibrio parahaemolyticus AQ4037]
          Length = 412

 Score =  341 bits (874), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 93/407 (22%), Positives = 166/407 (40%), Gaps = 20/407 (4%)

Query: 234 DPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVH 293
            P   D           +   +  +  +T+             +   +++  +       
Sbjct: 13  LPDPQDLNPQQSRLKVGQHYPVPISLELTTLNGSSQMSSVLRWETYKVKNGESAAILFNR 72

Query: 294 AGYSNGDSAKIAKALKN-EVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIA 352
            G S     ++  + K  E ++ +L   + L+ G  +K+D   + R              
Sbjct: 73  VGLSARLLHELVSSDKEIEQQLTRLRPGDKLQFGFDEKNDLVQLRRTL----SAFETFRI 128

Query: 353 LNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLA 412
              + +YV        +++ +    + +     I    W A   +G+N N +  +     
Sbjct: 129 KLQDGKYVS-------EVDKKEVDYQFNYAEATIKSNFWNAGISSGLNGNQIMELAGIFG 181

Query: 413 SSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVE 472
             ++    ++  D     +       +     +++    +               + + +
Sbjct: 182 WDIDFALDIRKNDSFRVLYQEEVVEGEVIGRGKIIAAIFKNQGDTFTAIL----DEKTGK 237

Query: 473 YFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGD 531
           Y++ENG++ +   LR P+ F R+TS F  R  HP+ G  R H G D+AAP GTPI A GD
Sbjct: 238 YYDENGRAMKKAFLRAPLDFRRVTSNFNPRRLHPVTGRVRPHRGTDYAAPVGTPIWAAGD 297

Query: 532 GIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLST 591
           G+V+K+ +    G    I H N Y++ Y H     + +K G  VKQGQ IG +G TG  T
Sbjct: 298 GVVQKSAYNKFNGNYVFIKHSNTYITKYLHLTK--RTVKTGQRVKQGQTIGTLGGTGRVT 355

Query: 592 GPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKK-RINSL 637
           GPHLHYE +VNG+  +   V +P+ ++L G   Q F    K  ++ L
Sbjct: 356 GPHLHYEFLVNGVHKNPRTVNLPQSKSLTGKARQTFMANAKVSMDKL 402


>gi|28899245|ref|NP_798850.1| hypothetical protein VP2471 [Vibrio parahaemolyticus RIMD 2210633]
 gi|260879061|ref|ZP_05891416.1| membrane protein [Vibrio parahaemolyticus AN-5034]
 gi|28807469|dbj|BAC60734.1| conserved hypothetical protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|308089594|gb|EFO39289.1| membrane protein [Vibrio parahaemolyticus AN-5034]
 gi|328474220|gb|EGF45025.1| hypothetical protein VP10329_15975 [Vibrio parahaemolyticus 10329]
          Length = 429

 Score =  341 bits (874), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 93/407 (22%), Positives = 166/407 (40%), Gaps = 20/407 (4%)

Query: 234 DPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVH 293
            P   D           +   +  +  +T+             +   +++  +       
Sbjct: 30  LPDPQDLNPQQSRLKVGQHYPVPISLELTTLNGSSQMSSVLRWETYKVKNGESAAILFNR 89

Query: 294 AGYSNGDSAKIAKALKN-EVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIA 352
            G S     ++  + K  E ++ +L   + L+ G  +K+D   + R              
Sbjct: 90  VGLSARLLHELVSSDKEIEQQLTRLRPGDKLQFGFDEKNDLVQLRRTL----SAFETFRI 145

Query: 353 LNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLA 412
              + +YV        +++ +    + +     I    W A   +G+N N +  +     
Sbjct: 146 KLQDGKYVS-------EVDKKEVDYQFNYAEATIKSNFWNAGISSGLNGNQIMELAGIFG 198

Query: 413 SSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVE 472
             ++    ++  D     +       +     +++    +               + + +
Sbjct: 199 WDIDFALDIRKNDSFRVLYQEEVVEGEVIGRGKIIAAIFKNQGDTFTAIL----DEKTGK 254

Query: 473 YFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGD 531
           Y++ENG++ +   LR P+ F R+TS F  R  HP+ G  R H G D+AAP GTPI A GD
Sbjct: 255 YYDENGRAMKKAFLRAPLDFRRVTSNFNPRRLHPVTGRVRPHRGTDYAAPVGTPIWAAGD 314

Query: 532 GIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLST 591
           G+V+K+ +    G    I H N Y++ Y H     + +K G  VKQGQ IG +G TG  T
Sbjct: 315 GVVQKSAYNKFNGNYVFIKHSNTYITKYLHLTK--RTVKTGQRVKQGQTIGTLGGTGRVT 372

Query: 592 GPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKK-RINSL 637
           GPHLHYE +VNG+  +   V +P+ ++L G   Q F    K  ++ L
Sbjct: 373 GPHLHYEFLVNGVHKNPRTVNLPQSKSLTGKARQTFMANAKVSMDKL 419


>gi|114319598|ref|YP_741281.1| peptidase M23B [Alkalilimnicola ehrlichii MLHE-1]
 gi|114225992|gb|ABI55791.1| peptidase M23B [Alkalilimnicola ehrlichii MLHE-1]
          Length = 513

 Score =  341 bits (873), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 94/496 (18%), Positives = 184/496 (37%), Gaps = 30/496 (6%)

Query: 164 KIESSSQMLMDTIHNVDSFEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNK 223
            +   +  L       D  E +        ++ + +   +       + +          
Sbjct: 38  GVAVGALALTGLGPEGDGAEPSLT-----AELPQYRAAPS------VDVLQLAGIEWPQG 86

Query: 224 KNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFA------DD 277
                +      +  D       T     +   +N T+  P          A       +
Sbjct: 87  GFLHASYEPGRDEGGDGDLGSRGTGWLDEQDWLDNGTLAEPGRDDGPTDPLAHLDGLDWE 146

Query: 278 LIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIV 337
            + ++   ++      AG+S  +   + +A +   R+ ++   +I+ +     D    + 
Sbjct: 147 SLKVRSGDSLARLFNWAGFSAREVHDLMQAGEEAERLTRVHPGDIIEVVRDGDD---RLA 203

Query: 338 RFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFN 397
                  +   L I   +           +     + +  + +  S  +   ++ A    
Sbjct: 204 HLRYEFSRGQTLYIERTEEG--------FQAQTFQEAEERQVARASVTVDSSLYIAGRRA 255

Query: 398 GMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETR 457
           G+++ L+  +       ++L   L+  D     +   + N +   D  +L         R
Sbjct: 256 GLSNRLIMQLASVFGQQLDLGRDLRAGDEFHLVYEEIYQNGEKVRDGHILAAELVHRGER 315

Query: 458 TRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGV 516
            +  R+  P     +Y+   G+S R    R P+ + R+TS F +   HP+LG  R H G 
Sbjct: 316 LQAVRYA-PPGADPDYYTPEGESLRRAFNRHPIDYDRITSHFDLNRKHPVLGVRRPHYGT 374

Query: 517 DWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVK 576
           D+AAP GTPI + G G V    W GGYG+  +I HG+ Y + Y H    A  +  G  V+
Sbjct: 375 DYAAPVGTPIRSTGSGRVVHRGWKGGYGRTVIIQHGSEYTTLYAHMSGYASGLSQGDRVR 434

Query: 577 QGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINS 636
           +GQ++G++G +G+ TGPHLH+E  VNG   D  KV +P+ + +  + +  F      + +
Sbjct: 435 RGQVVGYLGGSGMVTGPHLHFEFHVNGNPRDPLKVALPKADPIPQEHMADFRATTHPMLA 494

Query: 637 LLNNGENPKKPLFTSH 652
            L   +          
Sbjct: 495 QLERDQRESATQVAQQ 510


>gi|221133487|ref|ZP_03559792.1| peptidase M23B [Glaciecola sp. HTCC2999]
          Length = 436

 Score =  341 bits (873), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 91/419 (21%), Positives = 166/419 (39%), Gaps = 18/419 (4%)

Query: 226 QSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNT 285
            +  L+ AD                 + +  E  + ++  V+   I         ++   
Sbjct: 28  TASMLFSADASRHATSTVLEPGVKYPVALNLEQLSASNSSVIDSGIESIESQTYRVKPGD 87

Query: 286 TIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQ 345
            +       G +  D+  +++A K+  ++ ++   E L     ++     +         
Sbjct: 88  NLAKIFKQVGLTPTDTYHVSRAGKHAKKLLKMMPGEFLNFTFDRRG---KLNTLIYEFSD 144

Query: 346 KHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVK 405
              LTI    ++EY+  ++  ++    +            I    W A    GM+ N + 
Sbjct: 145 TETLTITRKTDDEYISQIDIAEVYTKFRF-------AQGEITSSFWNAAIKAGMSDNKIM 197

Query: 406 LIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLN 465
            +       ++    ++  D     +     N       ++L           +  R  +
Sbjct: 198 ELADIFGWDIDFAMEIRAGDTFNVMYEERFVNGDFIGYGDILAAEFVNQGEVFQAIRHTD 257

Query: 466 PVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGT 524
                  Y+  NG+S +   LR PV F  ++S F  +  HP+    + H G D+AAP GT
Sbjct: 258 GS-----YYAPNGRSMKKSFLRAPVNFRYISSNFTKKRFHPVTKRWKAHRGTDYAAPTGT 312

Query: 525 PIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWI 584
           P+VA G G V K+ +    G    I HG+ YV+ Y H     + +K G  VKQGQ+IG +
Sbjct: 313 PVVASGKGRVIKSTYDRFNGHHVFIQHGDRYVTKYLHFSK--RKVKKGEIVKQGQVIGLL 370

Query: 585 GTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGEN 643
           G+TG+S+GPHLHYE +V+G+  +   V +P+ E +       F        ++L N + 
Sbjct: 371 GSTGMSSGPHLHYEFLVDGVHRNPRTVTLPKAEPIAKSEKAAFTQLSLPRLTMLANNKR 429


>gi|226946611|ref|YP_002801684.1| metallopeptidase [Azotobacter vinelandii DJ]
 gi|226721538|gb|ACO80709.1| metallopeptidase [Azotobacter vinelandii DJ]
          Length = 480

 Score =  340 bits (872), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 100/376 (26%), Positives = 154/376 (40%), Gaps = 13/376 (3%)

Query: 269 DKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVV 328
                    ++      T+      AG       +I    +    + ++   +       
Sbjct: 109 TPSLPATPTVVTSGKGDTLSTVFAKAGVPASILQEILHDKEAAKYLGRIKTGQKFEFTFS 168

Query: 329 QKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYD 388
              +  T+   S    +   + I+ +             +        MRT      I  
Sbjct: 169 ADGELQTL---SANLDKLESVEISKSVQG--------FSVKHEIAKPEMRTVYARGVIGS 217

Query: 389 GIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLY 448
               A    G++      + +  A  ++  + ++  D  E  +      ++     ++L 
Sbjct: 218 SFSLAAKKAGLSHGQTVSLSKIFAYDIDFAQDIRRGDEFEVIYEEKRLGSKRLHQGKILA 277

Query: 449 IHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGF-GMRYHPIL 507
                        R+ N    +  Y+  +G S R   +RTPV F R++S F   R HPIL
Sbjct: 278 ARFTNRGKTYTAVRYTNKQGAT-HYYTVDGNSMRKAFIRTPVDFARISSRFSNGRRHPIL 336

Query: 508 GYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAK 567
              R H GVD+AAPRGTPI A GDG V  A   GGYG   +I HGN   + Y H    AK
Sbjct: 337 NKIRAHKGVDYAAPRGTPIRATGDGKVTLAGRKGGYGNTVIIEHGNNQQTLYAHMQGFAK 396

Query: 568 NIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRF 627
            I+ G++VKQGQIIG+IGTTGLSTGPHLHYE  +NG  VD    ++     +     QRF
Sbjct: 397 GIRTGSSVKQGQIIGYIGTTGLSTGPHLHYEFQINGTHVDPLSQKLTMANPISRGEKQRF 456

Query: 628 AMEKKRINSLLNNGEN 643
             + + + + +N  + 
Sbjct: 457 LQQTQPLMARMNKEKA 472


>gi|15604272|ref|NP_220788.1| hypothetical protein RP407 [Rickettsia prowazekii str. Madrid E]
 gi|3860964|emb|CAA14864.1| unknown [Rickettsia prowazekii]
 gi|292572019|gb|ADE29934.1| Membrane-bound metallopeptidase [Rickettsia prowazekii Rp22]
          Length = 458

 Score =  340 bits (872), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 102/383 (26%), Positives = 180/383 (46%), Gaps = 6/383 (1%)

Query: 259 RTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLT 318
            T+  P    ++   F +  + ++   TI   +V       D  KI   +K       L 
Sbjct: 58  ITLVQPDSNEEETISFKE--VVVKKGDTIKSILVEQKIPKNDIEKIINLVKVGKLSSILK 115

Query: 319 KDEILRIGVVQKDDKFTIVRFSIYHK--QKHLLTIALNDNNEYVLGVEPVKMDINHQMDY 376
             + +      K  +      +       K ++ I      + +   +  K++       
Sbjct: 116 IGQHIIFEYETKITENDDEDLTSEITFLNKIVIIIDKLKTIKVIREGDNFKVEEIVVPLS 175

Query: 377 MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNH- 435
            + S+ S NI      A    G+++N +  ++   A  ++ Q  +K  D           
Sbjct: 176 KKVSKSSVNIESNFMSALKKLGLSNNSIIELINAYAYQIDFQRQIKNGDTATVITEKYVT 235

Query: 436 ANNQASDDSELLYIHARFGETRTRFYRF-LNPVDGSVEYFNENGKSSRPFLLRTPVPFGR 494
            + + S   ++LY+           YR+  +    +  +F+E+GKS +  LL+TP+   +
Sbjct: 236 EDGKFSHHGKILYVSLNLSGKEYNIYRYSHDNNANNYAFFSEDGKSVKRSLLKTPLKVIK 295

Query: 495 MTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNG 554
           ++S +G R HPILGY++MH GVD+AAP GTPI + G+G++ +  W  GYGK   + H   
Sbjct: 296 VSSHYGNRKHPILGYTKMHRGVDFAAPTGTPIYSAGNGVITEIGWKSGYGKFIQVKHSGT 355

Query: 555 YVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIP 614
             ++Y H  + AKN+K G+ VKQGQ+I ++G+TG ++GPHLHYE+ ++G  V+   V+  
Sbjct: 356 LSTAYAHASSFAKNLKVGSIVKQGQVIAYVGSTGRASGPHLHYEVKIDGKHVNPMSVKTT 415

Query: 615 ERENLKGDLLQRFAMEKKRINSL 637
               L G  L++F   K+ I +L
Sbjct: 416 PGIELNGKNLEKFKQFKQEIKTL 438


>gi|91794162|ref|YP_563813.1| peptidase M23B [Shewanella denitrificans OS217]
 gi|91716164|gb|ABE56090.1| peptidase M23B [Shewanella denitrificans OS217]
          Length = 472

 Score =  340 bits (872), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 105/469 (22%), Positives = 178/469 (37%), Gaps = 23/469 (4%)

Query: 185 TTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDH 244
           T   +  P++        T  + +          L          L      ++D   D 
Sbjct: 26  TLVILMLPSEDALASKQ-TPTNTKANIDFTEDDLLFARSNPSPLALEARQADSVDADMDT 84

Query: 245 PITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKI 304
                  +  ++        Q+      +   +   + +  T+      AG S  D   I
Sbjct: 85  FGNQDLLLNSVQAQIRAKKQQLRAADDDQKNVEYFEVVNGDTLGGLFSRAGLSAKDVFDI 144

Query: 305 AKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVE 364
           A     +  + ++   E + I    + +   +   S    +   L I+ ND+        
Sbjct: 145 ANLPLAKKNLLKIIPGEEIAITKSPEGE---LSEVSYRIDKVSTLVISKNDSGYVE---- 197

Query: 365 PVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPT 424
                IN +   +R+   S  I    W A +  G+++N +  +    A  V+    L+  
Sbjct: 198 ----KINTKEIEIRSQYVSAKIKSNFWNAAADAGLSANHIMQLANIFAWDVDFALDLRRN 253

Query: 425 DFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPF 484
           D          A+ +   +  +L         R    R+ +      EY++E G S R  
Sbjct: 254 DHFSLIVEQEFADGEFLRNGNILAAEFVNQGERHTAVRYSD-----GEYYSEAGNSLRKA 308

Query: 485 LLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGY 543
            LR+PV F  ++S F  R  HP+ G  + H GVD+ A  GTPI + G G V +A +    
Sbjct: 309 FLRSPVDFKYVSSNFNPRRLHPVTGQVKAHRGVDYVAAVGTPIKSAGRGKVIEAGYNQFN 368

Query: 544 GKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNG 603
           G    I H   Y + Y H     +N+  G +VKQGQIIG +G TG  TG HLHYE IVNG
Sbjct: 369 GNYVFIRHNGTYTTKYLHLTK--RNVSRGDSVKQGQIIGTLGRTGRVTGAHLHYEFIVNG 426

Query: 604 IKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
           +  +   V +P+ + +     Q+F    +    L+   +  ++    S+
Sbjct: 427 VHRNPRTVSLPKSDPIARSEKQKFQRLSQ---DLMAKLKQNQQVQLASN 472


>gi|187479434|ref|YP_787459.1| peptidase [Bordetella avium 197N]
 gi|115424021|emb|CAJ50574.1| putative peptidase [Bordetella avium 197N]
          Length = 471

 Score =  340 bits (872), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 90/443 (20%), Positives = 160/443 (36%), Gaps = 3/443 (0%)

Query: 197 RIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIE 256
             ++               +  +       S  L+         +            I  
Sbjct: 13  SRKIAALFAPATEPAPSRGRSLVRRTLLVSSLGLFAGAAALGMVQQPDRTELPPLSLIHS 72

Query: 257 ENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQ 316
           E R       +    P        I+   T+   +      +           +   + +
Sbjct: 73  ELRLQPEQLQVSASTPAPYISETRIRSGDTLASVLQRLDIDDSKLQTFLTHDASARSIYR 132

Query: 317 LTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDY 376
           L     ++    ++ +   +        +                  +  K     +   
Sbjct: 133 LYPGRSVQAATDEEGNLVWLRYIHTPGNEADGQVYTK--LLHVEASDDGFKAREITETTD 190

Query: 377 MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHA 436
           ++T      I+  ++ AT   G+  ++   +   L + ++    L+  D     + V   
Sbjct: 191 LQTRVAVGTIHSSLFAATDAAGIPDSITMQMADILGAKIDFLRDLRQGDQFRVVYEVRSH 250

Query: 437 NNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMT 496
           + + +    LL +     + +     F +P + S  Y++ +G S R   LRT + F R++
Sbjct: 251 DGRYAGAGRLLAVEFLNNDKKYSAVWF-SPDNKSGSYYDFDGTSLRGAFLRTALKFSRIS 309

Query: 497 SGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYV 556
           S FGMR HPI      H GVD+AAP GTPI +  DG V+   W  GYG   +I H   Y 
Sbjct: 310 STFGMRMHPIHKTWTGHKGVDYAAPSGTPIHSTADGTVDFVGWQNGYGNVVIIKHHGQYS 369

Query: 557 SSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPER 616
           + Y HQ  I   +K G  + QG ++G++G TG +TGPHLHYE  +N   VD   V +P  
Sbjct: 370 TLYAHQSRIRPGLKKGDKIAQGDLVGYVGATGWATGPHLHYEFRINNQPVDPLSVDLPVA 429

Query: 617 ENLKGDLLQRFAMEKKRINSLLN 639
             L+   ++ FA   +     + 
Sbjct: 430 RKLEPAEVRAFAKAVEPYKQQIE 452


>gi|297181094|gb|ADI17293.1| membrane proteins related to metalloendopeptidases [uncultured
           alpha proteobacterium HF0070_17D04]
          Length = 460

 Score =  340 bits (871), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 117/428 (27%), Positives = 187/428 (43%), Gaps = 23/428 (5%)

Query: 211 NAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDK 270
             I +    L   K     LY A+P  +      P   +   +     RT+    +    
Sbjct: 31  EPIRSDGMPLPQSKPDLALLYPAEPVEISLPVPRPDPQTILPRA---TRTVAEMYLQQTG 87

Query: 271 IPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQK 330
                D L  +++   +   +  AGY   D A    A+     +  L     +R+     
Sbjct: 88  TETGKDALYTLKNGEGLGKLLRRAGYEATDVAAAVDAVSGRASLRALPVGLDVRVTPGGF 147

Query: 331 DDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGI 390
                  R            +A +                  +      S     I D I
Sbjct: 148 AFTTRNGRDIFAIDDPEEGWVAFS----------------AIRPVERYLSFAQGVINDSI 191

Query: 391 WRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHA--NNQASDDSELLY 448
           +RA + + +  + +   +R +  SV+ Q  ++  D  E  +       + +     +L Y
Sbjct: 192 YRAAADSNIPDDALAEYVRIMGFSVDFQREIRSGDAFELLYEQQIDQISGEKIAT-KLHY 250

Query: 449 IHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILG 508
                  ++  FYRF +     V +++ NG S+   L+RTP+   R++S +GMR HPI G
Sbjct: 251 AGLMLSGSQLGFYRF-DHDGSRVGWYDRNGNSAARTLIRTPISGARLSSSYGMRKHPISG 309

Query: 509 YSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKN 568
           Y+RMH GVD+AAP GTPI+A G G+V K+ W G YG+   I H + Y ++Y H   IA+ 
Sbjct: 310 YNRMHKGVDFAAPTGTPIIAAGSGVVMKSGWLGSYGRYIRIRHNSTYDTAYAHMSRIARG 369

Query: 569 IKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFA 628
           I  G  V+QGQIIG++G++G STGPHLHYE++VN  KV+   V +P  E +   LL  F 
Sbjct: 370 ITPGRRVEQGQIIGYVGSSGRSTGPHLHYEILVNNRKVNPLTVSLPTGEKIPAKLLADFR 429

Query: 629 MEKKRINS 636
            + + + +
Sbjct: 430 SQVELVEA 437


>gi|297180366|gb|ADI16583.1| membrane proteins related to metalloendopeptidases [uncultured
           gamma proteobacterium HF0010_01E20]
          Length = 455

 Score =  340 bits (871), Expect = 6e-91,   Method: Composition-based stats.
 Identities = 93/433 (21%), Positives = 162/433 (37%), Gaps = 19/433 (4%)

Query: 209 IKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLI 268
           I          L     +  +    D      R   P   + ++    E   + S    +
Sbjct: 27  IPEEPTYHPMTLTTPSPRPESSKTNDTSGAQGRSLLPNDAAYEV----EKEVLASQAAYV 82

Query: 269 DKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVV 328
                   +   ++   ++        +       + +    E  +  +     L     
Sbjct: 83  VHEHAVVTNE-TVRAGDSMALIFARRNFPARALYALTQTAHGET-LAGIFPGAKLTFETK 140

Query: 329 QKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYD 388
                  +   +        +  +   +  +         +          + +   I  
Sbjct: 141 ND----QLTVLTYQPGPLERVVFSREQDGSFSS-------EEIFTKPEKVLTYKHGIINS 189

Query: 389 GIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLY 448
            ++  +   G+  NL   + +     V+    ++P D         H + +     ++L 
Sbjct: 190 SLFSTSQAIGLPDNLTMQLAQIFQWDVDFVLDIRPGDEFFALVEEQHLDGEFIGFGDILS 249

Query: 449 IHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPIL 507
                        R+      S  YFN  G+S R   LR PV F R++S F +R  HP+ 
Sbjct: 250 ARFVNQGRTFTAVRYTTEDGVS-GYFNATGRSMRKAFLRAPVEFSRISSSFNLRRKHPLY 308

Query: 508 GYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAK 567
              R H G+D+AAP GTPI+A GDG VE A+     G   +I HG  +V+ Y H    A+
Sbjct: 309 KTVRPHRGIDYAAPPGTPILAAGDGRVEIASRTKPNGNYVVIKHGEQFVTKYLHLSKFAR 368

Query: 568 NIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRF 627
            IK+G  V QGQIIG++G+TG +TGPHLHYE +VNG+  +   V +P+ + +    + RF
Sbjct: 369 GIKSGKRVNQGQIIGYVGSTGYATGPHLHYEFLVNGVHQNPRTVSLPQAKPVARKEISRF 428

Query: 628 AMEKKRINSLLNN 640
             +      LL++
Sbjct: 429 REKTFENLVLLDH 441


>gi|51473595|ref|YP_067352.1| hypothetical protein RT0393 [Rickettsia typhi str. Wilmington]
 gi|51459907|gb|AAU03870.1| conserved hypothetical protein [Rickettsia typhi str. Wilmington]
          Length = 454

 Score =  339 bits (870), Expect = 7e-91,   Method: Composition-based stats.
 Identities = 103/383 (26%), Positives = 180/383 (46%), Gaps = 6/383 (1%)

Query: 259 RTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLT 318
            T+  P    ++   F +  + ++   TI   +V       D  KI   +K       L 
Sbjct: 56  ITLVQPDSSEEETISFKE--VVVKKGDTIKSILVEQKIPKNDIEKIINLVKAGQLSSTLK 113

Query: 319 KDEILRIGVVQKDDKFTIVRFSIYHK--QKHLLTIALNDNNEYVLGVEPVKMDINHQMDY 376
             + +      K  +      +       K ++ I      E +   +  K++       
Sbjct: 114 IGQQITFEYETKITENDDEDLTSEITFLNKIIIIIDKLKTVEVIREGDNFKVEEIVVPLS 173

Query: 377 MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVN-H 435
            + S+ S NI      A    G+++N +  ++   A  ++ Q  +K  D           
Sbjct: 174 KKVSKSSVNIESNFMSALKKLGLSNNSIIELINAYAYQIDFQRQIKNGDTATVITEKYIT 233

Query: 436 ANNQASDDSELLYIHARFGETRTRFYRF-LNPVDGSVEYFNENGKSSRPFLLRTPVPFGR 494
            + + S   ++LY+           YR+  +    +  +F+E+GKS +  LL+TP+   +
Sbjct: 234 EDGKFSHHGKILYVSLNLSGKEYNIYRYSHDNNANNYAFFSEDGKSVKRSLLKTPLKVIK 293

Query: 495 MTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNG 554
           ++S +G R HPILGY++MH GVD+AAP GTPI + G+G++ +  W  GYGK   + H   
Sbjct: 294 VSSHYGNRKHPILGYTKMHRGVDFAAPTGTPIYSAGNGVITEIGWKSGYGKFIQVKHSGT 353

Query: 555 YVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIP 614
             ++Y H  + AKN+K G+ VKQGQ+I ++G+TG ++GPHLHYE+ ++G  V+   V+  
Sbjct: 354 LSTAYAHASSFAKNLKVGSIVKQGQVIAYVGSTGRASGPHLHYEVKIDGKHVNPMSVKTT 413

Query: 615 ERENLKGDLLQRFAMEKKRINSL 637
               L G  L++F   K+ I +L
Sbjct: 414 PGIELNGKNLEKFKQFKQEIKTL 436


>gi|253997779|ref|YP_003049842.1| peptidase M23 [Methylovorus sp. SIP3-4]
 gi|253984458|gb|ACT49315.1| Peptidase M23 [Methylovorus sp. SIP3-4]
          Length = 448

 Score =  339 bits (870), Expect = 7e-91,   Method: Composition-based stats.
 Identities = 94/390 (24%), Positives = 159/390 (40%), Gaps = 17/390 (4%)

Query: 255 IEENRTIT---SPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNE 311
           + EN  +    +P V +D           I+ + T+   +     +N D+ +  K   + 
Sbjct: 60  VVENIELPETIAPMVQVDAQNSSFWQADQIRRDDTLASLLSRLNITNDDAIEFLKRNPDA 119

Query: 312 VRV-DQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDI 370
             +  QL     ++    Q      +++          L + L  N          +  +
Sbjct: 120 RALATQLRPGRSIQAQTNQDG---QLLKLQYQTDNNSTLHVELTANG--------YEAHV 168

Query: 371 NHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETF 430
              +       +S  I   ++ AT   G+   +   +    +S ++    L+  D     
Sbjct: 169 AETVMETHPVLKSAEIKSSLFGATDEAGIPDAIAIQLAEIFSSDIDFHSDLRRGDRFVVV 228

Query: 431 FSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPV 490
           +  ++ N + +   ++L           R  R+ NP    V Y+   GKS     LR+P+
Sbjct: 229 YEASYWNGELARTGQVLAAEFINDGKTYRAVRYRNPEGQ-VSYYTPEGKSLHKSFLRSPL 287

Query: 491 PFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLI 549
            F R++SGF +   HPIL   R H GVD+AAP GT + A  D +V+      GYG   ++
Sbjct: 288 EFSRISSGFSLGRFHPILQKMRAHKGVDYAAPIGTRVKASADAVVDFVGVKSGYGNVVVL 347

Query: 550 HHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDST 609
            H NG  + Y H    A  +  G+ V QG II ++G TGL+TGPHLHYE ++NG   D  
Sbjct: 348 RHQNGISTVYGHLSRFAAGLHRGSKVSQGDIIAYVGMTGLATGPHLHYEFLLNGQHRDPL 407

Query: 610 KVRIPERENLKGDLLQRFAMEKKRINSLLN 639
            V +P    +       F     ++ + L 
Sbjct: 408 TVALPNAVPIAPKYKADFLANSSKLVAQLQ 437


>gi|329909300|ref|ZP_08275029.1| hypothetical protein IMCC9480_3854 [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327546500|gb|EGF31485.1| hypothetical protein IMCC9480_3854 [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 454

 Score =  339 bits (869), Expect = 8e-91,   Method: Composition-based stats.
 Identities = 92/396 (23%), Positives = 162/396 (40%), Gaps = 11/396 (2%)

Query: 236 QTLDQRHDHPITYSKKIKIIEENRTITS---PQVLIDKIPEFADDLIPIQHNTTIFDAMV 292
                    P   +  I+ I +   +         +++ P+       I++  T+   ++
Sbjct: 40  GAAAVAPMAPDAANLTIRSIVQEMDLPDIADQIASLEQSPQLYIHEEKIRYGDTLASVLM 99

Query: 293 HAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIA 352
             G  +  +    K+      V QL   + ++    +      +   +          + 
Sbjct: 100 RLGVDDDAAESFIKSDPVARNVLQLKSGKRIQAQTTEDGQLQWLSMLTDSRDDTTKNLMV 159

Query: 353 LNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLA 412
             D   +     P +++        R    +  I   ++ AT    +  N+ + I+   A
Sbjct: 160 SRDGEGFKAYEAPAELER-------RVEMHAGTIQSSLFAATDAAQIPDNVARQIVDMFA 212

Query: 413 SSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDG-SV 471
           + ++    L+  D  +  +     N +      +L    + G    +   F +       
Sbjct: 213 TDIDFASDLQRGDRFDVVYETFWQNGEFVRGGRILAGEFQNGNKNYQSIWFDDEAPQLGG 272

Query: 472 EYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGD 531
            Y+N +GKS +   L++P+ F R++S F MR HPI G  + HTGVD+AA  GTPI A  D
Sbjct: 273 GYYNFDGKSLKKAFLKSPLKFSRISSVFSMRKHPISGKWKQHTGVDFAATTGTPIRAAAD 332

Query: 532 GIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLST 591
           G+V+      GYG   ++ H +   ++Y H    A  +  G  V QG +IG++G+TG +T
Sbjct: 333 GVVDMVATQNGYGNIVVLKHWSNITTAYAHMSRFASGLHKGEKVSQGDVIGYVGSTGWAT 392

Query: 592 GPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRF 627
           GPHLHYE  V     D   V IP  + L G  L+RF
Sbjct: 393 GPHLHYEFRVASKARDPMSVDIPNVQALNGPELKRF 428


>gi|313199843|ref|YP_004038501.1| peptidase m23 [Methylovorus sp. MP688]
 gi|312439159|gb|ADQ83265.1| Peptidase M23 [Methylovorus sp. MP688]
          Length = 419

 Score =  339 bits (869), Expect = 8e-91,   Method: Composition-based stats.
 Identities = 94/390 (24%), Positives = 159/390 (40%), Gaps = 17/390 (4%)

Query: 255 IEENRTIT---SPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNE 311
           + EN  +    +P V +D           I+ + T+   +     +N D+ +  K   + 
Sbjct: 31  VVENIELPETIAPMVQVDAQNSSFWQADQIRRDDTLASLLSRLNITNDDAIEFLKRNPDA 90

Query: 312 VRV-DQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDI 370
             +  QL     ++    Q      +++          L + L  N          +  +
Sbjct: 91  RALATQLRPGRSIQAQTNQDG---QLLKLQYQTDNNSTLHVELTANG--------YEAHV 139

Query: 371 NHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETF 430
              +       +S  I   ++ AT   G+   +   +    +S ++    L+  D     
Sbjct: 140 AETVMETHPVLKSAEIKSSLFGATDEAGIPDAIAIQLAEIFSSDIDFHSDLRRGDRFVVV 199

Query: 431 FSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPV 490
           +  ++ N + +   ++L           R  R+ NP    V Y+   GKS     LR+P+
Sbjct: 200 YEASYWNGELARTGQVLAAEFINDGKTYRAVRYRNPEGQ-VSYYTPEGKSLHKSFLRSPL 258

Query: 491 PFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLI 549
            F R++SGF +   HPIL   R H GVD+AAP GT + A  D +V+      GYG   ++
Sbjct: 259 EFSRISSGFSLGRFHPILQKMRAHKGVDYAAPIGTRVKASADAVVDFVGVKSGYGNVVVL 318

Query: 550 HHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDST 609
            H NG  + Y H    A  +  G+ V QG II ++G TGL+TGPHLHYE ++NG   D  
Sbjct: 319 RHQNGISTVYGHLSRFAAGLHRGSKVSQGDIIAYVGMTGLATGPHLHYEFLLNGQHRDPL 378

Query: 610 KVRIPERENLKGDLLQRFAMEKKRINSLLN 639
            V +P    +       F     ++ + L 
Sbjct: 379 TVALPNAVPIAPKYKADFLANSSKLVAQLQ 408


>gi|91228324|ref|ZP_01262253.1| hypothetical protein V12G01_21728 [Vibrio alginolyticus 12G01]
 gi|91188140|gb|EAS74443.1| hypothetical protein V12G01_21728 [Vibrio alginolyticus 12G01]
          Length = 377

 Score =  339 bits (869), Expect = 8e-91,   Method: Composition-based stats.
 Identities = 91/381 (23%), Positives = 162/381 (42%), Gaps = 21/381 (5%)

Query: 261 ITSPQVLIDKIPEF-ADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVR-VDQLT 318
           +++       +P     +   +++  +        G S     ++  + K   + + +L 
Sbjct: 4   LSALNSSSPAVPAVLRWETYKVKNGESAAILFSRVGLSARLLHELVSSDKEVEKQLTRLR 63

Query: 319 KDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMR 378
             + L+ G  + +D   + R                 + +YV  V+  ++D         
Sbjct: 64  PGDRLQFGFDENNDLVQLRRTL----SAFETFRITLKDGKYVSEVDKKEVDFQ------- 112

Query: 379 TSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANN 438
            +     I    W A   +G+N N +  +       ++    ++  D     +       
Sbjct: 113 YNYAEATIKSNFWNAGISSGLNGNQIMELAGIFGWDIDFALDIRKNDSFRVLYQEEVVEG 172

Query: 439 QASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSG 498
           +     +++    +                 S +Y++ENG++ +   LR P+ F R++S 
Sbjct: 173 EVIGRGKIIAAIFKNQGDTFTAIL----DQKSGKYYDENGRAMKKAFLRAPLDFRRVSSN 228

Query: 499 FGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVS 557
           F  R  HP+ G  R H G D+AAP GTPI A GDG+V+K+++    G    I H N Y++
Sbjct: 229 FNPRRLHPVTGRVRPHRGTDYAAPVGTPIWAAGDGVVQKSSYNKFNGNYVFIKHSNTYIT 288

Query: 558 SYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERE 617
            Y H     + ++AG  VKQGQ IG +G TG  TGPHLHYE +VNG+  +   V +P+ +
Sbjct: 289 KYLHLTK--RTVRAGQRVKQGQTIGTLGGTGRVTGPHLHYEFLVNGVHKNPRTVNLPQSK 346

Query: 618 NLKGDLLQRFAME-KKRINSL 637
           +L G   Q F    K  ++ L
Sbjct: 347 SLTGKARQTFMANAKISMDKL 367


>gi|304310528|ref|YP_003810126.1| Peptidase, M23/M37 family [gamma proteobacterium HdN1]
 gi|301796261|emb|CBL44469.1| Peptidase, M23/M37 family [gamma proteobacterium HdN1]
          Length = 479

 Score =  339 bits (869), Expect = 9e-91,   Method: Composition-based stats.
 Identities = 97/416 (23%), Positives = 173/416 (41%), Gaps = 13/416 (3%)

Query: 227 SFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTT 286
              +   +   L+         S      E      S         +     + ++   +
Sbjct: 53  PTPVAAVEDDALNASASISEAISAPGARNEAPSKADSSISNAAAGTQPNTRALNVRSGDS 112

Query: 287 IFDAMVHAGYSNGDSAKIAKALKN-EVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQ 345
           +   +  A     D   I  A    + R+  L   + L I   Q+D +  +   S+   +
Sbjct: 113 LSTLLARAELMAKDQDAILAATAALKKRIPHLQPGQTLHI---QEDHENQLTFLSLDLTK 169

Query: 346 KHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVK 405
              L  A + + +       + + +  +     T+     +    ++A    G++ +   
Sbjct: 170 TDSLIAARDTSGQ-------LSVSLEKKEPVPFTTYTQGTVRSSFFQAAQAAGLSHSSAL 222

Query: 406 LIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLN 465
            + R     ++  + +   D  +  +   + + Q   D  +L              RF  
Sbjct: 223 QLTRIFDFDIDFSQDIHKGDSFKVVYEELYVDGQKLRDGAILAAEFTTKGKEYTAVRFKR 282

Query: 466 PVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGT 524
           P   S++Y+++ G + R   +R P+ + R++S F +   HP+L   R H G D+AA RGT
Sbjct: 283 PDG-SIDYYSKEGTTLRKAFIRAPIDYARISSHFDLSRLHPVLHSLRAHKGTDYAATRGT 341

Query: 525 PIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWI 584
           PI A GDG+V+ +   GGYG   ++ HG GY + Y H    AK +K GT +KQGQ+IG++
Sbjct: 342 PIKATGDGVVKFSGRKGGYGNVVILDHGRGYETLYAHMQNFAKGMKTGTKIKQGQVIGYV 401

Query: 585 GTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNN 640
           G+TGL+TGPHLHYE  VNG   +   V++P    +       F  +  +I   +N 
Sbjct: 402 GSTGLATGPHLHYEFYVNGQVKNPVTVKLPGSLPIAQTERAAFVRQASKITQQMNT 457


>gi|254480951|ref|ZP_05094197.1| M23 peptidase domain protein [marine gamma proteobacterium
           HTCC2148]
 gi|214038746|gb|EEB79407.1| M23 peptidase domain protein [marine gamma proteobacterium
           HTCC2148]
          Length = 435

 Score =  339 bits (869), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 90/421 (21%), Positives = 165/421 (39%), Gaps = 19/421 (4%)

Query: 233 ADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMV 292
           A P+      + P+     +    E   + +P+    K   + +    +++   +     
Sbjct: 22  AKPEPQQALEEAPLVPLVDVGAAAEPADLLTPEPEAPKAQPWNEQ--VVRNGDNLSLIFK 79

Query: 293 HAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIA 352
            AG+   D  ++     +   + ++   + +     +  +   +               +
Sbjct: 80  RAGFDTQDVHRVVTESPDGSGLARIYPGQTIAFLGNESGELAAVRH-----------VKS 128

Query: 353 LNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLA 412
             +   Y L       ++  ++   R S  +  I   ++ A    G++   +  +     
Sbjct: 129 ELETISYTLSANGYGSEVITRVPVTRQSNATGIITSSLFLAGQEAGLSHTTIMDMANIFG 188

Query: 413 SSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVE 472
             ++     +  D +   F   + +    DD E++             YR+     G   
Sbjct: 189 GVIDFVGDPRKGDTMHLLFEELYLDGNKFDDGEIIAASYANQGKTFTAYRY-TDSAGKTG 247

Query: 473 YFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGD 531
           YFN +G S R   L  PV F R++S F  R  HPI   +R H G D+AA  GTP+ A GD
Sbjct: 248 YFNTDGVSMRKAFLLAPVDFTRISSNFNPRRIHPIYKTARPHRGTDYAASTGTPVYAAGD 307

Query: 532 GIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLST 591
           G V KA +    G    I HG  +V+ Y H     + +K G  V Q Q+IG +G+TG +T
Sbjct: 308 GRVVKAGYNRANGNYVFIQHGEQFVTKYLHLHK--RKVKQGARVSQSQVIGTVGSTGAAT 365

Query: 592 GPHLHYELIVNGIKVDSTKV--RIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLF 649
           GPHLHYE ++NG+  +   +  ++P+ ++L    + RF      I+  L   +       
Sbjct: 366 GPHLHYEFLMNGVHRNPRTIHKKLPKAKSLAASEMPRFRQAISEISEQLAALQQDTDNRL 425

Query: 650 T 650
            
Sbjct: 426 A 426


>gi|256819661|ref|YP_003140940.1| Peptidase M23 [Capnocytophaga ochracea DSM 7271]
 gi|256581244|gb|ACU92379.1| Peptidase M23 [Capnocytophaga ochracea DSM 7271]
          Length = 429

 Score =  339 bits (868), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 82/404 (20%), Positives = 152/404 (37%), Gaps = 17/404 (4%)

Query: 246 ITYSKKIKIIEENRTITSPQ--VLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAK 303
            T + +            P        + ++      I+   T    +        D   
Sbjct: 23  DTPNAEKATASATVEAPKPPVYEFGFNLNDYTIVKDTIKQGDTFGKLLEENNIGAVDIHN 82

Query: 304 IAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGV 363
           I +  K E     +   ++      +K D      F         + + L D+       
Sbjct: 83  ITQKTKGEFNPKNIRTGKVYAFLYDKK-DPSKPHSFIYQPNVTDYVVVRLGDS------- 134

Query: 364 EPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKP 423
             V      +   +     + NI   +       G+++N    + +    +++    L+ 
Sbjct: 135 --VHAYKAQRKVTIVEKALAGNINSNLTVDALAAGISANATYQMGQIFDYTIDFFR-LQK 191

Query: 424 TDFLETFFSVNHANNQA-SDDSELLYIHARFGETRTRFYRFLNPVDGSV-EYFNENGKSS 481
            D  +  +   + ++   +    +   +  +       + F          Y++E G   
Sbjct: 192 GDNFKIIYEERYVDDTIFAGVERVKAAYFEWQGKPYYAFNFTTDSAKGTNGYYDEKGNMM 251

Query: 482 RPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAG 541
           +   L++P+   R+TS FGMR+HP+L   + H G D+AAP GTPI     G V +A ++ 
Sbjct: 252 KRMFLKSPLDIFRITSKFGMRFHPVLHRMKGHFGTDYAAPTGTPIRVTASGTVIEAGYSS 311

Query: 542 GYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIV 601
           G G    + H N Y + Y H   I    + G  V QGQ+IG +G+TGL+TGPH+ Y    
Sbjct: 312 GNGNYVKVRHNNMYTTQYLHMSRILA--RRGQHVSQGQVIGLVGSTGLATGPHVCYRFWK 369

Query: 602 NGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPK 645
           NG +VD  + ++PE   +   L  ++  E   +   L+  +   
Sbjct: 370 NGRQVDPLREKLPESVPIDARLKAKYLKEIAPLKEQLDALKATP 413


>gi|254230587|ref|ZP_04923950.1| membrane protein [Vibrio sp. Ex25]
 gi|151936888|gb|EDN55783.1| membrane protein [Vibrio sp. Ex25]
          Length = 433

 Score =  338 bits (867), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 90/365 (24%), Positives = 156/365 (42%), Gaps = 20/365 (5%)

Query: 276 DDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVR-VDQLTKDEILRIGVVQKDDKF 334
            +   +++  +        G S      +  + K   + + +L   + L+ G  + +D  
Sbjct: 76  WETYKVKNGESAAILFSRVGLSARLLHDLVSSDKEVEKQLTRLRPGDRLQFGFDENNDLV 135

Query: 335 TIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRAT 394
            + R                 + +YV  V+  ++D          +     I    W A 
Sbjct: 136 QLRRTL----SAFETFRITLKDGKYVSEVDKKEVDFQ-------YNYAEATIKSNFWNAG 184

Query: 395 SFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFG 454
             +G+N N +  +       ++    ++  D     +       +     +++    +  
Sbjct: 185 ISSGLNGNQIMELAGIFGWDIDFALDIRKNDSFRVLYQEEVVEGEVIGRGKIIAAIFKNQ 244

Query: 455 ETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMH 513
                          S +Y++ENG++ +   LR P+ F R++S F  R  HP+ G  R H
Sbjct: 245 GDTFTAIL----DQKSGKYYDENGRAMKKAFLRAPLDFRRVSSNFNPRRLHPVTGRVRPH 300

Query: 514 TGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGT 573
            G D+AAP GTPI A GDG+V+K+++    G    I H N Y++ Y H     + ++AG 
Sbjct: 301 RGTDYAAPVGTPIWAAGDGVVQKSSYNKFNGNYVFIKHSNTYITKYLHLTK--RTVRAGQ 358

Query: 574 AVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAME-KK 632
            VKQGQ IG +G TG  TGPHLHYE +VNG+  +   V +P+ ++L G   Q F    K 
Sbjct: 359 RVKQGQTIGTLGGTGRVTGPHLHYEFLVNGVHKNPRTVNLPQSKSLTGKARQTFMANAKI 418

Query: 633 RINSL 637
            ++ L
Sbjct: 419 SMDKL 423


>gi|114564136|ref|YP_751650.1| peptidase M23B [Shewanella frigidimarina NCIMB 400]
 gi|114335429|gb|ABI72811.1| peptidase M23B [Shewanella frigidimarina NCIMB 400]
          Length = 512

 Score =  338 bits (867), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 115/503 (22%), Positives = 196/503 (38%), Gaps = 30/503 (5%)

Query: 159 IFSEGKIESSSQMLMDTIHNVDSFEVTTQKINFPTD---ITRIQLDHTAQDEEIKNAIMN 215
           +F     ++S Q  + +     S   T ++   P      T    +    D+E  + I N
Sbjct: 31  MFPSEDAQASKQTRLVSQSADKSDIETNERYAIPLAFRTPTAPSHNDRIVDDESTDFISN 90

Query: 216 QFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKI----KIIEENR-TITSPQVLIDK 270
                 +   +  +    D +   Q      T +  I      +++   T  +       
Sbjct: 91  DALASSDNSEEVSSGETPDDEAFSQHLAMLQTSTSDIDGMINDLDQQVATQKAKIKQQAA 150

Query: 271 IPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQK 330
             +++ +   +    T+      AG S  D   I +    +  + ++   E + I    K
Sbjct: 151 NDDYSVEYYEVAKGDTLGGLFSRAGLSAKDVYDITQLPLAKKNLLKIMPGEEIAI---SK 207

Query: 331 DDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGI 390
           + +  +   +    +   L I+           E  K  +N +    RTS  S NI    
Sbjct: 208 NAQGELQELTYRMDKVSTLIISQ--------HNEQYKETVNTKEVVNRTSFISANIKSNF 259

Query: 391 WRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIH 450
           W A +  G++ N +  +       V+    ++  D     F   +A+ Q   +  +L   
Sbjct: 260 WNAAADAGLSGNHIMELANIFGWDVDFALDIRKGDHFSLLFEQEYADGQFLRNGNILAAE 319

Query: 451 ARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGY 509
                 R    R+ +      EY++ENG S R   LR+PV F  ++S F  R  HP+ G 
Sbjct: 320 FINQGERYTAVRYTD-----GEYYSENGSSMRKAFLRSPVDFKYVSSNFNPRRLHPVTGQ 374

Query: 510 SRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNI 569
            + H GVD+ A  GTPI A G G V +A +    G    I H   Y + Y H     + +
Sbjct: 375 IKAHRGVDYVAAIGTPIKAAGKGKVVEAGYNQFNGNYVFIKHNETYTTKYLHLTK--RKV 432

Query: 570 KAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAM 629
             G  VKQGQIIG +G TG  TG HLHYE IVNG+  +   + +P+   +      +FA 
Sbjct: 433 NRGETVKQGQIIGTLGKTGRVTGAHLHYEFIVNGVHRNPRTIDLPKSMPIDRREKNKFAA 492

Query: 630 EKKRINSLLNNGENPKKPLFTSH 652
             K+   L+   ++ ++    S+
Sbjct: 493 LSKQ---LMTKLKSNQQQQLASN 512


>gi|85860667|ref|YP_462869.1| peptidoglycan-specific endopeptidase, M23 family [Syntrophus
           aciditrophicus SB]
 gi|85723758|gb|ABC78701.1| peptidoglycan-specific endopeptidase, M23 family [Syntrophus
           aciditrophicus SB]
          Length = 433

 Score =  337 bits (865), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 103/389 (26%), Positives = 169/389 (43%), Gaps = 16/389 (4%)

Query: 265 QVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILR 324
           QV I +  EF +    I+   T+FD     G   GD   + +A  +  ++  L  D+  R
Sbjct: 48  QVRISESKEFHEVKGKIREGETLFDIFKKYGLHPGDLFSLREASADIHKLRNLRVDQPYR 107

Query: 325 IGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESP 384
           I          I  F+ +     +L I   +N  +     PV  +        RT + + 
Sbjct: 108 ILFDAD---KQINSFTYWIDDDTILNITCGENG-FCAEKIPVSYEK-------RTEQLAG 156

Query: 385 NIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDS 444
            I D +  + S +  +  L   +    A  ++    ++  D  +      + N +     
Sbjct: 157 VIKDNLISSLSQDKESLMLALDLSDIFAWDIDFATDIRKGDTFKVVVEGLYLNGEFRKYG 216

Query: 445 ELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY- 503
            +L             YRF +     V+Y++  G+S +   L+ P+ F R++S F     
Sbjct: 217 RILSAEIVNKGEPYHAYRFEDEEG--VDYYDAAGRSLKKAFLKAPLSFRRISSNFSRGRY 274

Query: 504 HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQD 563
           HPIL  +R H G+D+AA +GTP+ + GDG V  A   G YG   ++ H NGY + Y H  
Sbjct: 275 HPILKITRPHHGIDYAALQGTPVSSAGDGTVVFAGKRGQYGNLVILRHRNGYTTYYGHLS 334

Query: 564 AIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDL 623
            I  N++ G  + QG +IG +G TGL+TGPHLHYE+ +N   V+   ++IP    + G  
Sbjct: 335 KINSNVRKGVRIAQGSLIGNVGATGLATGPHLHYEMRINDRPVNPLSIKIPRGRTITGKS 394

Query: 624 LQRFAMEKKRINSLLNNGENPKKPLFTSH 652
           +  FA  K  ++  L +          S 
Sbjct: 395 MAEFARVKAAMDIELASVS--SSTFLASQ 421


>gi|114569207|ref|YP_755887.1| peptidase M23B [Maricaulis maris MCS10]
 gi|114339669|gb|ABI64949.1| peptidase M23B [Maricaulis maris MCS10]
          Length = 490

 Score =  337 bits (864), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 112/490 (22%), Positives = 194/490 (39%), Gaps = 29/490 (5%)

Query: 182 FEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKK-NQSFTLYYADPQTLDQ 240
            E    + +       + L        +  A+M            ++ +L    P  +  
Sbjct: 2   SEFDVTRADTRRTRGLVALASLTLSAGLLTALMLTGEPSSEAASGEAISLAMIAPNDVAG 61

Query: 241 RHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFAD---------DLIPIQHNTTIFDAM 291
             ++ +              +    +L      F               +    T+   +
Sbjct: 62  TIENSVPLQDGAATDPTPVVLEPADLLHINDAAFTQCASCPTRVQVERTVPRGGTMAGLL 121

Query: 292 VHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVV------QKDDKFTIVRFSIYHKQ 345
             AG    ++A+   AL     +  L   E + + +         D    +   S     
Sbjct: 122 DDAGVDRVEAARAIAALGTVFDLRYLRAGERINLYLDVETPADGADAVTRLNGLSFRPDI 181

Query: 346 KHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVK 405
           +  +T+A   ++ +       + D             S +I   ++      G    +V 
Sbjct: 182 ERSITVARTFDDRFRARETIAQFDREMVR-------ASGSITASLYVDALAAGATDRVVV 234

Query: 406 LIMRTLASSVNLQEHLKPTDFLETFFSVN-HANNQASDDSELLYIHARFGETRTRFYRFL 464
            +   LA +++ Q  ++P D  +  F          +   ++LY           FYR+ 
Sbjct: 235 ELAGVLAYAIDFQRSIQPGDDFDILFERFVDEEGNTARTGDILYAMYDGRGDPKEFYRYE 294

Query: 465 NPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGM-RYHPILGYSRMHTGVDWAAPRG 523
                 V Y++  G S++  L+ TPV   R++S F   R HPILGY+R H G D+AAPRG
Sbjct: 295 TEDGI-VGYYSPEGASAQRLLMLTPVNGARLSSSFSRARRHPILGYTRRHNGTDFAAPRG 353

Query: 524 TPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGW 583
           TP++A G+G+VE+A+  G +G    I H NGY ++Y H +  A+ I+AG+ V QGQ+I +
Sbjct: 354 TPVMAAGNGVVERADRYGSFGNYVRIRHANGYQTAYAHLNGFARGIRAGSRVTQGQVIAY 413

Query: 584 IGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGE- 642
           +GTTG STGPHLHYE+  NG   +   + +P    L  D +  F  E+ RI ++      
Sbjct: 414 VGTTGRSTGPHLHYEVHHNGTARNPMTLDLPTGRQLSEDEIPLFEAERDRIIAIREAARP 473

Query: 643 --NPKKPLFT 650
               + P+  
Sbjct: 474 AAEDETPVVA 483


>gi|297180579|gb|ADI16790.1| membrane proteins related to metalloendopeptidases [uncultured
           gamma proteobacterium HF0010_11K06]
          Length = 428

 Score =  337 bits (864), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 82/366 (22%), Positives = 160/366 (43%), Gaps = 13/366 (3%)

Query: 277 DLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTI 336
             I +  N T+   +      +     + K  K   ++  +   +I+ I   +      I
Sbjct: 67  KKIKVDKNDTLIKILSSNEVESKYIKALIKT-KGSEKLANIKTGDIVEISFTEN----KI 121

Query: 337 VRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSF 396
            +     +      +A   +  Y        ++ + ++  +     S  I + ++++   
Sbjct: 122 PKEIFVTRNGLKGVLAEFKDKTY-------SIENHERIPEVIERFASVTIDESLYQSALK 174

Query: 397 NGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGET 456
            G++ +++  ++      ++    ++  D  E  +       +   + ++     + G+ 
Sbjct: 175 GGISDSVIMDLVFIFGWDIDFVFDIRSGDSFEILYEEYFYQGEKIKNGDIKAARFKRGKK 234

Query: 457 RTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTG 515
                RF + V G+ EYF+  G++ +   LRTPV F  ++S + ++  HPIL   R HTG
Sbjct: 235 VFSAIRFFSNVSGTKEYFSTRGENVKKAFLRTPVEFSYISSRYNLKRKHPILNKIRAHTG 294

Query: 516 VDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAV 575
           VD+AAP GTP+ +   G V      GGYGK   + H   Y + Y H       +  G+ V
Sbjct: 295 VDYAAPIGTPVRSTSSGTVSFIGNKGGYGKLIEVKHSEDYSTRYAHLSKFNPRLSNGSKV 354

Query: 576 KQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRIN 635
           +QG+ IG++G TGL+TGPHLHYE  V G   +   V++P+ + +     + F     ++ 
Sbjct: 355 EQGETIGYVGQTGLATGPHLHYEFRVGGNHTNPLTVKLPDAKPISEVEKKEFFDHAIKMI 414

Query: 636 SLLNNG 641
           + L+  
Sbjct: 415 NRLDEL 420


>gi|90580613|ref|ZP_01236418.1| hypothetical membrane protein [Vibrio angustum S14]
 gi|90438271|gb|EAS63457.1| hypothetical membrane protein [Photobacterium angustum S14]
          Length = 405

 Score =  337 bits (864), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 90/373 (24%), Positives = 155/373 (41%), Gaps = 19/373 (5%)

Query: 262 TSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDE 321
            +P    DK  +       I+   ++  A  + G ++     +     N  ++++L    
Sbjct: 31  ATPLSDKDKTDKLTWKKHVIESGESLAIAFDNIGLNSKTLHSLINTDDNTKQLERLRPGN 90

Query: 322 ILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSE 381
           IL+ G  ++     +       +      I  +D N +   ++  ++          T+ 
Sbjct: 91  ILKFGFNKEGKLVELR----QPRNHLETLIVRHDGNTFSSEMDKKEIK-------THTNF 139

Query: 382 ESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQAS 441
               I    W A    G+ +N +  I       ++    ++  D  E  F  ++ +    
Sbjct: 140 SHATIETSFWNAADKAGLTANQIMEIAALFGWDIDFALDIRAGDKFEVLFEQHYLDGNPV 199

Query: 442 DDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGM 501
           D  E+L              R  +       Y++++G + R   LR+PV F  ++S F  
Sbjct: 200 DRGEILAATFTNMGQTFTAVRNNDGK-----YYDKDGLAMRKAFLRSPVNFRYVSSNFNP 254

Query: 502 RY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYN 560
           R  HP+ G  + H G D+ AP GTPI A GDG+V ++ +    G    I H   YV+ Y 
Sbjct: 255 RRLHPVTGKVKPHRGTDYVAPVGTPIWAAGDGVVLESAYNKYNGNYVFIKHSAKYVTKYL 314

Query: 561 HQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLK 620
           H     + +K G  VKQG  +G +G TG  TGPHLHYE +VNG   +   V +P+  +L 
Sbjct: 315 HLTK--RMVKKGQRVKQGDTVGTLGGTGRVTGPHLHYEFLVNGQHKNPRTVDLPQANSLS 372

Query: 621 GDLLQRFAMEKKR 633
           G+    F  + K+
Sbjct: 373 GNEQVTFKKQAKQ 385


>gi|288959635|ref|YP_003449976.1| peptidase M23B [Azospirillum sp. B510]
 gi|288911943|dbj|BAI73432.1| peptidase M23B [Azospirillum sp. B510]
          Length = 521

 Score =  337 bits (864), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 114/437 (26%), Positives = 178/437 (40%), Gaps = 14/437 (3%)

Query: 213 IMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLI---- 268
           +     L                         P  Y   +K        T  +       
Sbjct: 69  LPTLALLAVITAGALAPATVIARDADTPNGRTPHAYKPAVKPTATAEEATEAKDDAGSDG 128

Query: 269 DKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVV 328
                     + I    T+ D +  A     D+     AL+      +L   + + +   
Sbjct: 129 PATGPVDRQTLSIGRGDTLMDLLATAKVPTNDAHDAVTALREVYNPRRLQAGQHVTVLFE 188

Query: 329 QK-DDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIY 387
            +       V F         ++IA   +  +             +    +       I 
Sbjct: 189 PRRSGARKFVGFEFAPDPLRSVSIARKGDAGFTSSQ-------TEKPVTRKPVAAQGVIR 241

Query: 388 DGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNH-ANNQASDDSEL 446
             ++ A +  G+  +++   ++T +  V+ Q  L+P D  E  +     A+   + + +L
Sbjct: 242 SSLFEAGAQAGVPISVMMTFIQTFSYDVDFQRDLQPGDRFEILYEKLVTADGTQAGEGDL 301

Query: 447 LYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPI 506
           LY            YRF       ++Y+N +G+S R  LLRTP+   R+TSGFGMR+HPI
Sbjct: 302 LYASLTLSGDDMPIYRFKTRDG-RIDYYNGDGESIRRALLRTPIDGARITSGFGMRHHPI 360

Query: 507 LGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIA 566
           LG+S+MH GVD+ AP GTPI A G G +E A     YG    I H     ++Y H    A
Sbjct: 361 LGFSKMHKGVDFGAPTGTPIYAAGRGTIEIAERNSSYGNYVRIRHNTEISTAYAHMSRFA 420

Query: 567 KNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQR 626
           K+I+ G  V QG IIG++GTTG STGPHLHYE++  G +V+   + +P  E L+G  LQ 
Sbjct: 421 KSIQRGARVDQGDIIGYVGTTGRSTGPHLHYEVLKAGQQVNPRSIDLPTGEKLEGRELQA 480

Query: 627 FAMEKKRINSLLNNGEN 643
           F   ++ I  L     +
Sbjct: 481 FQQARRSIEKLFEESRH 497


>gi|297170336|gb|ADI21371.1| membrane proteins related to metalloendopeptidases [uncultured
           gamma proteobacterium HF0010_20H22]
          Length = 428

 Score =  337 bits (864), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 83/386 (21%), Positives = 165/386 (42%), Gaps = 14/386 (3%)

Query: 257 ENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQ 316
           E  T+   Q       + +   I +  N T+   +      N     + K  K   ++  
Sbjct: 48  EQITVYENQDEEIFTGKLSKK-IKVDKNDTLIQILGSNEVENKYIKALIKT-KGSEKLAN 105

Query: 317 LTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDY 376
           +   + + I   +      I +     +      +A   +  Y +       ++  +   
Sbjct: 106 IKTGDFVEISFSEN----KIPKEIFVTRNGLKGILAEFKDKTYTIKDYERTPEVLERFAS 161

Query: 377 MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHA 436
           +        I + ++++    G++ +++  ++      ++    ++  D  E  +     
Sbjct: 162 V-------TIDESLYQSALQEGISDSVIMDLVFIFGWDIDFVFDIRSGDSFEILYEEYFY 214

Query: 437 NNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMT 496
             +   + +++    + G+      RF++ V G+ EYF+  G++ +   L+TPV F  ++
Sbjct: 215 KGEKIKNGDIVVARFKRGKKVFSAIRFVSSVSGTKEYFSTRGENVKKAFLKTPVEFSYIS 274

Query: 497 SGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGY 555
           S + ++  HP+L   R HTGVD+AAP GTP+ +   G V      GGYGK   I H   Y
Sbjct: 275 SHYNLKRKHPVLNKIRAHTGVDYAAPTGTPVRSTSSGTVTFIGNKGGYGKLIEIKHSEDY 334

Query: 556 VSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPE 615
            + Y H       +  G+ V+QG+ IG++G TGL+TGPHLHYE  V G   +   V++P+
Sbjct: 335 STRYAHLSKFNPRLDNGSKVEQGETIGYVGQTGLATGPHLHYEFRVGGNHTNPLTVKLPD 394

Query: 616 RENLKGDLLQRFAMEKKRINSLLNNG 641
            + +     + F     ++ + L+  
Sbjct: 395 AKPISEVEKKEFFDHAIKMINRLDEL 420


>gi|84394557|ref|ZP_00993263.1| Membrane protein [Vibrio splendidus 12B01]
 gi|84374826|gb|EAP91767.1| Membrane protein [Vibrio splendidus 12B01]
          Length = 429

 Score =  337 bits (863), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 91/401 (22%), Positives = 159/401 (39%), Gaps = 19/401 (4%)

Query: 234 DPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVH 293
            P     R D       K   +  N +                +   ++   +       
Sbjct: 30  LPDVSSLRDDTGALVVGKHYPLTINASALVSSSDAPPTAVLNWEKYTVRSGESTSVLFER 89

Query: 294 AGYSNGDSAKIAKALKNEVR-VDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIA 352
            G S      +     +  + +  L   ++L+ G  + +D   + R            ++
Sbjct: 90  IGLSYRLLITLLNTNNDIKKQLSNLRPGDVLQFGFDENNDLIQLKR-----------QLS 138

Query: 353 LNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLA 412
             ++ +     +      + +    + +    NI    W A    G+ +N +  +     
Sbjct: 139 AFESFKITKSGDSFSSSFDKKEVAYQYNYAEANITSNFWNAGVSAGLTANQIMELAGIFG 198

Query: 413 SSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVE 472
             ++    ++  D  +  +       +     +++    +               D S  
Sbjct: 199 WDIDFALDIRKNDSFKILYQEKVVEGEVVGRGKIMAAVFKNQGDSFTAVL----DDKSGN 254

Query: 473 YFNENGKSSRPFLLRTPVPFGRMTSGFGM-RYHPILGYSRMHTGVDWAAPRGTPIVAVGD 531
           YF+ENG++ +   LR+P+ F R+TS F   R HP+ G  R H G D+AAP GTPI A GD
Sbjct: 255 YFDENGRAMKKAFLRSPIDFRRVTSNFNPTRRHPVTGKVRAHRGTDYAAPVGTPIWAAGD 314

Query: 532 GIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLST 591
           GIV+K+ +    G    I H N Y++ Y H     + +K G  VKQGQ IG +G TG  T
Sbjct: 315 GIVQKSGYNQFNGNYVFIRHSNTYITKYLHMKR--RMVKTGQRVKQGQTIGTLGGTGRVT 372

Query: 592 GPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKK 632
           GPHLHYE +VNG+  ++  V++P+ ++L G     F    +
Sbjct: 373 GPHLHYEFLVNGVHKNARTVKLPQSKSLTGKAKATFIANSE 413


>gi|330830718|ref|YP_004393670.1| cell wall endopeptidase [Aeromonas veronii B565]
 gi|328805854|gb|AEB51053.1| Cell wall endopeptidase, family M23/M37 [Aeromonas veronii B565]
          Length = 441

 Score =  337 bits (863), Expect = 5e-90,   Method: Composition-based stats.
 Identities = 92/418 (22%), Positives = 152/418 (36%), Gaps = 23/418 (5%)

Query: 232 YADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAM 291
               +  +  ++  +        + +     + Q +    P +    + ++    +    
Sbjct: 36  AVATRVDENGNEIALREPANDNALNDELPAEAAQPVTPPKPRYITKQVKVRRGDNMGVIF 95

Query: 292 VHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTI 351
              G S  D   +   L+    +  L   + L   + +  +  ++     Y         
Sbjct: 96  QRIGLSTTDLH-LIDQLEGSDPLRMLQPGQELTFKLTENGELHSL----YYPHSLEQALK 150

Query: 352 ALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTL 411
                  +V     + +D        R       I    W A    GM  + +  +    
Sbjct: 151 VSRKEETFVARNVKIALD-------TREQVSKGEIRSSFWGAAVDAGMTEDQIMDLAAIF 203

Query: 412 ASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSV 471
              ++  + L+P D     +     +++     ++L        T  R     +      
Sbjct: 204 GWDIDFAQDLQPGDSFRVVYEDKFRDDERVASGDILAAEFVNQGTAYRAVLNEDGN---- 259

Query: 472 EYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVG 530
            Y+   GK+ R   LR PV F  ++S F  R  HP+ G  R H G+D+ AP GTPI+A G
Sbjct: 260 -YYTPEGKAMRKSFLRAPVNFKYISSNFNPRRLHPVTGKIRPHNGIDYVAPVGTPIMAAG 318

Query: 531 DGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLS 590
            G V  A +    G    I H   YV+ Y H     + +  G  VKQGQ IG +G TG  
Sbjct: 319 SGSVVAAGYNQFNGNYVFIKHAGNYVTKYLHLSK--RTVNKGQRVKQGQTIGTLGGTGRV 376

Query: 591 TGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPL 648
           TGPHLHYE +V GI  +   + +P+ E L G  L  F          L   +NP+  L
Sbjct: 377 TGPHLHYEFVVGGIHKNPRTLTLPQAETLSGRELANFKKLA---MPQLAKLDNPELQL 431


>gi|315225119|ref|ZP_07866936.1| M23 peptidase domain protein [Capnocytophaga ochracea F0287]
 gi|314944802|gb|EFS96834.1| M23 peptidase domain protein [Capnocytophaga ochracea F0287]
          Length = 429

 Score =  337 bits (863), Expect = 5e-90,   Method: Composition-based stats.
 Identities = 82/404 (20%), Positives = 151/404 (37%), Gaps = 17/404 (4%)

Query: 246 ITYSKKIKIIEENRTITSPQ--VLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAK 303
            T + +            P        + ++      I+   T    +        D   
Sbjct: 23  DTPNAEKATASATVEAPKPPVYEFGFNLNDYTIVKDTIKQGDTFGKLLEENNIGAVDIHN 82

Query: 304 IAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGV 363
           I +  K E     +   ++      +K D      F         + + L D+       
Sbjct: 83  ITQKTKGEFNPKNIRTGKVYAFLYDKK-DPSKPHSFIYQPNVTDYVVVRLGDS------- 134

Query: 364 EPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKP 423
             V      +   +     + NI   +       G+++N    + +    +++    L+ 
Sbjct: 135 --VHAYKAQRKVTIVEKALAGNINSNLTVDALAAGISANATYQMGQIFDYTIDFFR-LQK 191

Query: 424 TDFLETFFSVNHANNQA-SDDSELLYIHARFGETRTRFYRFLNPVDGSV-EYFNENGKSS 481
            D  +  +   + ++   +    +   +  +       + F          Y++E G   
Sbjct: 192 GDNFKIIYEERYVDDTIFAGVERVKAAYFEWQGKPYYAFNFTTDSVKGTNGYYDEKGNMM 251

Query: 482 RPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAG 541
           +   L++P+   R+TS FGMR+HP+L   + H G D+AAP GTPI     G V +A +  
Sbjct: 252 KRMFLKSPLDIFRITSKFGMRFHPVLHRMKGHFGTDYAAPTGTPIRVTASGTVIEAGYGS 311

Query: 542 GYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIV 601
           G G    + H N Y + Y H   I    + G  V QGQ+IG +G+TGL+TGPH+ Y    
Sbjct: 312 GNGNYVKVRHNNMYTTQYLHMSRILA--RRGQHVSQGQVIGLVGSTGLATGPHVCYRFWK 369

Query: 602 NGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPK 645
           NG +VD  + ++PE   +   L  ++  E   +   L+  +   
Sbjct: 370 NGRQVDPLREKLPESVPIDARLKAKYLKEIVPLKEQLDALKATP 413


>gi|254283587|ref|ZP_04958555.1| 3'-5' exoribonuclease, VacB and RNase II [gamma proteobacterium
           NOR51-B]
 gi|219679790|gb|EED36139.1| 3'-5' exoribonuclease, VacB and RNase II [gamma proteobacterium
           NOR51-B]
          Length = 426

 Score =  336 bits (862), Expect = 5e-90,   Method: Composition-based stats.
 Identities = 95/442 (21%), Positives = 172/442 (38%), Gaps = 23/442 (5%)

Query: 215 NQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIK---IIEENRTITSPQVLIDKI 271
                L     Q             +        +       +  E+ + T    +    
Sbjct: 1   MALIALAASGPQEAATLVVTGPVPSEIKTVNPELTLSGANLNVDVEDSSATESMPVAPPA 60

Query: 272 PEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKD 331
           P + ++   ++    +      AGY++ D  ++ +A   +  + ++   E +     + D
Sbjct: 61  PRWHEE--TVRSGDNLSLIFARAGYTDRDVYQVTRADGGKA-LRRIYPGETVAFLTDESD 117

Query: 332 DKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIW 391
               +             T +   +  +V G +    ++  +   +R       I   ++
Sbjct: 118 RLAAVRH-----------TESRLKSTTFVKGDQGFVTEVLERKPEVRERGTRLRITSSLF 166

Query: 392 RATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHA 451
            A S  G+++ ++  +       ++     +  D +E  +     + +   D +++    
Sbjct: 167 LAGSDAGLSNRVIMDLAGIFGGVIDFVLDPRVGDTIELVYEEEFLDGEKLRDGDIVAASF 226

Query: 452 RFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYS 510
                R   YR+     G   Y+NE+G S R   L  PV F R++S F     HPI    
Sbjct: 227 TNKGERFEAYRY-TDSAGDTSYYNEDGVSMRKAFLMAPVDFTRISSNFNPNRLHPIYKTK 285

Query: 511 RMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIK 570
           R H G D+AAPRGTP+ + GDG V +A +    G    I HG  Y + Y H     + +K
Sbjct: 286 RPHRGTDYAAPRGTPVYSAGDGRVVEAGYTRANGNYVFIQHGESYKTHYLHLHK--RKVK 343

Query: 571 AGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVR--IPERENLKGDLLQRFA 628
            G  V QG +IG +G+TG +TGPHLHYE +VNG+  +   V   +P+ ++L G  L  F 
Sbjct: 344 RGDRVSQGSVIGTVGSTGAATGPHLHYEFLVNGVHRNPRSVHKMLPKAKSLPGGELPVFR 403

Query: 629 MEKKRINSLLNNGENPKKPLFT 650
                 +  L    +  K   +
Sbjct: 404 SHIAAFDQQLAALRSETKLALS 425


>gi|33593891|ref|NP_881535.1| hypothetical protein BP2956 [Bordetella pertussis Tohama I]
 gi|33563965|emb|CAE43228.1| hypothetical protein BP2956 [Bordetella pertussis Tohama I]
 gi|332383310|gb|AEE68157.1| hypothetical protein BPTD_2925 [Bordetella pertussis CS]
          Length = 471

 Score =  336 bits (862), Expect = 6e-90,   Method: Composition-based stats.
 Identities = 101/453 (22%), Positives = 171/453 (37%), Gaps = 3/453 (0%)

Query: 197 RIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIE 256
             +    A              LL      S    +A    L        +    +++I+
Sbjct: 11  SFKRKVAALFAPPVEPTSRGGALLRRTLTVSALGLFAGAAALGMVQQPDRSELPPLRLID 70

Query: 257 ENRTITS-PQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVD 315
               + +    + D           I+   T+   +      +           +   + 
Sbjct: 71  SVLPLEAGQMQVSDASNAPYISETRIRAGDTLAAVLQRLDIDSPRLQNFLTHDASARSIY 130

Query: 316 QLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMD 375
           +L     ++    +  D   + R+      +    +     +    G    K +   Q  
Sbjct: 131 KLYPGRSVQAATNENGDLVWL-RYIHTPGNESGGQVVTRLLHVAPDGANGYKAEEVTQGT 189

Query: 376 YMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNH 435
             +T      I   ++ AT   G+  ++   +   L+S ++    L+  D     + V  
Sbjct: 190 EQQTRVAVGTIRSSLFGATDAAGIPDSVTMQMADILSSKIDFLRDLRQGDQFRVVYEVRT 249

Query: 436 ANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRM 495
              + +    +  +    G+       F +P   S  Y++ +G S R   LRT + F R+
Sbjct: 250 HEGRYAGAGRVQALEFINGDKTYNAVWF-SPDGKSGSYYDFDGTSLRGAFLRTALKFSRI 308

Query: 496 TSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGY 555
           +S FGMR HPI      H GVD+AAP GTPI A  DG VE A W  GYG   +I H   Y
Sbjct: 309 SSTFGMRMHPIHKTWTGHKGVDYAAPTGTPIHATADGTVEFAGWQNGYGNVVIIKHHGKY 368

Query: 556 VSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPE 615
            + Y HQ  IA  +K G  + QG+++G++G+TG +TGPHLHYE  VN   +D   V +P 
Sbjct: 369 STLYAHQSRIASGLKKGQKIAQGELVGYVGSTGWATGPHLHYEFRVNNQPIDPLAVDLPV 428

Query: 616 RENLKGDLLQRFAMEKKRINSLLNNGENPKKPL 648
              L+   L+ F    +     +      ++ L
Sbjct: 429 ARKLEPAELRAFTQAVQPYKQQIKLLTEFQQTL 461


>gi|157374242|ref|YP_001472842.1| peptidase M23B [Shewanella sediminis HAW-EB3]
 gi|157316616|gb|ABV35714.1| peptidase M23B [Shewanella sediminis HAW-EB3]
          Length = 475

 Score =  336 bits (862), Expect = 6e-90,   Method: Composition-based stats.
 Identities = 105/467 (22%), Positives = 177/467 (37%), Gaps = 30/467 (6%)

Query: 192 PTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKK 251
           P D  +   +   Q     +   N    + N + ++          L  R   P + +  
Sbjct: 33  PADDAQASKNTNTQLSGSIDLGNNSTDSVSNTEARNAQ---QLKLPLAFRKPTPPSGNHS 89

Query: 252 IKIIEEN--RTITSPQVLIDKIPEFADDLIP---IQHNTTIFDAMVHAGYSNGDSAKIAK 306
               E N    +    +   K  +  +  +    ++   T+    + AG S+ D  +I  
Sbjct: 90  ASNAESNHIEPLADGSMEKLKAKQAENLDVERFQVKSGDTLAALFIRAGLSSRDVYEITL 149

Query: 307 ALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPV 366
             K +  + ++   E L I      +   +            L I  N+           
Sbjct: 150 LPKAKKNLLKIMPGEELIIAKDSAGELAELK---YQLNPISTLIITKNEAG--------Y 198

Query: 367 KMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDF 426
           K  I+ +    R    S  I    W A    G+  N +  +       ++    L+  D 
Sbjct: 199 KELISDKQVESRNKFASATISSNFWNAGVGAGLTPNQIMQLATIFGWDIDFALDLRKDDH 258

Query: 427 LETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLL 486
               F   +A+ +   +  +L         R    R+ +       Y++E G+S R   L
Sbjct: 259 FALIFEEEYADGEFLRNGNILAAEFSNQGDRYTAVRYTDGN-----YYSEEGRSMRKAFL 313

Query: 487 RTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGK 545
           R+PV F  ++S F  +  HP+ G  R H GVD+ A  GTPI A G G V K+ +    G 
Sbjct: 314 RSPVDFKYVSSSFNPKRLHPVTGKVRAHRGVDYVAKVGTPIKAAGKGRVIKSAYNQYNGN 373

Query: 546 QTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIK 605
              I H + Y + Y H     + +K G  VKQGQ+IG +G+TG  TG HLHYE IVNG+ 
Sbjct: 374 YVFIKHNDTYTTKYLHLKK--RKVKQGATVKQGQVIGTLGSTGRVTGAHLHYEFIVNGVH 431

Query: 606 VDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
            +   +++P+   +      +F    K+I   +   +  K+    S 
Sbjct: 432 RNPRTIKLPKSLPIASKDKPKFMALSKQI---MTKLQRNKQVYLASQ 475


>gi|117926780|ref|YP_867397.1| peptidase M23B [Magnetococcus sp. MC-1]
 gi|117610536|gb|ABK45991.1| peptidase M23B [Magnetococcus sp. MC-1]
          Length = 741

 Score =  336 bits (862), Expect = 6e-90,   Method: Composition-based stats.
 Identities = 94/470 (20%), Positives = 182/470 (38%), Gaps = 19/470 (4%)

Query: 183 EVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRH 242
           E   +    P  +  +    + ++E+  +                      D Q +    
Sbjct: 285 EKVAKIAPAPKSVAHLDNASS-EEEQALDQQAVVDPQQTQTAQAEGQQAETDEQDVTLAD 343

Query: 243 DHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSA 302
                         E     + ++              ++        +     SN  + 
Sbjct: 344 AAAEEEQPSAA---EAVKAKNDEMRSRFPAAKQIVSEKVRPGDMFSAILARHEVSNLVAF 400

Query: 303 KIAKALKNEVRV---DQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEY 359
           ++AKA + +       +L     L +    K +   ++  S    +   L IA   +N  
Sbjct: 401 EVAKAAQQQADFDIARRLRPGCELNMAFDAKHE---LIGLSYAVAKDKTLFIAQKADNS- 456

Query: 360 VLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQE 419
                 ++ ++  +   ++    +  I   +  A    G++ NL   +       V+   
Sbjct: 457 ------LRAEMVQKAYEVQVRSVAGTINGSLLVAARNVGLSQNLAMRLAGLFEWDVDFAR 510

Query: 420 HLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGK 479
            ++  D     F   + + +   +  +L              R+ +P    V Y+  +G 
Sbjct: 511 DIRAGDQFTVVFEELYVDGRKVGNGNILAAKFVNQGNAYEAIRYQDPRGQ-VGYYKPDGS 569

Query: 480 SSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKAN 538
           S     +R PV F R++S F +   HP+ G++R H GVD+AAP GTPI A G G +    
Sbjct: 570 SVEKMFIRAPVDFTRISSRFSLARKHPVFGFTRAHKGVDYAAPSGTPIRASGSGQIIYRA 629

Query: 539 WAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYE 598
             G +G   L+ H   Y ++Y H  A  + +  G+ VKQG++IG++G TG +TGPHLHYE
Sbjct: 630 HKGSFGNLILVKHNGTYSTAYAHMSAFKRGLSVGSQVKQGEVIGYVGATGAATGPHLHYE 689

Query: 599 LIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPL 648
           + V G +V+  ++++P  +++    L  F    +++ ++L +  N    L
Sbjct: 690 VRVRGRQVNPLQIKLPMGKSVPSQYLADFNKRSQKLTAMLRSSSNVVAAL 739


>gi|260775439|ref|ZP_05884336.1| membrane protein [Vibrio coralliilyticus ATCC BAA-450]
 gi|260608620|gb|EEX34785.1| membrane protein [Vibrio coralliilyticus ATCC BAA-450]
          Length = 428

 Score =  336 bits (861), Expect = 7e-90,   Method: Composition-based stats.
 Identities = 95/416 (22%), Positives = 165/416 (39%), Gaps = 20/416 (4%)

Query: 225 NQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHN 284
           +    +    P   D R D  +    +   I  N          +       +   I   
Sbjct: 20  SALIVIALFLPSPQDLRPDEKLYEVGEHYPIAINAEALISSDSENTAASLRWEKHTIGSG 79

Query: 285 TTIFDAMVHAGYSNGDSAKIAKALKN-EVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYH 343
            ++      AG S+     +    K  + ++ ++   +  + G    D    I R     
Sbjct: 80  DSMALLFQRAGLSSRLLYDLTTTSKEIKQQLTRVRPGDSFQFGFDTDDQLVQIKR---QL 136

Query: 344 KQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNL 403
                  I  ++              ++ +  + + +    +I    W A    G+ +N 
Sbjct: 137 NAYETFLITRSETG--------FTSQLDKKEVHYQYNYAEADITSNFWNAGVGAGLTANQ 188

Query: 404 VKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRF 463
           +  +       ++    ++  D  E  +       +     +++           +    
Sbjct: 189 IMELAGIFGWDIDFALDIRKGDHFEILYQERVVEGEVVGRGKIIAAIFTNQGDTFKAII- 247

Query: 464 LNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPR 522
               D +  Y++ENG++ +   LR+P+ F R++S F  R  HP+ G  R H G D+AAP 
Sbjct: 248 ---NDKNGNYYDENGRAMKKAFLRSPLDFRRVSSNFNPRRRHPVTGKVRAHRGTDYAAPV 304

Query: 523 GTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIG 582
           GTPI A GDGIV+K+++    G    I H N Y++ Y H     + +K G  VKQGQ IG
Sbjct: 305 GTPIWAAGDGIVQKSSYNQFNGNYVFIKHSNTYITKYLHLTK--RTVKTGQRVKQGQTIG 362

Query: 583 WIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKK-RINSL 637
            +G TG  TGPHLHYE +VNG+  +   V++P+ ++L G     F    K R+  L
Sbjct: 363 TLGGTGRVTGPHLHYEFLVNGVHKNPRTVKLPQSKSLTGKDKATFIANAKLRLEKL 418


>gi|33598387|ref|NP_886030.1| hypothetical protein BPP3878 [Bordetella parapertussis 12822]
 gi|33603325|ref|NP_890885.1| hypothetical protein BB4351 [Bordetella bronchiseptica RB50]
 gi|33574516|emb|CAE39161.1| hypothetical protein BPP3878 [Bordetella parapertussis]
 gi|33577449|emb|CAE34714.1| hypothetical protein BB4351 [Bordetella bronchiseptica RB50]
          Length = 471

 Score =  336 bits (860), Expect = 9e-90,   Method: Composition-based stats.
 Identities = 101/453 (22%), Positives = 171/453 (37%), Gaps = 3/453 (0%)

Query: 197 RIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIE 256
             +    A              LL      S    +A    L        +    +++I+
Sbjct: 11  SFKRKVAALFAPPVEPTSRGGALLRRTLTVSALGLFAGAAALGMVQQPDRSELPPLRLID 70

Query: 257 ENRTITS-PQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVD 315
               + +    + D           I+   T+   +      +           +   + 
Sbjct: 71  SVLPLEAGQMQVSDASNAPYISETRIRAGDTLAAVLQRLDIDSPRLQNFLTHDASARSIY 130

Query: 316 QLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMD 375
           +L     ++    +  D   + R+      +    +     +    G    K +   Q  
Sbjct: 131 KLYPGRSVQAATNENGDLVWL-RYIHTPGNESGGQVVTRLLHVAPDGANGYKAEEVTQGT 189

Query: 376 YMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNH 435
             +T      I   ++ AT   G+  ++   +   L+S ++    L+  D     + V  
Sbjct: 190 EQQTRVAVGTIRSSLFGATDAAGIPDSVTMQMADILSSKIDFLRDLRQGDQFRVVYEVRT 249

Query: 436 ANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRM 495
              + +    +  +    G+       F +P   S  Y++ +G S R   LRT + F R+
Sbjct: 250 HEGRYAGAGRVQALEFINGDKTYNAVWF-SPDGKSGSYYDFDGTSLRGAFLRTALKFSRI 308

Query: 496 TSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGY 555
           +S FGMR HPI      H GVD+AAP GTPI A  DG VE A W  GYG   +I H   Y
Sbjct: 309 SSTFGMRMHPIHKTWTGHKGVDYAAPTGTPIHATADGTVEFAGWQNGYGNVVIIKHHGKY 368

Query: 556 VSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPE 615
            + Y HQ  IA  +K G  + QG+++G++G+TG +TGPHLHYE  VN   +D   V +P 
Sbjct: 369 STLYAHQSRIAAGLKKGQKIAQGELVGYVGSTGWATGPHLHYEFRVNNQPIDPLAVDLPV 428

Query: 616 RENLKGDLLQRFAMEKKRINSLLNNGENPKKPL 648
              L+   L+ F    +     +      ++ L
Sbjct: 429 ARKLEPAELRAFTQAVQPYKQQIKLLTEFQQTL 461


>gi|331007023|ref|ZP_08330258.1| peptidase, M23/M37 family [gamma proteobacterium IMCC1989]
 gi|330419171|gb|EGG93602.1| peptidase, M23/M37 family [gamma proteobacterium IMCC1989]
          Length = 337

 Score =  336 bits (860), Expect = 9e-90,   Method: Composition-based stats.
 Identities = 89/337 (26%), Positives = 149/337 (44%), Gaps = 13/337 (3%)

Query: 315 DQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQM 374
            ++   + +   +    +   ++       + + +     D   +V     +        
Sbjct: 2   KRIYPGQRVEFNIS---EGSELLGLKFQKNRLNYIEFTKTDKG-FVDNSIAIT------- 50

Query: 375 DYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVN 434
                +     I   ++ A +  G+    +  +       ++    ++  D  +  +   
Sbjct: 51  PDTHIAYREATITSSLFLAGTAAGLEQGSIMELANIFGWDIDFALDIRTNDSFKVLYEER 110

Query: 435 HANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGR 494
             N +   +  +L           +  R+   VDG+  YF   GKS R   LRTPV F R
Sbjct: 111 FLNGEKIGNGPILAAEFTNQNKTFKAVRY-TDVDGNTSYFTPEGKSMRKAFLRTPVDFAR 169

Query: 495 MTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGN 553
           ++S F ++  HPIL   R H G D+AAP GTPI A G+G VE A   GGYG+  +I HG 
Sbjct: 170 ISSHFNLKRKHPILNRIRAHKGTDYAAPTGTPIKAAGNGKVEFAGVKGGYGRTVVIRHGQ 229

Query: 554 GYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRI 613
            Y + Y H     K I+ GT VKQGQIIG++G +GL+TGPHLHYE   NG+  +  +V +
Sbjct: 230 SYKTLYAHMHKYGKGIRTGTRVKQGQIIGYVGKSGLATGPHLHYEFYKNGVVRNPVRVEL 289

Query: 614 PERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFT 650
           P+ E++    L  F  + + + + ++   N      +
Sbjct: 290 PKAESIPKSSLANFKQQTQPLVAQMHEYTNSTTLALS 326


>gi|297170311|gb|ADI21347.1| membrane proteins related to metalloendopeptidases [uncultured
           gamma proteobacterium HF0010_10D20]
          Length = 439

 Score =  336 bits (860), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 95/432 (21%), Positives = 187/432 (43%), Gaps = 21/432 (4%)

Query: 224 KNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQV--LIDKIPEFADDLIPI 281
            +    +Y++ P+ L++     +   ++IK   E   +       +I    +     I +
Sbjct: 20  GSLIALMYFSLPKGLEEFS-LSLPADEEIKYERETIKLGQQVGNGVIKTDNKKVYKQIKV 78

Query: 282 QHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSI 341
           +    +   + +    +     + +A K   R+ ++ + + + I      +  +I   S 
Sbjct: 79  KSQDNLIKILRNENIPDRFIQALVRA-KGSERMARIKEGDFVEIVHDFLMNPASISVTSN 137

Query: 342 YHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNS 401
           +         A+  N  + +      +D             S  I D ++ +   + +  
Sbjct: 138 FMDGYE----AIFKNGLFKISKFSRILDKEEIY-------HSATIEDSLFMSGKKSNIPE 186

Query: 402 NLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFY 461
           +++  +       ++    ++  D  E  +   +       + +++  +   GE +    
Sbjct: 187 SIIMDLAYIFGWDIDFIYDIRSGDSFELIYEQLYWKGNKVRNGDIISANFYRGENKFSAV 246

Query: 462 RFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAA 520
           R+        +YF++ G + +   LR+PV F  ++S + +   HPIL   R HTGVD+AA
Sbjct: 247 RYFQDG--KKDYFSQEGNNLKKAFLRSPVEFSYVSSKYNLNRKHPILNTIRAHTGVDYAA 304

Query: 521 PRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQI 580
             GTP+ A G+G V      GGYG+   I H N Y + Y H    AK ++ G+ V QG I
Sbjct: 305 TTGTPVRATGEGTVIFRANKGGYGRLIEIRHFNEYTTRYAHLSGYAKGLQVGSKVDQGDI 364

Query: 581 IGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNN 640
           IG++G +GL+TGPHLHYE  VNG+  D  +V+ P  + ++ +  + F      ++  +N 
Sbjct: 365 IGYVGKSGLATGPHLHYEFRVNGMHTDPLRVKFPNAKPIESENKEEFTNFALALDLKMNT 424

Query: 641 GENPKKPLFTSH 652
            +   K LF+S+
Sbjct: 425 LK---KKLFSSN 433


>gi|41582352|gb|AAS07966.1| M23/M37 peptidase domain protein [uncultured marine bacterium 463]
          Length = 470

 Score =  336 bits (860), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 90/421 (21%), Positives = 165/421 (39%), Gaps = 19/421 (4%)

Query: 233 ADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMV 292
           A P+      + P+     +    E   + +P+    K   + +    +++   +     
Sbjct: 57  AKPEPQQALEEAPLVPLVDVGAAAEPADLLTPEPEAPKAQPWNEQ--VVRNGDNLSLIFK 114

Query: 293 HAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIA 352
            AG+   D  ++     +   + ++   + +     +  +   +               +
Sbjct: 115 RAGFDTQDVHRVVTESPDGSGLARIYPGQTIAFLGNESGELAAVRH-----------VKS 163

Query: 353 LNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLA 412
             +   Y L       ++  ++   R S  +  I   ++ A    G++   +  +     
Sbjct: 164 ELETISYTLSANGYGSEVITRVPVTRQSNATGIITSSLFLAGQEAGLSHTTIMDMANIFG 223

Query: 413 SSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVE 472
             ++     +  D +   F   + +    DD E++             YR+     G   
Sbjct: 224 GVIDFVGDPRKGDTMHLLFEELYLDGNKFDDGEIIAASYANQGKTFTAYRY-TDSAGKTG 282

Query: 473 YFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGD 531
           YFN +G S R   L  PV F R++S F  R  HPI   +R H G D+AA  GTP+ A GD
Sbjct: 283 YFNTDGVSMRKAFLLAPVDFTRISSNFNPRRIHPIYKTARPHRGTDYAASTGTPVYAAGD 342

Query: 532 GIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLST 591
           G V KA +    G    I HG  +V+ Y H     + +K G  V Q Q+IG +G+TG +T
Sbjct: 343 GRVVKAGYNRANGNYVFIQHGEQFVTKYLHLHK--RKVKQGARVSQSQVIGTVGSTGAAT 400

Query: 592 GPHLHYELIVNGIKVDSTKV--RIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLF 649
           GPHLHYE ++NG+  +   +  ++P+ ++L    + RF      I+  L   +       
Sbjct: 401 GPHLHYEFLMNGVHRNPRTIHKKLPKAKSLAASEMPRFRQAISEISEQLAALQQDADNRL 460

Query: 650 T 650
            
Sbjct: 461 A 461


>gi|262401672|ref|ZP_06078238.1| membrane protein [Vibrio sp. RC586]
 gi|262352089|gb|EEZ01219.1| membrane protein [Vibrio sp. RC586]
          Length = 432

 Score =  336 bits (860), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 90/432 (20%), Positives = 177/432 (40%), Gaps = 22/432 (5%)

Query: 223 KKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQ 282
               +F +++       ++ D  +   +   +  +N  +T+ +      P    +   + 
Sbjct: 20  SAVIAFAVFFLPNTETLRKPDSQLELGRHYSVPLDNTLLTTNEDGQVSSPLLRWETYKVA 79

Query: 283 HNTTIFDAMVHAGYSNGDSAKIAKALKNEVR-VDQLTKDEILRIGVVQKDDKFTIVRFSI 341
           +  +       AG S+    ++  +  +    + +L   + L+ G  +K+    + R   
Sbjct: 80  NGESAAVLFQRAGLSSRVLYELTSSNSDINSQLSKLMPKDELKFGFDEKNQLVQLKRTI- 138

Query: 342 YHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNS 401
                    +  +D+            + + +    + +     I    W A    G+++
Sbjct: 139 --SPYETFVVTRSDSG--------FTSEFDKKDVVYQLNYAEAKITSSFWNAGMAAGLSA 188

Query: 402 NLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFY 461
           N +  +       ++    ++  D  +  +              ++        +     
Sbjct: 189 NQIMELAGLFGWDIDFALDIREGDQFKLLYQEKLVEGTVIGRGNIIAATFSNQGSTFTAI 248

Query: 462 RFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAA 520
                 D +  Y++ENG++ +   LR+P+ F R++S F  R  HP+ G  + H G D+AA
Sbjct: 249 L----DDNTGNYYDENGRAMKKAFLRSPLDFRRVSSNFNPRRLHPVTGQVKAHRGTDYAA 304

Query: 521 PRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQI 580
           P GTPI A GDG+VEK+++    G    I H N Y++ Y H     + +K G  VKQGQ 
Sbjct: 305 PVGTPIWAAGDGVVEKSSYNQFNGNYVYIRHSNTYITKYLHLQR--RLVKTGQRVKQGQS 362

Query: 581 IGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNN 640
           IG +G TG  TGPHLHYE +VNG+  +   V +P+ ++L G   + F    K+    +  
Sbjct: 363 IGTLGGTGRVTGPHLHYEFLVNGVHKNPRTVELPQAQSLSGKAKETFITNAKQ---RMAK 419

Query: 641 GENPKKPLFTSH 652
            +   + L+ + 
Sbjct: 420 LDRYSQLLYANQ 431


>gi|326796182|ref|YP_004314002.1| peptidase M23 [Marinomonas mediterranea MMB-1]
 gi|326546946|gb|ADZ92166.1| Peptidase M23 [Marinomonas mediterranea MMB-1]
          Length = 448

 Score =  336 bits (860), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 84/381 (22%), Positives = 161/381 (42%), Gaps = 12/381 (3%)

Query: 261 ITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKD 320
           + +PQ L +   +  +  I I    ++   +   G S  D  ++A A      + ++   
Sbjct: 58  VATPQHLKNNKKDIIEQTITIASGDSLSTVLSSMGISQQDVYRVANARDANSELLRIQPG 117

Query: 321 EILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTS 380
           + L +       +  +   +    +          + ++   V+  K +       +   
Sbjct: 118 QTLNVKAEFP--EGRLKELTYIQSKLKRTLYERQQDGQFSFVVQLTKPETKQIYKEV--- 172

Query: 381 EESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQA 440
                I + I+      G+  +++  + +  A  ++    ++  D     +  N    + 
Sbjct: 173 ----TITNSIFVDGIKAGIPQSVLIQLTQIFAWDIDFATDIRKGDSFSLLYEENELEGEV 228

Query: 441 SDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFG 500
                ++  +        +  R+ +  + +  Y+  +G S R   +R+PV F R++S F 
Sbjct: 229 LGTGNIIAANFINIGRSFQTIRYDDGDEFN--YYTPDGLSMRKAFIRSPVDFTRISSKFN 286

Query: 501 MRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSY 559
               HPI   S+ H GVD+AA  GTP+ A G G V+      GYG   +I HG GY + Y
Sbjct: 287 PNRLHPIFKTSQPHQGVDYAAKSGTPVKAAGAGKVKYVGELKGYGNTIIIEHGQGYSTLY 346

Query: 560 NHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENL 619
            H     K ++A   ++QG +IG++G TG +TGPHLH+E  +NGI  D   V IP    +
Sbjct: 347 AHLQGFKKGLQANRYIEQGDLIGFVGQTGWATGPHLHFEFRINGIHKDPMTVEIPHDSPM 406

Query: 620 KGDLLQRFAMEKKRINSLLNN 640
             D L+++    + + + L+ 
Sbjct: 407 SKDSLKKYLPYARSVMTELSQ 427


>gi|78484697|ref|YP_390622.1| peptidase M23B [Thiomicrospira crunogena XCL-2]
 gi|78362983|gb|ABB40948.1| Peptidase family M23 protein [Thiomicrospira crunogena XCL-2]
          Length = 430

 Score =  336 bits (860), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 91/412 (22%), Positives = 172/412 (41%), Gaps = 16/412 (3%)

Query: 241 RHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGD 300
                      + +   + +      L  +   +   ++ I+ N ++ +A+   G S   
Sbjct: 30  ATASQSPERYALPLPPVDLSSQESHTLDKQNANWTKHVVKIKKNGSLSEALDSVGLSPVV 89

Query: 301 SAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYV 360
           S +IA     +  + QL   + L I + + +    I     Y K+  +       N+++ 
Sbjct: 90  SFQIADTKHGQW-LTQLRAGDTLEIWLDKANQLQKIH----YPKRTSVHYQLTRKNDQF- 143

Query: 361 LGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEH 420
                  +         +    S  I    +++    G+++  +  +    +  ++    
Sbjct: 144 ------NIQKIEYPVETKIQTASGTIKHSFYQSGKDEGLSAQTIMNLADIFSWEIDFIRQ 197

Query: 421 LKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRF-LNPVDGSVEYFNENGK 479
           L+P D  +  +     N Q   D ++L         +        +     V Y++++ +
Sbjct: 198 LRPGDPFKVIYEKKFINGQYVGDGDILAAEVTTNGDQLHTAFLLRDQNGEKVGYYDQHKR 257

Query: 480 SSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKAN 538
           + R   LR PV + R+TS +  +  HP+L   R H GVD+  P GTPI   GDG + K  
Sbjct: 258 NLRKAFLRNPVDYVRITSRYKPKRYHPVLKKWRAHRGVDYGGPIGTPIHVTGDGQIIKRR 317

Query: 539 WAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYE 598
           W+  YG+   + H   YV+ Y H     K  + G  V+QGQ+IG+IG +GL++GPHLHYE
Sbjct: 318 WSRSYGRVIYVKHAGRYVTVYAHMSKFGKY-RQGEWVRQGQVIGYIGQSGLASGPHLHYE 376

Query: 599 LIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFT 650
               G  VD  +V+ P+   +     ++F    + +++ L+   NP   L +
Sbjct: 377 FRKKGHHVDPLRVKFPDAGPVPKKYRRQFIQYAELMSAQLDRL-NPHTQLVS 427


>gi|326801045|ref|YP_004318864.1| peptidase M23 [Sphingobacterium sp. 21]
 gi|326551809|gb|ADZ80194.1| Peptidase M23 [Sphingobacterium sp. 21]
          Length = 440

 Score =  335 bits (859), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 86/417 (20%), Positives = 163/417 (39%), Gaps = 15/417 (3%)

Query: 236 QTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAG 295
              +       + +K +   +E   +  P+     +  F      ++ N  + + +    
Sbjct: 26  SGFEINRPSEESPTKAVN-AQEKIPVPLPKQFNLAVDSFDVHNNKVERNQFLSNILSAYQ 84

Query: 296 YSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALND 355
                 +K+A   +    V +++      I   + +       F         +   L D
Sbjct: 85  VDPVTISKLADKSRAIFNVRKISAGNPYTIFTYKSN-PQKAAYFIYQPNPIDYIVYDLRD 143

Query: 356 NNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSV 415
                     + +    +   +R    S +I   ++ A   NG +  L   +      ++
Sbjct: 144 T---------LNVYAGKKDVAVRLETVSSDINHSLYEALQRNGADPQLAIKLAEIYGWAI 194

Query: 416 NLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFN 475
           +    +   D+ +  +   + +++  D   ++             + F        EY++
Sbjct: 195 DFYA-IGENDWFKIQYERRYVDDRPVDAGHIVSAVFSHKGKELSAFYFQTDSTTKGEYYD 253

Query: 476 ENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIV 534
           E G S R   L+ P+ F R+TS +  R  HP+    + H G D+AAPRGTPI+A G+G+V
Sbjct: 254 EEGNSVRRAFLKAPLKFSRITSRYTKRRLHPVQKIWKAHLGTDYAAPRGTPIIATGNGVV 313

Query: 535 EKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPH 594
            ++ ++   G    I H   Y + Y H     + +++G  V+QGQ+IG++G+TGL+TGPH
Sbjct: 314 TESAFSKFNGNYVKIKHNGTYTTQYLHMSK--RAVRSGQRVQQGQVIGYVGSTGLATGPH 371

Query: 595 LHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTS 651
           + Y    NG +VD+ K    E   L    L  F     R   +L +          S
Sbjct: 372 VCYRFWKNGKQVDALKQNFRETTPLPSKFLSAFKAVVAREQEVLASLNVVAGDALAS 428


>gi|297182042|gb|ADI18216.1| membrane proteins related to metalloendopeptidases [uncultured
           gamma proteobacterium HF0200_40H22]
          Length = 508

 Score =  335 bits (858), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 103/489 (21%), Positives = 189/489 (38%), Gaps = 24/489 (4%)

Query: 159 IFSEGKIESSSQMLMDTIHNVD-SFEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQF 217
           +  +      S++  +  +          +       I +         + +  A     
Sbjct: 42  LVLDQDPVPLSEIETEAKNGSGIDPMPVMESFQGVAAIEKAAPAFGTVLQSVDAAKTTDD 101

Query: 218 FLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADD 277
             +                   +  +     S   +   E+ T T  ++        A +
Sbjct: 102 SAMVESATAVAV-------AKAELSESQDKPSVGTRATAESET-TQSELPASAPGSAAWE 153

Query: 278 LIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIV 337
            I IQ   ++         +   + +I+K +     +  L     L+I          ++
Sbjct: 154 SIQIQSGDSLVGIFKRMDLAVAQAIEISK-VPEAKALVSLRTGPYLKIQRDGPA----LL 208

Query: 338 RFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFN 397
                   +  L +   +N  +V  +   + +   +   +        I D ++++   +
Sbjct: 209 VLQYQPNIRTFLHVT-AENQTFVAKLTEREFETQEREVTVE-------ITDSLYQSALRS 260

Query: 398 GMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETR 457
           G+  +++  +       ++    +KP D     F     + +   +  +L +        
Sbjct: 261 GLPESVIYRVTEIFQWELDFSRDVKPGDEFTVIFEERSLDGKKVGNGPILAVRFENDGVL 320

Query: 458 TRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGV 516
               R+++    S  Y+   GKS +   LRTPVP   +TSGF  +  HPIL   R H GV
Sbjct: 321 REAIRYVDSDG-SAAYYTPKGKSLQRAFLRTPVPGRHVTSGFSYKRLHPILKVHRPHLGV 379

Query: 517 DWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVK 576
           D+ APRGTPIVA  DG V +A+  GGYGK  ++ HG  Y + Y H    AK ++ G  VK
Sbjct: 380 DYGAPRGTPIVATADGKVIRASRKGGYGKTIILRHGQNYRTLYAHLSRYAKGMRKGKWVK 439

Query: 577 QGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINS 636
           +GQ+IG++G+TGLSTGPHLHYE+ V+G   +   +++P    +       +    K   S
Sbjct: 440 KGQVIGYVGSTGLSTGPHLHYEIHVDGKARNPLSLKLPRAAPVGRKEKANYLEHAKIWLS 499

Query: 637 LLNNGENPK 645
            L+   +  
Sbjct: 500 RLDEARSST 508


>gi|317402595|gb|EFV83157.1| hypothetical protein HMPREF0005_02269 [Achromobacter xylosoxidans
           C54]
          Length = 469

 Score =  335 bits (858), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 94/454 (20%), Positives = 169/454 (37%), Gaps = 5/454 (1%)

Query: 196 TRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKII 255
           + I+    A    ++                +  L+      L        +     ++I
Sbjct: 10  SSIKRKVAAVFAPVEPKPHRSGLFRRTLLVTAMGLFAG-AAALGMVQQPDRSELPPSRVI 68

Query: 256 EENRTITSPQVLIDKIPEFADDLIP-IQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRV 314
           +    +T+ QV +             I+   T+   +      + D         +   +
Sbjct: 69  QSILPLTTEQVEVSTPSAAPYISETRIRAGDTLAAVLQRLELDSPDLQTFLTHDASARSI 128

Query: 315 DQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQM 374
            +L     ++     + +   +        +     +               K +   + 
Sbjct: 129 YKLYPGRSVQAATDAEGNLIWLRYIHTPGNEADGQVVTR--MLHVARTDAGYKAEEITES 186

Query: 375 DYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVN 434
              +T      I   ++ AT   G+  ++   +   L++ ++    L+  D     + V 
Sbjct: 187 TDRQTRVAVGTIRSSLFGATDAAGIPDSVTMQMADILSAKIDFLRDLRQGDQFRVVYEVR 246

Query: 435 HANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGR 494
             + + +    +L +    G        F      +  Y++ +G S R   LRT + F R
Sbjct: 247 SHDGRYAGAGRVLALEFINGGKTYSAVWFSADN-KTGSYYDFDGTSLRGAFLRTALKFSR 305

Query: 495 MTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNG 554
           ++S FGMR HPI      H GVD+AAP GTPI +  DG VE A W  GYG   ++ H   
Sbjct: 306 ISSTFGMRMHPIHKTWTGHKGVDYAAPSGTPIHSTADGTVEFAGWQNGYGNVVIVKHHGK 365

Query: 555 YVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIP 614
           Y + Y HQ  IA+ I  G+ + QGQ+IG++G TG +TGPHLHYE  V+   +D   V +P
Sbjct: 366 YSTLYAHQSRIAEGITKGSKISQGQLIGYVGATGWATGPHLHYEFRVDNQPIDPLSVDLP 425

Query: 615 ERENLKGDLLQRFAMEKKRINSLLNNGENPKKPL 648
               L+   ++ F          +      ++ L
Sbjct: 426 VARALEPAEIRAFNQAVAPYKQQIQLLTEFQQTL 459


>gi|86148141|ref|ZP_01066440.1| Membrane protein [Vibrio sp. MED222]
 gi|218710459|ref|YP_002418080.1| membrane protein [Vibrio splendidus LGP32]
 gi|85834058|gb|EAQ52217.1| Membrane protein [Vibrio sp. MED222]
 gi|218323478|emb|CAV19655.1| Membrane protein [Vibrio splendidus LGP32]
          Length = 429

 Score =  335 bits (858), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 89/387 (22%), Positives = 160/387 (41%), Gaps = 22/387 (5%)

Query: 256 EENRTITS--PQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVR 313
               + ++               +   ++   +        G S      +     +  +
Sbjct: 50  PLTISASALVSSSDAPPTAVLKWEKYTVRSGESTSVLFERIGLSYRLLITLLNTNNDIKK 109

Query: 314 -VDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINH 372
            +  L   ++L+ G  + +D   + R            ++  ++ +     +      + 
Sbjct: 110 QLSNLRPGDVLQFGFDENNDLIQLKR-----------QLSAFESFKITKSGDSFSSSFDK 158

Query: 373 QMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFS 432
           +    + +    NI    W A    G+ +N +  +       ++    ++  D  +  + 
Sbjct: 159 KEVAYQYNYAEANITSNFWNAGVNAGLTANQIMELAGIFGWDIDFALDIRNNDSFKILYQ 218

Query: 433 VNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPF 492
                 +     +++    +               D S  YF+ENG++ +   LR+P+ F
Sbjct: 219 EKVVEGEVIGRGKIMAAVFKNQGDSFTAVL----DDRSGNYFDENGRAMKKAFLRSPIDF 274

Query: 493 GRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHH 551
            R+TS F  R  HP+ G  R H G D+AAP GTPI A GDGIV+K+ +    G    I H
Sbjct: 275 RRVTSNFNPRRKHPVTGKVRAHRGTDYAAPVGTPIWAAGDGIVQKSGYNQFNGNYVFIRH 334

Query: 552 GNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKV 611
            N Y++ Y H     + +K G  VKQGQ IG +G TG  TGPHLHYE +VNG+  ++  V
Sbjct: 335 SNTYITKYLHMKR--RMVKTGQRVKQGQTIGTLGGTGRVTGPHLHYEFLVNGVHKNARTV 392

Query: 612 RIPERENLKGDLLQRFAMEKK-RINSL 637
           ++P+ ++L G     F    + R+N+L
Sbjct: 393 KLPQSKSLTGKAKATFIANSEIRLNNL 419


>gi|83859258|ref|ZP_00952779.1| peptidase, M23/M37 family protein [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852705|gb|EAP90558.1| peptidase, M23/M37 family protein [Oceanicaulis alexandrii
           HTCC2633]
          Length = 498

 Score =  334 bits (856), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 106/450 (23%), Positives = 181/450 (40%), Gaps = 34/450 (7%)

Query: 209 IKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLI 268
            +               +S     A    L+     P +            T  +     
Sbjct: 46  AQAQTEMADDDATEMSAESADADDAAVSPLEALDAAPQSSVL---------TEHALFTNP 96

Query: 269 DKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVV 328
           +K P      + ++   T    +  AG    D+A+   AL        L   + L +   
Sbjct: 97  NKRPAVHSVDVTVRRGQTFASVLSDAGADRVDAARAINALDPLYAARLLRAGQDLTLYFE 156

Query: 329 QKD---------------DKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQ 373
                                 +  FS    Q+  LT++ +   ++        +     
Sbjct: 157 TPAPYEIQHAFNTEEGSVSTTRLAGFSFRPDQERTLTVSRDGQGQFHAREATASLRREVV 216

Query: 374 MDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSV 433
                       +   ++ +    G    +V  +   L  +V+    ++P D  +  F  
Sbjct: 217 RVR-------GEVSSSLYLSAIELGATDRVVFELANILGFAVDF-RTVQPGDPFDVVFER 268

Query: 434 N-HANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPF 492
             ++  +     ++LY+          ++R+       V Y+   G+S++  L+R P+  
Sbjct: 269 FVNSRGETVRTGDILYVVFDGRGDPLEYFRYEMDDG-EVGYYTGEGESAQRLLMRMPING 327

Query: 493 GRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHG 552
            R++S FGMR+HP+L  +R H G D+AAPRGTP++A G GIVE+AN  G +G    I H 
Sbjct: 328 ARISSSFGMRFHPVLNRNRPHNGTDFAAPRGTPVMAAGAGIVERANRFGSFGNYVRIRHA 387

Query: 553 NGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVR 612
           NGY ++Y H    A  ++AGT V+QGQII ++GTTG STGPHLHYE+ +NG   +   + 
Sbjct: 388 NGYQTAYAHLQGFASGVRAGTRVQQGQIIAYVGTTGRSTGPHLHYEVHLNGNPTNPMSLD 447

Query: 613 IPERENLKGDLLQRFAMEKKRINSLLNNGE 642
           +P    L+ D L  F   +  +  + +N  
Sbjct: 448 LPTGRRLEADELDDFTRARDELLQIRDNAP 477


>gi|293603318|ref|ZP_06685746.1| M23/M37 family peptidase [Achromobacter piechaudii ATCC 43553]
 gi|292818228|gb|EFF77281.1| M23/M37 family peptidase [Achromobacter piechaudii ATCC 43553]
          Length = 469

 Score =  334 bits (856), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 93/442 (21%), Positives = 171/442 (38%), Gaps = 5/442 (1%)

Query: 208 EIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVL 267
            ++                +  L+      L        T     +II+    +T+ QV 
Sbjct: 22  PVEPKPHRSGLFRRTLLVTAIGLFAG-AAALGMVQQPDRTELPPSRIIQSVLPLTAEQVE 80

Query: 268 IDKIPEFADDLIP-IQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIG 326
           +             I+   T+   +      + +         +   + +L     ++  
Sbjct: 81  VSTPSAAPYISETRIRAGDTLAAVLQRLELDSPNLQTFLTHDASARSIYKLYPGRSVQAA 140

Query: 327 VVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNI 386
             ++ +   +        +     +            +  K +   +    +T      I
Sbjct: 141 TDEQGNLIWLRYIHTPGNETDGQVVTR--MLHVAPAGDTYKAEEVTESTERQTRVAVGTI 198

Query: 387 YDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSEL 446
              ++ AT   G+  ++   +   L++ ++    L+  D     + V   + + +    +
Sbjct: 199 KSSLFGATDTAGIPDSVTMQMADILSAKIDFLRDLRQGDQFRVVYEVRSHDGRYAGAGRV 258

Query: 447 LYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPI 506
           L +    G        F +P + S  Y++ +G S R   LRT + F R++S FGMR HPI
Sbjct: 259 LALEFINGGKTYSAVWF-SPDEKSGSYYDFDGTSLRGAFLRTALKFSRISSTFGMRMHPI 317

Query: 507 LGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIA 566
                 H GVD+AAP GTPI +  DG VE + W  GYG   ++ H   Y + Y HQ  IA
Sbjct: 318 HKTWTGHKGVDYAAPSGTPIHSTADGTVEFSGWQNGYGNVVIVKHHGKYSTLYAHQSRIA 377

Query: 567 KNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQR 626
           + I  G+ + QGQ++G++G+TG +TGPHLHYE  V+   +D   V +P    L+   ++ 
Sbjct: 378 EGITKGSKISQGQLLGYVGSTGWATGPHLHYEFRVDNQPIDPLSVDLPVARALEPAEVRA 437

Query: 627 FAMEKKRINSLLNNGENPKKPL 648
           F          +      ++ L
Sbjct: 438 FNQAVAPYKQQIQLLTQFQQTL 459


>gi|148979045|ref|ZP_01815290.1| Membrane protein [Vibrionales bacterium SWAT-3]
 gi|145962018|gb|EDK27306.1| Membrane protein [Vibrionales bacterium SWAT-3]
          Length = 429

 Score =  334 bits (855), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 86/375 (22%), Positives = 154/375 (41%), Gaps = 19/375 (5%)

Query: 260 TITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVR-VDQLT 318
           +                +   ++   +        G S      +    K+  + +  L 
Sbjct: 56  SALVSSNDAPPTAVLNWEKYTVRSGESTSVLFERIGLSYRLLLNLLNTNKDIKKQLSNLR 115

Query: 319 KDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMR 378
             ++L+ G  + +D   + R            ++  ++ +     +      + +    +
Sbjct: 116 PGDVLQFGFDENNDLIQLKR-----------QLSAFESFKITKSGDSFTSSFDKKEVAYQ 164

Query: 379 TSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANN 438
            +    NI    W A    G+ +N +  +       ++    ++  D  +  +       
Sbjct: 165 YNYAEANITSNFWNAGVSAGLTANQIMELAGIFGWDIDFALDIRKNDSFKILYQEKVVEG 224

Query: 439 QASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSG 498
           +     +++    +               D S  Y++ENG++ +   LR+P+ F R+TS 
Sbjct: 225 EVIGRGKIMAAVFKNQGDSFTAVL----DDKSGNYYDENGRAMKKAFLRSPIDFRRVTSN 280

Query: 499 FGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVS 557
           F  R  HP+ G  R H G D+AAP GTPI A GDGIV+K+ +    G    I H N Y++
Sbjct: 281 FNPRRKHPVTGKVRAHRGTDYAAPVGTPIWAAGDGIVQKSGYNQFNGNYVFIRHSNTYIT 340

Query: 558 SYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERE 617
            Y H     + +K G  VKQGQ IG +G TG  TGPHLHYE +VNG+  ++  V++P+ +
Sbjct: 341 KYLHMKK--RMVKTGQRVKQGQTIGTLGGTGRVTGPHLHYEFLVNGVHKNARTVKLPQSK 398

Query: 618 NLKGDLLQRFAMEKK 632
           +L G     F    +
Sbjct: 399 SLTGKAKATFIANSE 413


>gi|297182953|gb|ADI19101.1| membrane proteins related to metalloendopeptidases [uncultured
           alpha proteobacterium HF0070_34A12]
          Length = 460

 Score =  334 bits (855), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 117/428 (27%), Positives = 188/428 (43%), Gaps = 23/428 (5%)

Query: 211 NAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDK 270
             + +    L   K     LY A+P  +      P   +   +     RT+    +    
Sbjct: 31  EPVRSDGMPLPQSKPDLALLYPAEPVEISLPVPRPDPRTILPRA---TRTVAEMYLQQTG 87

Query: 271 IPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQK 330
                D L  +++   +   +  AGY   D A    A+ +   +  L     +R+     
Sbjct: 88  TETDKDALYTLKNGEGLGKLLHRAGYEATDVAAAVDAVSSRASLRALPVGLDVRVTPGAF 147

Query: 331 DDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGI 390
                  R            IA +                  +      S     I D I
Sbjct: 148 AFTTRNGREIFAIDDPEEGWIAFS----------------AIRPVERYLSFAQGVINDSI 191

Query: 391 WRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHA--NNQASDDSELLY 448
           +RA + + +  + +   +R +  SV+ Q  ++  D  E  +       + +     +L Y
Sbjct: 192 YRAAADSNIPDDALAEYVRIMGFSVDFQREIRSGDAFELLYEQQIDQISGEKIAT-KLHY 250

Query: 449 IHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILG 508
                  ++  FYRF +     V +++ NG S+   L+RTP+   R++S +GMR HPI G
Sbjct: 251 AGLMLSGSQIGFYRF-DHDGSRVGWYDRNGNSAARTLIRTPISGARLSSSYGMRKHPISG 309

Query: 509 YSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKN 568
           Y+RMH GVD+AAP GTPI+A G G+V K+ W G YG+   I H + Y ++Y H   IA+ 
Sbjct: 310 YNRMHKGVDFAAPTGTPIIAAGSGVVTKSGWLGSYGRYIRIRHNSTYDTAYAHMSRIARG 369

Query: 569 IKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFA 628
           I  G  V+QGQIIG++G++G STGPHLHYE++VN  KV+   V +P  E +  +LL  F 
Sbjct: 370 ITPGRRVEQGQIIGYVGSSGHSTGPHLHYEILVNNRKVNPLTVSLPTGEKIPAELLVDFR 429

Query: 629 MEKKRINS 636
              + + +
Sbjct: 430 SHVELVEA 437


>gi|262393368|ref|YP_003285222.1| membrane protein [Vibrio sp. Ex25]
 gi|262336962|gb|ACY50757.1| membrane protein [Vibrio sp. Ex25]
          Length = 353

 Score =  334 bits (855), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 90/359 (25%), Positives = 154/359 (42%), Gaps = 20/359 (5%)

Query: 282 QHNTTIFDAMVHAGYSNGDSAKIAKALKNEVR-VDQLTKDEILRIGVVQKDDKFTIVRFS 340
           ++  +        G S      +  + K   + + +L   + L+ G  + +D   + R  
Sbjct: 2   KNGESAAILFSRVGLSARLLHDLVSSDKEVEKQLTRLRPGDRLQFGFDENNDLVQLRRTL 61

Query: 341 IYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMN 400
                          + +YV  V+  ++D          +     I    W A   +G+N
Sbjct: 62  ----SAFETFRITLKDGKYVSEVDKKEVDFQ-------YNYAEATIKSNFWNAGISSGLN 110

Query: 401 SNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRF 460
            N +  +       ++    ++  D     +       +     +++    +        
Sbjct: 111 GNQIMELAGIFGWDIDFALDIRKNDSFRVLYQEEVVEGEVIGRGKIIAAIFKNQGDTFTA 170

Query: 461 YRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWA 519
                    S +Y++ENG++ +   LR P+ F R++S F  R  HP+ G  R H G D+A
Sbjct: 171 IL----DQKSGKYYDENGRAMKKAFLRAPLDFRRVSSNFNPRRLHPVTGRVRPHRGTDYA 226

Query: 520 APRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQ 579
           AP GTPI A GDG+V+K+++    G    I H N Y++ Y H     + ++AG  VKQGQ
Sbjct: 227 APVGTPIWAAGDGVVQKSSYNKFNGNYVFIKHSNTYITKYLHLTK--RTVRAGQRVKQGQ 284

Query: 580 IIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAME-KKRINSL 637
            IG +G TG  TGPHLHYE +VNG+  +   V +P+ ++L G   Q F    K  ++ L
Sbjct: 285 TIGTLGGTGRVTGPHLHYEFLVNGVHKNPRTVNLPQSKSLTGKARQTFMANAKISMDKL 343


>gi|54296596|ref|YP_122965.1| hypothetical protein lpp0627 [Legionella pneumophila str. Paris]
 gi|53750381|emb|CAH11775.1| hypothetical protein lpp0627 [Legionella pneumophila str. Paris]
          Length = 477

 Score =  333 bits (854), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 80/381 (20%), Positives = 153/381 (40%), Gaps = 17/381 (4%)

Query: 272 PEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKD 331
            +    ++  +   ++       G +  +   + K   +   + ++  ++ L+  + +  
Sbjct: 104 KDNEWQIVNPRSGDSMATIFHRLGLTAQNLNDVIKNNPHAKMLTRIKPNQKLQFLIKKN- 162

Query: 332 DKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIW 391
               + +  +       LT+            +  K  I+ +    +    +  +   ++
Sbjct: 163 ---KLEKLIVPVNTIQTLTVYR--------AGKIYKTKIDSKKTTTQNRYVTATVQGSLY 211

Query: 392 RATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHA 451
                  + S LV+ +       ++    L+  D     +   +  ++     ++L +  
Sbjct: 212 TTAQRFNIPSKLVRQMTTIFNKEIDFSRSLRSGDQFSIIYDAYYIEDKMVGVGDILVVTY 271

Query: 452 RFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYS 510
                  +  R      G  +YF   G S +    R P+ F  ++S F +   HPIL Y 
Sbjct: 272 TNRGKTYQAIRH-TNAHGEQDYFTPQGTSFKKAFTRYPIKFSHISSTFALSRYHPILHYR 330

Query: 511 RMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIK 570
           R H G+D AAP GTPI A GDG++   +   GYG    I H   Y + Y H     K + 
Sbjct: 331 RAHKGIDLAAPIGTPIHATGDGVITIIDRHNGYGNMIKIKHDKTYSTVYGHLLKFQKGLS 390

Query: 571 AGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAME 630
            G+ VK+GQ+IG++G TGL+TGPH HYEL VN    + T + +P    +    +  F   
Sbjct: 391 KGSRVKRGQVIGYVGQTGLATGPHCHYELHVNNQPRNPTTISLPTAAPVPAREMAAFKA- 449

Query: 631 KKRINSLLNNGENPKKPLFTS 651
             + ++LL   +  ++    S
Sbjct: 450 --KASTLLARLKLFEQAQLAS 468


>gi|262163956|ref|ZP_06031695.1| membrane protein [Vibrio mimicus VM223]
 gi|262172294|ref|ZP_06039972.1| membrane protein [Vibrio mimicus MB-451]
 gi|261893370|gb|EEY39356.1| membrane protein [Vibrio mimicus MB-451]
 gi|262027484|gb|EEY46150.1| membrane protein [Vibrio mimicus VM223]
          Length = 431

 Score =  333 bits (854), Expect = 5e-89,   Method: Composition-based stats.
 Identities = 88/428 (20%), Positives = 172/428 (40%), Gaps = 22/428 (5%)

Query: 227 SFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTT 286
            F +++       +  +  +   +   I  +N   ++             +   +++  +
Sbjct: 24  VFAVFFLPNAESLRNPNSQLEIGRHYPITLDNELFSTNDDPQAPTALLRWETYQVRNGES 83

Query: 287 IFDAMVHAGYSNGDSAKIAKALKNEVR-VDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQ 345
                  AG S+    ++  +  +    + +L   + L+ G  + +    + R       
Sbjct: 84  AAVLFQRAGLSSRVLYELTSSNSDINSQLSKLMPKDELKFGFDENNQLVQLKRTI---SP 140

Query: 346 KHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVK 405
                +  +D+            + + +  + + +     I    W A    G+++N + 
Sbjct: 141 YETFVVTRSDSG--------FTSEFDKKEVFYQFNYAEAKITSSFWNAGMAAGLSANQIM 192

Query: 406 LIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLN 465
            +       ++    ++  D  +  +              ++        T         
Sbjct: 193 ELAGLFGWDIDFALDIREGDQFKLLYQEKIVEGTVIGRGNIIAATFTNQGTTFTAIL--- 249

Query: 466 PVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGT 524
             D +  Y++ENG++ +   LR+P+ F R++S F  R  HP+ G  + H G D+ AP GT
Sbjct: 250 -DDNTGNYYDENGRAMKKAFLRSPLDFRRVSSNFNPRRLHPVTGQVKAHRGTDYVAPVGT 308

Query: 525 PIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWI 584
           PI A GDG+VEK+++    G    I H N Y++ Y H     + +K G  VKQGQ IG +
Sbjct: 309 PIWAAGDGVVEKSSYNQFNGNYVYIRHSNTYITKYLHLQR--RLVKTGQRVKQGQSIGTL 366

Query: 585 GTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENP 644
           G TG  TGPHLHYE +VNG+  +   V +P+ ++L G   + F    K+    +   E  
Sbjct: 367 GGTGRVTGPHLHYEFLVNGVHKNPRTVELPQAQSLSGKAKETFIANAKQ---RMAKLERY 423

Query: 645 KKPLFTSH 652
            + L+ + 
Sbjct: 424 SQLLYANQ 431


>gi|88704555|ref|ZP_01102268.1| peptidase M37 family protein [Congregibacter litoralis KT71]
 gi|88700876|gb|EAQ97982.1| peptidase M37 family protein [Congregibacter litoralis KT71]
          Length = 470

 Score =  333 bits (854), Expect = 5e-89,   Method: Composition-based stats.
 Identities = 90/441 (20%), Positives = 171/441 (38%), Gaps = 17/441 (3%)

Query: 213 IMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIP 272
           +     +  +    +         T D         +  ++  E   T+           
Sbjct: 35  VALAAIITPSGDVNATRSVAETGLTSDSASLPEQDVAPILEAAEAVATVDKLTEAPTPPA 94

Query: 273 EFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDD 332
               +   ++    +      AG+S  D  +I         ++++   + L     +   
Sbjct: 95  SQPWEEFIVRSGDNLSLLFKRAGFSTADVYQIVHTAPQGRDLERIYPGQSLAFLRDESGG 154

Query: 333 KFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWR 392
              +              +    +  +         +   +    R +  +  I   ++ 
Sbjct: 155 LSAVRHTI----NGLQSVVYRRMDGGFSS-------ERKVREPEQRLNWATVEIESSMFL 203

Query: 393 ATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHAR 452
           A    G++SNL+      L+  ++     +  D +E  +   + + +  +D +++     
Sbjct: 204 AGKEAGLSSNLIMEAAIILSGVIDFVMDPRKGDTMEILYEELYLDGEKYEDGKVVAASYT 263

Query: 453 FGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSR 511
               R   YR+++       Y+NE G S R   L  PV F R++SGF  R  HPI    R
Sbjct: 264 NRGERFDAYRYIDSNG-MTSYYNEEGVSMRKAFLMAPVDFTRISSGFNPRRRHPIYKTVR 322

Query: 512 MHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKA 571
            H G D+AAPRGTP+ + GDG V +A +    G    I HG+ Y + Y H +   + +K 
Sbjct: 323 PHNGTDYAAPRGTPVFSAGDGRVIEAGYTRANGNYVFIQHGDRYTTKYLHLNK--RKVKR 380

Query: 572 GTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVR--IPERENLKGDLLQRFAM 629
           G  V Q Q+IG +G+TG +TGPHLHYE +V G+  +   +   +P+ ++L  + + RF +
Sbjct: 381 GQRVVQSQVIGTVGSTGAATGPHLHYEFLVGGVHRNPRTIHKSLPKAKSLPKEEMPRFRV 440

Query: 630 EKKRINSLLNNGENPKKPLFT 650
                ++ L      ++    
Sbjct: 441 AIAEASTRLAQLREERRLAKA 461


>gi|30249401|ref|NP_841471.1| M23/M37 familypeptidase [Nitrosomonas europaea ATCC 19718]
 gi|30138764|emb|CAD85341.1| Peptidase family M23/M37 [Nitrosomonas europaea ATCC 19718]
          Length = 443

 Score =  333 bits (854), Expect = 5e-89,   Method: Composition-based stats.
 Identities = 107/448 (23%), Positives = 177/448 (39%), Gaps = 22/448 (4%)

Query: 205 QDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQ-----TLDQRHDHPITYSKKIKIIEENR 259
              + ++ +  +  +L  KK +  T+  + P            D P       KI+   R
Sbjct: 6   SPRKRRSILAQKLAVLAQKKVRWITILSSLPLFGMVTAFGIVPDAPPHEIPGKKIV---R 62

Query: 260 TITSPQVLIDKIPEFA-DDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLT 318
            +  P+      PE        I+   TI   +     S  D      A +    + QL 
Sbjct: 63  PLQLPEKFASSDPEMTFWHQESIRRGDTIVAILARLEISQEDKNNFLDATRGSKAMSQLK 122

Query: 319 KDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMR 378
             E++        +  T+  F               +  +        ++          
Sbjct: 123 PGEVVHAETRPDGELLTLRYF-----------YGNGEQFQVEKVDGAFELSEQSGKSDTH 171

Query: 379 TSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANN 438
               S  I   ++ A     + S +   ++   +SS++    ++  D+    +       
Sbjct: 172 IQIGSGVISTSLFAAVDKADLPSTIASQMIDIFSSSIDFHRDIQKGDYFTVVYESRQDEG 231

Query: 439 QASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSG 498
                  +L +         R   F  P DG  EY+   G+S R   L  P+ F R++SG
Sbjct: 232 GKIQVGRVLAVEFFNKGKSRRAVYFQ-PSDGKGEYYTPEGESLRRPFLMAPLKFSRISSG 290

Query: 499 FGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVS 557
           F     HPIL   R H GVD+AAPRG P++A  DGIVE   W  GYG   ++ H   Y S
Sbjct: 291 FSNARYHPILKRWRAHRGVDYAAPRGVPVMATADGIVEYKGWQNGYGNLVVLKHNAQYSS 350

Query: 558 SYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERE 617
           +Y H     K ++ G  V+QG +IG++G+TG++TGPHLHYEL VNG++ D +++ +P  +
Sbjct: 351 AYGHLSGFDKRLQKGKRVRQGDVIGFVGSTGMATGPHLHYELRVNGVQRDPSRIVMPAAQ 410

Query: 618 NLKGDLLQRFAMEKKRINSLLNNGENPK 645
            +       F  +   + S L+   N  
Sbjct: 411 PISKKHYSTFRRQTSELLSQLDLLRNSS 438


>gi|258625585|ref|ZP_05720471.1| conserved hypothetical protein [Vibrio mimicus VM603]
 gi|258582138|gb|EEW07001.1| conserved hypothetical protein [Vibrio mimicus VM603]
          Length = 409

 Score =  333 bits (854), Expect = 5e-89,   Method: Composition-based stats.
 Identities = 86/413 (20%), Positives = 167/413 (40%), Gaps = 22/413 (5%)

Query: 242 HDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDS 301
            +  +   +   I  +N   ++             +   +++  +       AG S+   
Sbjct: 17  PNSQLEIGRHYPITLDNELFSTNDDPQAPTALLRWETYQVRNGESAAVLFQRAGLSSRVL 76

Query: 302 AKIAKALKNEVR-VDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYV 360
            ++  +  +    + +L   + L+ G  + +    + R            +  +D+    
Sbjct: 77  YELTSSNSDINSQLSKLMPKDELKFGFDENNQLVQLKRTI---SPYETFVVTRSDSG--- 130

Query: 361 LGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEH 420
                   + + +  + + +     I    W A    G+++N +  +       ++    
Sbjct: 131 -----FTSEFDKKEVFYQFNYAEAKITSSFWNAGMAAGLSANQIMELAGLFGWDIDFALD 185

Query: 421 LKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKS 480
           ++  D  +  +              ++        +           D +  Y++ENG++
Sbjct: 186 IREGDQFKLLYQEKIVEGTVIGRGNIIAATFTNQGSTFTAIL----DDNTGNYYDENGRA 241

Query: 481 SRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANW 539
            +   LR+P+ F R++S F  R  HP+ G  + H G D+ AP GTPI A GDG+VEK+++
Sbjct: 242 MKKAFLRSPLDFRRVSSNFNPRRLHPVTGQVKAHRGTDYVAPVGTPIWAAGDGVVEKSSY 301

Query: 540 AGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYEL 599
               G    I H N Y++ Y H     + +K G  VKQGQ IG +G TG  TGPHLHYE 
Sbjct: 302 NQFNGNYVYIRHSNTYITKYLHLQR--RLVKTGQRVKQGQSIGTLGGTGRVTGPHLHYEF 359

Query: 600 IVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
           +VNG+  +   V +P+ ++L G   + F    K+    +   E   + L+ + 
Sbjct: 360 LVNGVHKNPRTVELPQAQSLSGKAKETFIANAKQ---RMAKLERYSQLLYANQ 409


>gi|270159219|ref|ZP_06187875.1| putative M23/M37 family peptidase [Legionella longbeachae D-4968]
 gi|289165955|ref|YP_003456093.1| peptidase family M23 [Legionella longbeachae NSW150]
 gi|269987558|gb|EEZ93813.1| putative M23/M37 family peptidase [Legionella longbeachae D-4968]
 gi|288859128|emb|CBJ13057.1| putative peptidase family M23 [Legionella longbeachae NSW150]
          Length = 506

 Score =  333 bits (853), Expect = 7e-89,   Method: Composition-based stats.
 Identities = 80/395 (20%), Positives = 158/395 (40%), Gaps = 15/395 (3%)

Query: 252 IKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNE 311
            K + EN  + + +     + +     I  +   ++       G +  +   + +   + 
Sbjct: 108 AKAVVENV-VNAIKPAKQIVKDNEWQTIKPRSGDSMAIIFKRLGLTAQNLQLVLQKNPHA 166

Query: 312 VRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDIN 371
             +  +   + L+  + +      + +  I       LT+  +            K  + 
Sbjct: 167 KALTAINPKQELKFLINKH----KLEKLIIPMNNIQTLTVYRD--------GAVYKTKVE 214

Query: 372 HQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFF 431
            +    +    S  +   ++      G+   L++ +   L   ++    ++  D     +
Sbjct: 215 SKKVTTKERYISGVVKGSLYTTAQSLGIPRKLIQQMTTILRKEIDFSRSIRSGDRFSIAY 274

Query: 432 SVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVP 491
              +  ++     +++ +         +  R ++    + +Y+   G+S +    R P+ 
Sbjct: 275 ESFYVEDKMVGIGDVVAVSYTNQGKTAQAVRHISRNG-NRDYYTPKGESFKKAFSRYPIK 333

Query: 492 FGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIH 550
           F  ++S F     HPIL Y R H GVD AAP GTPI +VGDGI+       GYG    I 
Sbjct: 334 FSHISSTFSASRQHPILHYRRAHKGVDLAAPIGTPIQSVGDGIITNIGRHNGYGNMIEIK 393

Query: 551 HGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTK 610
           H   Y + Y H     K +  G+ +++GQ+IG++G TGL+TGPH HYEL V+    + T 
Sbjct: 394 HDKTYSTLYGHMLRFEKGLSKGSKIRRGQVIGYVGQTGLATGPHCHYELHVHNQPRNPTT 453

Query: 611 VRIPERENLKGDLLQRFAMEKKRINSLLNNGENPK 645
             +P    +    +  F  + ++I +     ENP 
Sbjct: 454 TYLPTASPVPAREMAVFKAKTQKIFAQFKLLENPN 488


>gi|323495917|ref|ZP_08100985.1| hypothetical protein VISI1226_02425 [Vibrio sinaloensis DSM 21326]
 gi|323319133|gb|EGA72076.1| hypothetical protein VISI1226_02425 [Vibrio sinaloensis DSM 21326]
          Length = 428

 Score =  332 bits (852), Expect = 8e-89,   Method: Composition-based stats.
 Identities = 93/416 (22%), Positives = 168/416 (40%), Gaps = 20/416 (4%)

Query: 225 NQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHN 284
           +      +  P   + R D       K   +  + +    +   + +     +   I   
Sbjct: 20  SALIVFAFFLPTPQELRPDERHYQLGKAYPLAIDPSALELEQRDNHLGLLRWEKHTIGSG 79

Query: 285 TTIFDAMVHAGYSNGDSAKIAKALKN-EVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYH 343
            ++      AG S+    +IA + K+   R+ ++   +    G  +K+    I      +
Sbjct: 80  DSMALLFQRAGLSSRLLHQIASSDKDIARRITKIRPGDSFYFGFDEKNTLIQIKSKISAN 139

Query: 344 KQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNL 403
           +      +   +              I  +  + + +     I    W A    G+ +N 
Sbjct: 140 ET---YLVTRTEQG--------FTASIEKKEVHYQYNYAGNVITSNFWNAGVGAGLTANQ 188

Query: 404 VKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRF 463
           +  +       ++    ++  D  E  +       +     +++                
Sbjct: 189 IMELAGIFGWDIDFALDIRKHDSFEILYQEKVVEGEVVGRGKIIAAIFNNQGDTFTAIL- 247

Query: 464 LNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPR 522
               + S +Y++ENG++ +   LR P+ F R++S F  R  HP+ G  R H G D+AAP 
Sbjct: 248 ---DEKSGKYYDENGRAMKKAFLRAPLDFRRVSSNFNPRRLHPVTGRVRPHRGTDYAAPV 304

Query: 523 GTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIG 582
           GTPI A GDG V K+++    G    I H N Y++ Y H     + +K G  VKQGQ IG
Sbjct: 305 GTPIWAAGDGTVIKSSYNQFNGNYVFIKHSNIYITKYLHLTK--RMVKTGQRVKQGQTIG 362

Query: 583 WIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKK-RINSL 637
            +G TG  TGPHLHYE +VNG+  ++  V++P+ ++L G     F    K +++ L
Sbjct: 363 TLGGTGRVTGPHLHYEFLVNGVHKNARTVKLPQSKSLTGKAKTTFIANAKVKLDKL 418


>gi|268317152|ref|YP_003290871.1| Peptidase M23 [Rhodothermus marinus DSM 4252]
 gi|262334686|gb|ACY48483.1| Peptidase M23 [Rhodothermus marinus DSM 4252]
          Length = 435

 Score =  332 bits (852), Expect = 8e-89,   Method: Composition-based stats.
 Identities = 94/437 (21%), Positives = 163/437 (37%), Gaps = 25/437 (5%)

Query: 203 TAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTIT 262
           T +  E+K ++     LL          Y        +  D P   ++            
Sbjct: 3   TPRTVEVKRSVRFFLPLLLVGAAVMALWYI-----RSRPIDAPSEPARSAVFRPITI--- 54

Query: 263 SPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEI 322
                  +   F      I+   T  D +        D   +A+A ++   V +L     
Sbjct: 55  VYDAFGIEEDAFERSTHRIRRGETFADILTRYEVPYADVLALAEAARDVFNVRRLQAGRP 114

Query: 323 LRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEE 382
             I       +     F         +   L D         PV++    +         
Sbjct: 115 FHIYRDSTGARV----FVYQPDPVRYVVFDLRD---------PVRVYTGRRAVERVLRTA 161

Query: 383 SPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASD 442
              I   ++        +  L   +    A  ++    ++  D     +     + +   
Sbjct: 162 QGVIESSLYETLQATEADPELAIRLSEIFAWQIDFYR-IQRGDRFVALYEETLIDGEPVG 220

Query: 443 DSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMR 502
              +L    +        +RF +     V+Y++E G++ R   L+ P+ + R+TS + +R
Sbjct: 221 IERVLAARFQHMGEDFYAFRFEHDGG--VDYYDEAGRNLRKAFLKAPLRYSRITSRYSLR 278

Query: 503 Y-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNH 561
             HP+    + H G D+AAP GTP+ A GDG+V +A +    G    I H   Y + Y H
Sbjct: 279 RFHPVQKRYKPHLGTDYAAPAGTPVYATGDGVVIEAGYTRYNGYYVKIRHNAVYTTGYLH 338

Query: 562 QDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKG 621
              IAK I+ G  V+QGQ+IG++G+TGL+TGPH+ Y    NG +VD  + ++P  E +  
Sbjct: 339 FSRIAKGIRPGVRVRQGQVIGYVGSTGLATGPHVCYRFWKNGRQVDPLREQLPPGEPVPD 398

Query: 622 DLLQRFAMEKKRINSLL 638
            L   F   + R+   L
Sbjct: 399 SLRDAFFTLRDRLMPRL 415


>gi|269104990|ref|ZP_06157686.1| cell wall endopeptidase family M23/M37 [Photobacterium damselae
           subsp. damselae CIP 102761]
 gi|268161630|gb|EEZ40127.1| cell wall endopeptidase family M23/M37 [Photobacterium damselae
           subsp. damselae CIP 102761]
          Length = 446

 Score =  332 bits (852), Expect = 8e-89,   Method: Composition-based stats.
 Identities = 84/390 (21%), Positives = 153/390 (39%), Gaps = 18/390 (4%)

Query: 264 PQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEIL 323
           P+ +I  +P        I+   T+         S  D  K+ ++  + +++D L   + L
Sbjct: 65  PETIIKTVPLPPQFEYTIKKGDTLSGVFSKLNVSREDMQKVMESDLDSLKIDTLKPGDTL 124

Query: 324 RIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEES 383
           R  + + +    + +F +              + ++       +          +++  S
Sbjct: 125 RFWLDENNH--KLTKFELQQTPAQKFDYVRTPSGDF-------EYQETTLPGQWKSAVAS 175

Query: 384 PNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDD 443
             I+     +    G++ + V  I   L   +N    L+  D  E        + + +  
Sbjct: 176 GTIHGSFSVSAQKAGLDYSEVLEITNLLKDKLNFARDLRAGDTFEVVHERQFIDGKPTGQ 235

Query: 444 SELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGR-MTSGFGMR 502
            E+  I           Y   +       Y++E+G S +   LR P      ++S F   
Sbjct: 236 HEVRAIRIHNKGKIISAYLHTDGN-----YYDEDGNSLQRAFLRYPSAKQWRISSNFNPN 290

Query: 503 Y-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNH 561
             HP+ G  + H GVD+AAPRGTP++A GDG+V         G+  +I HG  Y + Y H
Sbjct: 291 RKHPVTGRRQPHNGVDFAAPRGTPVLATGDGVVVLTTNHPYAGRYIVIQHGTNYKTRYLH 350

Query: 562 QDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKG 621
              I   +K G  V +GQ I   G+TG  TGPH+HYE ++    V+     IP   ++ G
Sbjct: 351 NTKIL--VKKGQRVHRGQEIALSGSTGRVTGPHIHYEFLIRNKPVNPMTANIPMASSVPG 408

Query: 622 DLLQRFAMEKKRINSLLNNGENPKKPLFTS 651
              + F     + N ++ +  + +      
Sbjct: 409 KEKKVFEQMVAQYNQMMKDPMSAETIQLAR 438


>gi|296106155|ref|YP_003617855.1| peptidase, M23/M37 family [Legionella pneumophila 2300/99 Alcoy]
 gi|295648056|gb|ADG23903.1| peptidase, M23/M37 family [Legionella pneumophila 2300/99 Alcoy]
          Length = 477

 Score =  332 bits (852), Expect = 8e-89,   Method: Composition-based stats.
 Identities = 80/381 (20%), Positives = 152/381 (39%), Gaps = 17/381 (4%)

Query: 272 PEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKD 331
            +    ++      ++       G +  +   + K   +   + ++  ++ L+  + +  
Sbjct: 104 KDNEWQIVNPHSGDSMATIFHRLGLTAQNLNDVIKNNPHAKMLTRIKPNQKLQFLIKKN- 162

Query: 332 DKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIW 391
               + +  +       LT+            +  K  I+ +    +    +  +   ++
Sbjct: 163 ---KLEKLIVPVNTIQTLTVYR--------AGKIYKTKIDSKKTTTQNRYVTATVQGSLY 211

Query: 392 RATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHA 451
                  + S LV+ +       ++    L+  D     +   +  ++     ++L +  
Sbjct: 212 TTAQRFNIPSKLVRQMTTIFNKEIDFSRSLRSGDQFSIIYDAYYIEDKMVGVGDILVVTY 271

Query: 452 RFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYS 510
                  +  R      G  +YF   G S +    R P+ F  ++S F +   HPIL Y 
Sbjct: 272 TNRGKTYQAIRH-TNAHGEQDYFTPQGTSFKKAFTRYPIKFSHISSTFALSRYHPILHYR 330

Query: 511 RMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIK 570
           R H G+D AAP GTPI A GDG++   +   GYG    I H   Y + Y H     K + 
Sbjct: 331 RAHKGIDLAAPIGTPIHATGDGVITIIDRHNGYGNMIKIKHDKTYSTVYGHLLKFQKGLS 390

Query: 571 AGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAME 630
            G+ VK+GQ+IG++G TGL+TGPH HYEL VN    + T + +P    +    +  F   
Sbjct: 391 KGSRVKRGQVIGYVGQTGLATGPHCHYELHVNNQPRNPTTISLPTAAPVPAREMAAFKA- 449

Query: 631 KKRINSLLNNGENPKKPLFTS 651
             + ++LL   +  ++    S
Sbjct: 450 --KASTLLARLKLFEQAQLAS 468


>gi|148360778|ref|YP_001251985.1| M23/M37 family transporter peptidase [Legionella pneumophila str.
           Corby]
 gi|148282551|gb|ABQ56639.1| peptidase, M23/M37 family [Legionella pneumophila str. Corby]
          Length = 477

 Score =  332 bits (852), Expect = 9e-89,   Method: Composition-based stats.
 Identities = 80/381 (20%), Positives = 152/381 (39%), Gaps = 17/381 (4%)

Query: 272 PEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKD 331
            +    ++      ++       G +  +   + K   +   + ++  ++ L+  + +  
Sbjct: 104 KDNEWQIVNPHSGDSMATIFHRLGLTAQNLNDVIKNNPHAKMLTRIKPNQKLQFLIKKN- 162

Query: 332 DKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIW 391
               + +  +       LT+            +  K  I+ +    +    +  +   ++
Sbjct: 163 ---KLEKLIVPVNTIQTLTVYR--------AGKIYKTKIDSKKTTTQNRYVTATVQGSLY 211

Query: 392 RATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHA 451
                  + S LV+ +       ++    L+  D     +   +  ++     ++L +  
Sbjct: 212 TTAQRFNIPSKLVRQMTTIFNKEIDFSRSLRSGDQFSIIYDAYYIEDKMVGVGDILVVTY 271

Query: 452 RFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYS 510
                  +  R      G  +YF   G S +    R P+ F  ++S F +   HPIL Y 
Sbjct: 272 TNRGKTYQAIRH-TNAHGEQDYFTPQGTSFKKAFTRYPIKFSHISSTFALSRYHPILHYR 330

Query: 511 RMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIK 570
           R H G+D AAP GTPI A GDG++   +   GYG    I H   Y + Y H     K + 
Sbjct: 331 RAHKGIDLAAPIGTPIHATGDGVITIIDRHNGYGNMIKIKHDKTYSTVYGHLLKFQKGLS 390

Query: 571 AGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAME 630
            G+ VK+GQ+IG++G TGL+TGPH HYEL VN    + T + +P    +    +  F   
Sbjct: 391 KGSRVKRGQVIGYVGQTGLATGPHCHYELHVNNQPRNPTTISLPTAAPVPAREMAAFKA- 449

Query: 631 KKRINSLLNNGENPKKPLFTS 651
             + ++LL   +  ++    S
Sbjct: 450 --KASTLLARLKLFEQAQLAS 468


>gi|89072502|ref|ZP_01159074.1| hypothetical membrane protein [Photobacterium sp. SKA34]
 gi|89051606|gb|EAR57059.1| hypothetical membrane protein [Photobacterium sp. SKA34]
          Length = 415

 Score =  332 bits (851), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 91/377 (24%), Positives = 155/377 (41%), Gaps = 23/377 (6%)

Query: 262 TSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNE----VRVDQL 317
           T P    DK  +       I+   ++  A  + G        +     N      ++++L
Sbjct: 37  TPPLSGKDKTEDLTWKKHVIESGESLAIAFDNIGLDGKTLHSLINTDANTDANTKQLERL 96

Query: 318 TKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYM 377
           +   IL+ G  ++     +       +      I  +D N +   ++  ++         
Sbjct: 97  SPGNILQFGFSKEGKLVELH----QPRNHLETLIVRHDGNTFTSEMDKKEI-------ET 145

Query: 378 RTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHAN 437
            T+     I    W A    G+ +N +  I       ++    ++  D  E  F  ++ +
Sbjct: 146 HTNFSHATIETSFWSAADKAGLTANQIMEIAALFGWDIDFALDIRAGDKFEVLFEQHYLD 205

Query: 438 NQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTS 497
               D  E+L              R  +       Y++++G++ R   LR+PV F  ++S
Sbjct: 206 GNPVDRGEILAATFTNMGKTFTAVRNNDGK-----YYDKDGRAMRKAFLRSPVNFRYVSS 260

Query: 498 GFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYV 556
            F  R  HP+ G  + H G D+ AP GTPI A GDG+V ++ +    G    I H   YV
Sbjct: 261 NFNPRRLHPVTGRVKPHRGTDYVAPVGTPIWAAGDGVVLESAYNKYNGNYVFIKHSAKYV 320

Query: 557 SSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPER 616
           + Y H     + +K G  VKQG  +G +G TG  TGPHLHYE +VNG   +   V +P+ 
Sbjct: 321 TKYLHLTK--RMVKKGQRVKQGDTVGTLGGTGRVTGPHLHYEFLVNGQHKNPRTVDLPQA 378

Query: 617 ENLKGDLLQRFAMEKKR 633
            +L G+    F  + K+
Sbjct: 379 NSLSGNEQVTFKKQAKQ 395


>gi|261212259|ref|ZP_05926545.1| membrane protein [Vibrio sp. RC341]
 gi|260838867|gb|EEX65518.1| membrane protein [Vibrio sp. RC341]
          Length = 432

 Score =  332 bits (851), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 87/413 (21%), Positives = 172/413 (41%), Gaps = 22/413 (5%)

Query: 242 HDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDS 301
            +  +   +   +  +N+ +++             ++  +++  +       AG S+   
Sbjct: 39  PESQLEVGRHYPLSLDNQLLSTTNETEAPSALLRWEVYQVRNGESAAVLFQRAGLSSRVL 98

Query: 302 AKIAKALKNEVR-VDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYV 360
            ++  +  +    + +L   + L+ G  + +    + R            I  +++    
Sbjct: 99  YELTSSNSDINSQLSKLMPKDELKFGFDENNQLVKLKRTI---SPYETFVITRSESG--- 152

Query: 361 LGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEH 420
                   + + +  + + +     I    W A    G+++N +  +       ++    
Sbjct: 153 -----FTSEFDKKEIFYQYNYAEAKITSSFWNAGMAAGLSANQIMELAGLFGWDIDFALD 207

Query: 421 LKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKS 480
           ++  D  +  +  N           ++        +           D +  Y++ENG++
Sbjct: 208 IREGDQFKLLYQENIVEGAVIGRGNIIAATFTNQGSTFTAIL----DDNTGNYYDENGRA 263

Query: 481 SRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANW 539
            +   LR+P+ F R++S F  R  HP+ G  + H G D+AAP GTPI A GDG+VEK+++
Sbjct: 264 MKKAFLRSPLDFRRVSSNFNPRRLHPVTGQVKAHRGTDYAAPVGTPIWAAGDGVVEKSSY 323

Query: 540 AGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYEL 599
               G    I H N Y++ Y H     + +K G  VKQGQ IG +G TG  TGPHLHYE 
Sbjct: 324 NQFNGNYVYIRHSNTYITKYLHLQR--RLVKTGQRVKQGQSIGTLGGTGRVTGPHLHYEF 381

Query: 600 IVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
           +VNG+  +   V +P+ ++L G   + F    K+    +   E   + L+ + 
Sbjct: 382 LVNGVHKNPRTVELPQAQSLSGKAKETFIANAKQ---RMAKLERYSQLLYANQ 431


>gi|52840809|ref|YP_094608.1| M24/M37 family peptidase [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
 gi|52627920|gb|AAU26661.1| peptidase, M23/M37 family [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 477

 Score =  332 bits (850), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 80/381 (20%), Positives = 152/381 (39%), Gaps = 17/381 (4%)

Query: 272 PEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKD 331
            +    ++      ++       G +  +   + K   +   + ++  ++ L+  + +  
Sbjct: 104 KDNEWQIVNPHSGDSMATIFHRLGLTAQNLNDVIKNNPHAKMLTRIKPNQKLQFLIKKN- 162

Query: 332 DKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIW 391
               + +  +       LT+            +  K  I+ +    +    +  +   ++
Sbjct: 163 ---KLEKLIVPVNTIQTLTVYR--------AGKIYKTKIDSKKTTTQNRYVTATVQGSLY 211

Query: 392 RATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHA 451
                  + S LV+ +       ++    L+  D     +   +  ++     ++L +  
Sbjct: 212 TTAQRFNIPSKLVRQMTTIFNKEIDFSRSLRSGDQFSIIYDAYYIEDKMVGVGDILVVTY 271

Query: 452 RFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYS 510
                  +  R      G  +YF   G S +    R P+ F  ++S F +   HPIL Y 
Sbjct: 272 TNRGKTYQAIRH-TNAHGEQDYFTPQGTSFKKAFTRYPIKFSHISSTFALSRYHPILHYR 330

Query: 511 RMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIK 570
           R H G+D AAP GTPI A GDG++   +   GYG    I H   Y + Y H     K + 
Sbjct: 331 RAHKGIDLAAPIGTPIHATGDGVITIIDRHNGYGNMIKIKHDKTYSTIYGHLLKFQKGLS 390

Query: 571 AGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAME 630
            G+ VK+GQ+IG++G TGL+TGPH HYEL VN    + T + +P    +    +  F   
Sbjct: 391 KGSRVKRGQVIGYVGQTGLATGPHCHYELHVNNQPRNPTTISLPTAAPVPAREMAAFKA- 449

Query: 631 KKRINSLLNNGENPKKPLFTS 651
             + ++LL   +  ++    S
Sbjct: 450 --KASTLLARLKLFEQAQLAS 468


>gi|307609370|emb|CBW98857.1| hypothetical protein LPW_06461 [Legionella pneumophila 130b]
          Length = 477

 Score =  332 bits (850), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 82/381 (21%), Positives = 152/381 (39%), Gaps = 17/381 (4%)

Query: 272 PEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKD 331
            +    ++      ++       G +  +   + K   +   + ++  ++ L+  + +  
Sbjct: 104 KDNEWQIVNPHSGDSMATIFHRLGLTAQNLNDVIKNNPHAKMLTRIKPNQKLQFLIKKN- 162

Query: 332 DKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIW 391
               + R  +       LT+            +  K  I+ +    +    +  +   ++
Sbjct: 163 ---KLERLIVPVNTIQTLTVYR--------AGKIYKTKIDSKKTTTQNRYVTATVQGSLY 211

Query: 392 RATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHA 451
                  + S LV+ +       ++    L+  D     +   +  ++     ++L +  
Sbjct: 212 TTAQRFNIPSKLVRQMTTIFNKEIDFSRSLRSGDQFSIIYDAYYIEDKMVGVGDILVVTY 271

Query: 452 RFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYS 510
                  +  R      G  +YF   G S +    R P+ F  ++S F +   HPIL Y 
Sbjct: 272 TNRGKTYQAIRH-TNAHGEQDYFTPQGTSFKKAFTRYPIKFSHISSTFALSRYHPILHYR 330

Query: 511 RMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIK 570
           R H G+D AAP GTPI A GDGI+   +   GYG    I H   Y + Y H     K + 
Sbjct: 331 RAHKGIDLAAPIGTPIHATGDGIITIIDRHNGYGNMIKIKHDKTYSTVYGHLLKFQKGLS 390

Query: 571 AGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAME 630
            G+ VK+GQ+IG++G TGL+TGPH HYEL VN    + T + +P    +    +  F   
Sbjct: 391 KGSRVKRGQVIGYVGQTGLATGPHCHYELHVNNQPRNPTTISLPTAAPVPAREMAAFKA- 449

Query: 631 KKRINSLLNNGENPKKPLFTS 651
             + ++LL   +  ++    S
Sbjct: 450 --KASTLLARLKLFEQAQLAS 468


>gi|114331531|ref|YP_747753.1| peptidase M23B [Nitrosomonas eutropha C91]
 gi|114308545|gb|ABI59788.1| peptidase M23B [Nitrosomonas eutropha C91]
          Length = 443

 Score =  332 bits (850), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 97/411 (23%), Positives = 163/411 (39%), Gaps = 17/411 (4%)

Query: 237 TLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFA-DDLIPIQHNTTIFDAMVHAG 295
                 D         KI+   R +  P+      PE        I+   TI   +    
Sbjct: 43  AFGIVPDSSFQEIPNKKIV---RALPLPEEFASSDPEMTFWHQESIRRGDTISAILARLE 99

Query: 296 YSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALND 355
            S  D  +    ++    + QL   EI+        +  T+     ++       +   D
Sbjct: 100 ISQKDKNRFLDTVRGSRAMSQLKPGEIIHAETRPNGELLTLR---YFYGNGEQFQVEKID 156

Query: 356 NNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSV 415
                      +++        R    S  I   ++ A     + S +   ++   +SS+
Sbjct: 157 G--------TFELNEQSAEGDTRVLVGSGVISSSLFAAVDKADLPSTIASQMIDIFSSSI 208

Query: 416 NLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFN 475
           +    ++  D     +      +  +    +L +     E   R   F  P      Y+ 
Sbjct: 209 DFHRDVRKGDRFTVVYESAQDESGKTQVGRVLAVEFFNKEKSRRAVYFR-PPGEEGGYYT 267

Query: 476 ENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIV 534
             G+S     L  P+ F R++SGF     HPIL   R H G+D+AAP GTP++A  +G V
Sbjct: 268 PEGESLSKPFLMAPLKFSRISSGFTHARYHPILKRWRAHRGIDYAAPTGTPVMATANGTV 327

Query: 535 EKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPH 594
           E      GYG   ++ H   Y S+Y H     + ++ G  VKQG IIG++G+TG++TGPH
Sbjct: 328 EFKGKQSGYGNLIILKHDAQYSSAYGHLSGFNRKLQKGMRVKQGDIIGFVGSTGMATGPH 387

Query: 595 LHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPK 645
           LHYEL VNG++ D +K+ +P  + +       F  + + + S L+   N  
Sbjct: 388 LHYELRVNGVQRDPSKIVMPAAQPVSKKYYSAFHRQTRELTSRLDLLRNTS 438


>gi|254508210|ref|ZP_05120334.1| membrane protein [Vibrio parahaemolyticus 16]
 gi|219548827|gb|EED25828.1| membrane protein [Vibrio parahaemolyticus 16]
          Length = 418

 Score =  331 bits (849), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 93/409 (22%), Positives = 163/409 (39%), Gaps = 19/409 (4%)

Query: 234 DPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVH 293
            P+  D R D       K   +  + T  + +     +     D   +    ++      
Sbjct: 19  LPEPEDLRQDERQYQIGKAYPLSIDPTALTLETRRSNLAVLRWDKHTVGSGDSMALLFQR 78

Query: 294 AGYSNGDSAKIAKALKNEVR-VDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIA 352
           AG S+    ++    K     + ++   +    G     +   I R        +   + 
Sbjct: 79  AGLSSRLLYQLTSTSKEIANQLTKVRPGDSFLFGFDGDSELVQIKR----QLSAYETFLI 134

Query: 353 LNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLA 412
              N+ +   ++  ++         + +  S  I    W A    G+ +N +  +     
Sbjct: 135 TKSNDGFTSSLDKKEVH-------YQYNYASNIITSNFWNAGVGAGLTANQIMELAGIFG 187

Query: 413 SSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVE 472
             ++    ++  D  E  +       +     +++           +        D +  
Sbjct: 188 WDIDFALDIRKNDSFEILYQEKVVEGEVVGRGKIMAAIFTNQGDTFKAIL----DDKTGN 243

Query: 473 YFNENGKSSRPFLLRTPVPFGRMTSGFGM-RYHPILGYSRMHTGVDWAAPRGTPIVAVGD 531
           Y++ENG++ +   LR+P+ F R+TS F   R HP+ G  R H G D+AAP GTPI A GD
Sbjct: 244 YYDENGRAMKKAFLRSPLDFRRVTSNFNPTRRHPVTGKVRAHRGTDYAAPVGTPIWAAGD 303

Query: 532 GIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLST 591
           G V K+++    G    I H N Y++ Y H     + +K G  VKQGQ IG +G TG  T
Sbjct: 304 GTVLKSSYNQFNGNYVFIKHSNTYITKYLHLTK--RTVKTGQRVKQGQTIGTLGGTGRVT 361

Query: 592 GPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNN 640
           GPHLHYE +VNG+  +   V++P+ ++L G     F    +   + L  
Sbjct: 362 GPHLHYEFLVNGVHKNPRTVKLPQSKSLTGKAKTTFIANAELRLAKLER 410


>gi|329898101|ref|ZP_08272307.1| membrane protein [gamma proteobacterium IMCC3088]
 gi|328920942|gb|EGG28370.1| membrane protein [gamma proteobacterium IMCC3088]
          Length = 464

 Score =  331 bits (848), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 97/456 (21%), Positives = 186/456 (40%), Gaps = 22/456 (4%)

Query: 194 DITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIK 253
             T++   H A    +   +        +    +            +     +  + +  
Sbjct: 18  SATQMPRKHLAAIGFVLLFLAVVAPFTPSGDVSANRDAELPLPQPTELASDALPAATEA- 76

Query: 254 IIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVR 313
            + +N     P+V      E       ++   ++   M  AG+S  D+    K  +    
Sbjct: 77  -LTDNVDEQEPEVAQPPS-EITWAFYQVRPGDSLSKLMTRAGFSERDAYIAGKTPEG--S 132

Query: 314 VDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQ 373
           + QL   + L        +   I     +        +  +++ ++       +++   +
Sbjct: 133 LTQLFPGQTLGFATKPSGELTEIQ----HKLSALEAMVYHHEDGKF-------RVERQIR 181

Query: 374 MDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSV 433
              +R  E+S  I   ++ A    G++ NL+  +       ++     +  D L   +  
Sbjct: 182 EPEVRIVEKSGEITSSLFLAGQAAGLSDNLIMELANLFGGVIDFVLDPREGDTLHVVYET 241

Query: 434 NHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFG 493
            + ++Q   D  ++             YR+ +     + YFNE G+S R   L  P+ F 
Sbjct: 242 LYLDDQYFSDGNIIAAAFTNKGETFTAYRYTDASG-RLGYFNERGESMRKAFLMAPLDFT 300

Query: 494 RMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHG 552
           R++S F  R  HP+   SR H G D+AAP+GTP+ A GDG V ++++    G    I HG
Sbjct: 301 RISSNFNPRRVHPVYKTSRPHRGTDYAAPKGTPVFAAGDGRVIESDYNRANGNYVFIQHG 360

Query: 553 NGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKV- 611
             YV+ Y H +   +++K    V Q QIIG +G+TG +TGPHLHYE +VNG+  +   + 
Sbjct: 361 EKYVTKYLHLNK--RHVKKNQRVSQSQIIGTVGSTGTATGPHLHYEFLVNGVHQNPRTIH 418

Query: 612 -RIPERENLKGDLLQRFAMEKKRINSLLNNGENPKK 646
            ++P+ ++L    + RF  + +     L    + ++
Sbjct: 419 KKLPKAKSLAATEMPRFKAQTQIQQEALARLISEQQ 454


>gi|54293558|ref|YP_125973.1| hypothetical protein lpl0610 [Legionella pneumophila str. Lens]
 gi|53753390|emb|CAH14843.1| hypothetical protein lpl0610 [Legionella pneumophila str. Lens]
          Length = 477

 Score =  331 bits (847), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 81/381 (21%), Positives = 153/381 (40%), Gaps = 17/381 (4%)

Query: 272 PEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKD 331
            +    ++      ++       G +  +   + K   +   + ++  ++ L+  + +  
Sbjct: 104 KDNEWQIVNPHSGDSMATIFHRLGLTAQNLNDVIKNNPHAKMLTRIKPNQKLQFLIKKN- 162

Query: 332 DKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIW 391
               + R  +       LT+            +  K  I+ +    +    +  +   ++
Sbjct: 163 ---KLERLIVPVNTIQTLTVYR--------AGKIYKTKIDSKKTTTQNRYVTATVQGSLY 211

Query: 392 RATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHA 451
                  + S LV+ +       ++  + L+  D     +   +  ++     ++L +  
Sbjct: 212 TTAQRFNIPSKLVRQMTTIFNKEIDFSKSLRSGDQFSIIYDAYYIEDKMVGVGDILVVTY 271

Query: 452 RFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYS 510
                  +  R      G  +YF   G S +    R P+ F  ++S F +   HPIL Y 
Sbjct: 272 TNHGKTYQAIRH-TNAHGEQDYFTPQGTSFKKAFTRYPIKFSHISSTFALSRYHPILHYK 330

Query: 511 RMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIK 570
           R H G+D AAP GTPI A GDG++   +   GYG    I H   Y + Y H     K + 
Sbjct: 331 RAHKGIDLAAPIGTPIHATGDGVITIIDRHNGYGNMIKIKHDKTYSTVYGHLLKFQKGLS 390

Query: 571 AGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAME 630
            G+ VK+GQ+IG++G TGL+TGPH HYEL VN    + T + +P    +    +  F   
Sbjct: 391 KGSRVKRGQVIGYVGQTGLATGPHCHYELHVNNQPRNPTTISLPTAAPVPAREMAAFKA- 449

Query: 631 KKRINSLLNNGENPKKPLFTS 651
             + ++LL   +  ++    S
Sbjct: 450 --KASTLLARLKLFEQAQLAS 468


>gi|119502752|ref|ZP_01624837.1| 3'-5' exoribonuclease, VacB and RNase II [marine gamma
           proteobacterium HTCC2080]
 gi|119461098|gb|EAW42188.1| 3'-5' exoribonuclease, VacB and RNase II [marine gamma
           proteobacterium HTCC2080]
          Length = 429

 Score =  331 bits (847), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 88/429 (20%), Positives = 164/429 (38%), Gaps = 20/429 (4%)

Query: 224 KNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQH 283
                     D        +  +  + +         I      +   P + ++   ++ 
Sbjct: 7   GVMLVAFAIPDSDNAPTLTESSVAANTEKTAQPTLEFIVVDAAALPTPPPWHEE--TVRE 64

Query: 284 NTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYH 343
              +      AG+S  D  ++++       + ++   + +        +   +       
Sbjct: 65  GDNLSLIFSRAGFSERDVYEVSRT-NGGQGLRKIYPGQTIAFMTAANGELDKVKHI---- 119

Query: 344 KQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNL 403
           + K   T+   D N++       K  +  +   +R       I   ++ A    G++S +
Sbjct: 120 ESKLKWTVFTRDGNDF-------KSRVTKRSTELRQESAILRIQSSLFLAGQRAGLSSRV 172

Query: 404 VKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRF 463
           +  +       ++     +  D +E  +     + +   D  ++        T    +R+
Sbjct: 173 IMGLADVFGGVIDFALDPRVGDTIELVYEAQWLDGEKYSDGAIVAAAFTNRGTTFDAFRY 232

Query: 464 LNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPR 522
                G + Y+N  G S R   L+ P+ F R++S F     HPI    R H G D+AAPR
Sbjct: 233 -TDSQGDMSYYNGEGVSMRKAFLKAPLDFTRVSSNFNPNRLHPIYKTKRPHRGTDYAAPR 291

Query: 523 GTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIG 582
           GTP+ A GDG + +A +    G    I HG  Y + Y H D   + +K G  V QG IIG
Sbjct: 292 GTPVYAAGDGRILEAGYTRANGNYVFIQHGENYKTHYLHLDK--RKVKQGQRVTQGDIIG 349

Query: 583 WIGTTGLSTGPHLHYELIVNGIKVDSTKVR--IPERENLKGDLLQRFAMEKKRINSLLNN 640
            +G+TG +TGPHLHYE +V G+  +  +V   +P+ ++L    + RF    +     L  
Sbjct: 350 TVGSTGAATGPHLHYEFLVRGVHKNPRRVHKSLPKAKSLPDSEMARFKSTVQAPLQQLAA 409

Query: 641 GENPKKPLF 649
                +   
Sbjct: 410 LYQDNRLAM 418


>gi|330447448|ref|ZP_08311097.1| peptidase M23 family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328491639|dbj|GAA05594.1| peptidase M23 family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 357

 Score =  330 bits (846), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 84/354 (23%), Positives = 148/354 (41%), Gaps = 19/354 (5%)

Query: 281 IQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFS 340
           ++   ++  A  + G        + +  +N  ++++L    ++  G  ++     +    
Sbjct: 2   VESGESLAIAFDNIGLDGNTLHTLLETDENTKQLERLRPGNVIEFGFNKEGQLTELR--- 58

Query: 341 IYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMN 400
            + +      I  ++   +   ++  K+          T+     I    W A    G+ 
Sbjct: 59  -HPRNHLETLIVRHNGKSFTSELDKKKI-------ETHTNFAHATIETSFWSAADKAGLT 110

Query: 401 SNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRF 460
           +N +  I       ++    ++  D  E  F  ++ +    D   +L             
Sbjct: 111 ANQIMEIAALFGWDIDFALDIRKGDKFEVLFEQHYLDGHPVDRGSILAATFTNMGQTFTA 170

Query: 461 YRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWA 519
            R  +       Y++++G++ R   LR+PV F  ++S F  R  HP+ G  + H G D+ 
Sbjct: 171 VRNEDGK-----YYDKDGQAMRKAFLRSPVNFRYVSSNFNPRRLHPVTGRVKAHRGTDYV 225

Query: 520 APRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQ 579
           AP GTPI A GDG+V K+ +    G    I H   YV+ Y H     + +K G  VKQG 
Sbjct: 226 APVGTPIWAAGDGVVLKSAYNKFNGNYVFIKHSTKYVTKYLHLTK--RMVKTGQRVKQGD 283

Query: 580 IIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKR 633
            IG +G TG  TGPHLHYE +VNG   +   V +P+  +L G     F  + K+
Sbjct: 284 TIGTLGGTGRVTGPHLHYEFLVNGEHKNPRTVDLPQANSLSGKEQTAFKQQAKQ 337


>gi|197335428|ref|YP_002156930.1| cell wall endopeptidase, family M23/M37 [Vibrio fischeri MJ11]
 gi|197316918|gb|ACH66365.1| cell wall endopeptidase, family M23/M37 [Vibrio fischeri MJ11]
          Length = 437

 Score =  330 bits (846), Expect = 5e-88,   Method: Composition-based stats.
 Identities = 84/371 (22%), Positives = 156/371 (42%), Gaps = 20/371 (5%)

Query: 270 KIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVR-VDQLTKDEILRIGVV 328
           +  + + +   ++   +        G       K+  + K     + +L   + L+ G  
Sbjct: 67  QNQQLSWETYTVKSGESASVLFSRIGLGYSQLLKLTSSDKEIENQLTRLRPGDKLKFGFN 126

Query: 329 QKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYD 388
           Q  D   ++R     +   +  +  +    +       +++                I  
Sbjct: 127 QDQDIVQLIRPISKFETYRISKVGDSYIGLFEKQDIETQLN-----------YTKATITS 175

Query: 389 GIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLY 448
             W A+   G+N N +  +       ++    ++  D  +  +   +   + +    ++ 
Sbjct: 176 NFWNASIGAGLNPNQIMELAGIFGWDIDFALDIREGDNFKVLYEEKYVEGEYAGKGNIIA 235

Query: 449 IHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPIL 507
                        R     D +  ++  NG++ +   LR+P+ F  ++S F  R  HP+ 
Sbjct: 236 ASFTNRGDTFTAIR----NDKNGNFYEPNGRAMKKAFLRSPINFRYVSSNFNPRRLHPVT 291

Query: 508 GYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAK 567
           G  + H G D+ AP GTPI A GDG+V+KA +    G    I H N Y++ Y H     +
Sbjct: 292 GQRKAHRGTDYVAPVGTPIWAAGDGVVDKAGYNQFNGNYVFIRHSNTYITKYLHMTK--R 349

Query: 568 NIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRF 627
            ++AG  VKQG+ IG +G TG  TGPHLHYE +VNG+  D+  V +P+ ++L G   + F
Sbjct: 350 YVRAGQRVKQGETIGTLGGTGRVTGPHLHYEFLVNGVHKDARTVSLPQSKSLTGKDKKEF 409

Query: 628 AME-KKRINSL 637
            +  K+R+  L
Sbjct: 410 EIVAKERLKQL 420


>gi|9971899|gb|AAG10461.1|AF279106_23 predicted metallopeptidase of the G-G peptidase family [uncultured
           marine gamma proteobacterium EBAC31A08]
          Length = 417

 Score =  330 bits (846), Expect = 5e-88,   Method: Composition-based stats.
 Identities = 85/396 (21%), Positives = 165/396 (41%), Gaps = 25/396 (6%)

Query: 248 YSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKA 307
            + +   +EE        + +++   +   +  +Q    +     +       + KI + 
Sbjct: 31  ETYESLPVEEIEITEKFSIPLEQTKTY--QMHEVQDGENLSIIFENFSVPLNTAYKIFRL 88

Query: 308 LKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVK 367
               + +  +   E +      +     + R  I   Q + ++I+L     +    + ++
Sbjct: 89  DSKNI-IANIKPGEKMLFEYSGE----ELTRIEIMKDQINSISISLTPEIVFKNISKSIE 143

Query: 368 MDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFL 427
           +           S  S  I    + A     +  +++          V+    ++  D  
Sbjct: 144 L---------IESYNSGIIQSSFYEAALDANIPESVIMDFAYIFGWDVDFVFDIREGDEF 194

Query: 428 ETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLR 487
              +   +++ +   + +++              RF        +YF+ENG + +   LR
Sbjct: 195 HVIYDTPYSDGEKVKNGDIVIAKFINNGNTYFANRFFT-EASKKQYFDENGNNMQKAFLR 253

Query: 488 TPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQ 546
            P+ F  ++S F     HP+L   R H GVD+AA RG+P+   GDGIV  +    G G +
Sbjct: 254 APLDFAYISSHFNPNRMHPVLHTIRAHNGVDYAAKRGSPVRTTGDGIVSFSGQRNGCGNE 313

Query: 547 TLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKV 606
            +I+H N Y + Y H +  +K I+ G  V QG  IG++G++GL+TGPHLHYE  +   ++
Sbjct: 314 IVINHTNEYSTRYCHLEKFSKGIRKGKKVSQGDTIGFVGSSGLATGPHLHYEFKIGKKRI 373

Query: 607 DSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGE 642
           D  KV++P  E +  +L   F       ++LL N +
Sbjct: 374 DPIKVKLPSAEPVPKNLRASF-------DTLLKNNK 402


>gi|254521563|ref|ZP_05133618.1| membrane-bound metalloendopeptidase [Stenotrophomonas sp. SKA14]
 gi|219719154|gb|EED37679.1| membrane-bound metalloendopeptidase [Stenotrophomonas sp. SKA14]
          Length = 443

 Score =  330 bits (845), Expect = 5e-88,   Method: Composition-based stats.
 Identities = 111/416 (26%), Positives = 175/416 (42%), Gaps = 18/416 (4%)

Query: 229 TLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIF 288
            L            D P   S     +              ++P  +  ++ +Q   T+ 
Sbjct: 11  ALVATIVPGFSHTIDAPFADSHTSLALPLP---PLTMARQQQVPGDSWQVLRVQRGQTLS 67

Query: 289 DAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHL 348
           D    AG       ++         + +L     +   +    D  +I RF      +  
Sbjct: 68  DLFDQAGIPASTLHRVLDHPGARESLTKLRPGTEIAFDMPLSGDLRSI-RFDRDGDNRVE 126

Query: 349 LTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIM 408
           L++  +D          +K  +  +    RT   S  I   ++ A    G++ + +  + 
Sbjct: 127 LSLVGDD----------IKEKVTKRETSTRTVVTSGEITSSLYAAARRAGLSPSAIATMT 176

Query: 409 R-TLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPV 467
                  ++  + L+P D             +  D S++L      G      +RF    
Sbjct: 177 DDIFKYDIDFSKDLQPGDRFSVVMDETWREGEKVDTSKILAATFTTGGKTYSGFRF--DR 234

Query: 468 DGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIV 527
           +G  EY++ NG+S +   +R P+PF R++S FG R HP+LG  RMH GVD+AA  GTPI+
Sbjct: 235 NGKSEYYDINGRSLKKSFIRMPIPFARLSSTFGARKHPVLGKMRMHKGVDYAARTGTPIM 294

Query: 528 AVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTT 587
           A GD  V+ A    GYG   ++ HG G+ + Y H    A NIK G  V QG +IG++G+T
Sbjct: 295 AAGDARVQFAGVQRGYGNVVILDHGRGHTTLYGHMSRFA-NIKTGQRVAQGTVIGYVGST 353

Query: 588 GLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGEN 643
           GL+TGPHLHYE  VNG   +   V +P  E LKG  L  F  +     + +   E 
Sbjct: 354 GLATGPHLHYEFRVNGEHRNPLTVTMPPPEPLKGAELVAFRAQTAPAMARIQGMEK 409


>gi|190572484|ref|YP_001970329.1| hypothetical protein Smlt0416 [Stenotrophomonas maltophilia K279a]
 gi|190010406|emb|CAQ44014.1| conserved hypothetical protein [Stenotrophomonas maltophilia K279a]
          Length = 490

 Score =  330 bits (845), Expect = 6e-88,   Method: Composition-based stats.
 Identities = 111/435 (25%), Positives = 179/435 (41%), Gaps = 19/435 (4%)

Query: 210 KNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLID 269
           +      +            +    P       D P   S     +              
Sbjct: 40  ERWTRRHWMHASLFATIGALVATIVPG-FSHTIDAPFADSHTSLALPLP---PLAMARQQ 95

Query: 270 KIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQ 329
           ++P  +  ++ ++   T+ D    AG       ++         + +L     +   +  
Sbjct: 96  QVPGDSWQVLRVERGQTLSDLFDKAGIPATTLHRVLDHPGAREALTKLRPGAEIAFDMPL 155

Query: 330 KDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDG 389
             D  +I RF      +  L++A +D          +K  +  +    RT   S  I   
Sbjct: 156 SGDLRSI-RFDRDADNRVELSLAGDD----------IKEKVTKRETSTRTVVTSGEITSS 204

Query: 390 IWRATSFNGMNSNLVKLIMR-TLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLY 448
           ++ A    G++ + +  +        ++  + L+P D             +  D S++L 
Sbjct: 205 LYAAARRAGLSPSAIATMTDDIFKYDIDFSKDLQPGDRFSVVMDETWREGEKVDTSKILA 264

Query: 449 IHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILG 508
                G      +RF    +G  EY++ NG+S +   +R P+PF R++S FG R HP+LG
Sbjct: 265 ATFTTGGKTYSGFRF--DRNGKSEYYDINGRSLKKSFIRMPIPFARLSSTFGARKHPVLG 322

Query: 509 YSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKN 568
             RMH GVD+AA  GTPI+A GD  V+ A    GYG   ++ HG G+ + Y H    A N
Sbjct: 323 KMRMHKGVDYAARTGTPIMAAGDARVQFAGVQRGYGNVVILDHGRGHTTLYGHMSRFA-N 381

Query: 569 IKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFA 628
           IK G  V QG +IG++G+TGL+TGPHLHYE  VNG   +   V +P  E LKG  L  F 
Sbjct: 382 IKTGQRVAQGTVIGYVGSTGLATGPHLHYEFRVNGEHRNPLTVTMPPPEPLKGAELVAFR 441

Query: 629 MEKKRINSLLNNGEN 643
            +     + +   E 
Sbjct: 442 AQTAPAMARIQGMEK 456


>gi|297180970|gb|ADI17173.1| membrane proteins related to metalloendopeptidases [uncultured
           gamma proteobacterium HF0070_08D07]
          Length = 469

 Score =  329 bits (844), Expect = 6e-88,   Method: Composition-based stats.
 Identities = 92/370 (24%), Positives = 155/370 (41%), Gaps = 15/370 (4%)

Query: 278 LIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIV 337
              I    ++        Y + D   + ++      +  +   + L   V  +     ++
Sbjct: 113 KHTITAGESLASIFKKYDYESRDLYLLTQSEFGTA-LKSVYPRQELSFLVRGE----ELI 167

Query: 338 RFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFN 397
           +               + +N     V P                +   I + ++ ++   
Sbjct: 168 QVKYSLNPLQSYIFDRDGDNFRSESVSP--------HPDRFLERKHGVIENSLFLSSQAL 219

Query: 398 GMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETR 457
           G++ NL+    +     V+    ++P D     F   + N +   D E+L          
Sbjct: 220 GLSDNLIMRFAQIFQWDVDFVLDIRPGDAFSIVFESLYLNGKKVRDGEILAATFVNQGKS 279

Query: 458 TRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGV 516
                +       ++YF   GK+ R   LR P+ F R++S F  R  HP+      H G+
Sbjct: 280 FEALAYATEDG-RLDYFTPAGKNMRKAFLRAPLEFSRISSNFNPRRRHPLFKTVIPHRGI 338

Query: 517 DWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVK 576
           D+AAP GTP+ A GDG V KA+     GK  +I HG  +V+ Y H    A  IK G  VK
Sbjct: 339 DYAAPHGTPVFASGDGKVIKASRTKANGKFIVISHGEQFVTKYLHLSNFANRIKKGKRVK 398

Query: 577 QGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINS 636
           QGQ IG++G+TG +TGPHLHYE +VNG+  +   V++P+  ++  + L+ F  E +R   
Sbjct: 399 QGQTIGYVGSTGYATGPHLHYEFLVNGVHRNPRTVQLPKAASIPPNQLEEFLYETERNRM 458

Query: 637 LLNNGENPKK 646
           LL +  +   
Sbjct: 459 LLTSQISNTT 468


>gi|311103887|ref|YP_003976740.1| peptidase family M23 [Achromobacter xylosoxidans A8]
 gi|310758576|gb|ADP14025.1| peptidase family M23 family protein 1 [Achromobacter xylosoxidans
           A8]
          Length = 469

 Score =  329 bits (844), Expect = 7e-88,   Method: Composition-based stats.
 Identities = 91/442 (20%), Positives = 169/442 (38%), Gaps = 5/442 (1%)

Query: 208 EIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVL 267
            ++                +  L+      L        T     +II     +++ QV 
Sbjct: 22  PVEPKPQRSGLFRRTILVTAIGLFAG-AAALGMVQQPDRTELPPSRIISSVLPLSAEQVE 80

Query: 268 IDKIPEFADDLIP-IQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIG 326
           +             I+   T+   +                  +   + +L     ++  
Sbjct: 81  VSTPSAAPYISETRIRAGDTLAAVLQRLELDAPSLQTFLTHEASARSIYKLYPGRSVQAA 140

Query: 327 VVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNI 386
             +  +   +        +     +            +  K +   +    +T      I
Sbjct: 141 TDEAGNLIWLRYIHTPGNEADGQVVTR--MLHVAPAGDSYKAEEITESTERQTRVAVGTI 198

Query: 387 YDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSEL 446
              ++ AT   G+  ++   +   L++ ++    L+  D     + V   + + +    +
Sbjct: 199 RSSLFGATDAAGIPDSVTMQMADILSAKIDFLRDLRQGDKFRVVYEVRSHDGRYAGAGRV 258

Query: 447 LYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPI 506
           L +    G+       F +P + S  Y++ +G S R   LRT + F R++S FGMR HPI
Sbjct: 259 LALEFINGDKTYNAVWF-SPDEKSGSYYDFDGTSLRGAFLRTALKFSRISSTFGMRMHPI 317

Query: 507 LGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIA 566
                 H GVD+AAP GTPI +  DG VE + W  GYG   ++ H   Y + Y HQ  IA
Sbjct: 318 HKTWTGHKGVDYAAPSGTPIHSTADGTVEFSGWQNGYGNVVIVKHHGKYSTLYAHQSRIA 377

Query: 567 KNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQR 626
           + +  G+ + QGQ++G++G TG +TGPHLHYE  V+   +D   V +P   +L+   ++ 
Sbjct: 378 EGVTKGSKISQGQLLGYVGATGWATGPHLHYEFRVDNQPIDPLSVDLPVARSLEPAEVRA 437

Query: 627 FAMEKKRINSLLNNGENPKKPL 648
           F        + +      ++ L
Sbjct: 438 FNQAVAPYKAQIQLLTEFQQTL 459


>gi|302877604|ref|YP_003846168.1| Peptidase M23 [Gallionella capsiferriformans ES-2]
 gi|302580393|gb|ADL54404.1| Peptidase M23 [Gallionella capsiferriformans ES-2]
          Length = 432

 Score =  329 bits (843), Expect = 8e-88,   Method: Composition-based stats.
 Identities = 87/392 (22%), Positives = 159/392 (40%), Gaps = 14/392 (3%)

Query: 253 KIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEV 312
           K+  E   + +     +  P        +Q   T+ + M      +  ++   +   +  
Sbjct: 47  KVAIEQLALPA-AAPTESTPATFWHTERLQRGDTVAELMQRLNIKDPVASNYLRNSADAK 105

Query: 313 RVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINH 372
              +L+    ++          ++     Y  ++   +I     + ++      +++   
Sbjct: 106 AFRKLSVGSEVQAETDTTGALVSLS----YLGEQGAKSIIQKQGDSFISKTVAAQLEK-- 159

Query: 373 QMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFS 432
                R    +  I   ++ AT   GM  +    +    +  V+    LK  D     + 
Sbjct: 160 -----RLFVRTGEIKTSLYAATDAAGMPESAANQLTEIFSGDVDFHHDLKRGDRFTAVYE 214

Query: 433 VNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPF 492
           + ++N       ++            R  RF +    S +Y+   G+S +   LR+P+ F
Sbjct: 215 MTYSNGALVKAGQIQAAEFINQGNVYRAVRFQSDATHS-DYYTPEGRSLKKAFLRSPIAF 273

Query: 493 GRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHH 551
            R++SGF M   HP+L   R H GVD+AAP GTP+ A  DGIV       GYG   ++ H
Sbjct: 274 SRVSSGFTMARFHPVLNKWRAHKGVDFAAPIGTPVKATSDGIVSFVGQQNGYGNVVILKH 333

Query: 552 GNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKV 611
            + Y + Y H    AK ++ G  V+QG +I ++G TG+++GPHLHYE  +N  + D  +V
Sbjct: 334 QSQYSTVYGHLSRYAKGLRNGARVRQGDVIAYVGMTGMTSGPHLHYEFRINDQQRDPLRV 393

Query: 612 RIPERENLKGDLLQRFAMEKKRINSLLNNGEN 643
            +P    + G     F     +  + L    N
Sbjct: 394 ALPNALPITGANRTAFKAMADKFVASLVQLRN 425


>gi|59712738|ref|YP_205514.1| cell wall endopeptidase [Vibrio fischeri ES114]
 gi|59480839|gb|AAW86626.1| cell wall endopeptidase, family M23/M37 [Vibrio fischeri ES114]
          Length = 437

 Score =  329 bits (843), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 86/368 (23%), Positives = 154/368 (41%), Gaps = 20/368 (5%)

Query: 273 EFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVR-VDQLTKDEILRIGVVQKD 331
           + + +   ++   +        G       K+  + K     + +L   + L+ G  Q  
Sbjct: 70  QLSWETHTVKSGESASVLFSRIGLGYSQLLKLTSSDKEIENQLTRLRPGDKLKFGFNQGQ 129

Query: 332 DKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIW 391
           +   ++R       K          + Y+   E   +         + +     I    W
Sbjct: 130 EIVQLIR----PISKFETYRISKAGDGYIGLFEKQDI-------ETQLNYTKATITSNFW 178

Query: 392 RATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHA 451
            A+   G+N N +  +       ++    ++  D  +  +   +   + +    ++    
Sbjct: 179 NASIGAGLNPNQIMELAGIFGWDIDFALDIREGDNFKVLYEEKYVEGEYAGKGNIIAASF 238

Query: 452 RFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYS 510
                     R     D +  ++  NG++ +   LR+P+ F  ++S F  R  HP+ G  
Sbjct: 239 TNRGDTFTAIR----NDKNGNFYEPNGRAMKKAFLRSPINFRYVSSNFNPRRLHPVTGQR 294

Query: 511 RMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIK 570
           + H G D+ AP GTPI A GDG+V+KA +    G    I H N Y++ Y H     + ++
Sbjct: 295 KAHRGTDYVAPVGTPIWAAGDGVVDKAGYNQFNGNYVFIRHSNTYITKYLHMTK--RYVR 352

Query: 571 AGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAME 630
           AG  VKQG  IG +G TG  TGPHLHYE +VNG+  D+  V +P+ ++L G   + F + 
Sbjct: 353 AGQRVKQGDTIGTLGGTGRVTGPHLHYEFLVNGVHKDARTVSLPQSKSLTGKDKKEFEVV 412

Query: 631 -KKRINSL 637
            K+R+  L
Sbjct: 413 AKERLKQL 420


>gi|194364077|ref|YP_002026687.1| peptidase M23 [Stenotrophomonas maltophilia R551-3]
 gi|194346881|gb|ACF50004.1| Peptidase M23 [Stenotrophomonas maltophilia R551-3]
          Length = 490

 Score =  329 bits (843), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 109/435 (25%), Positives = 178/435 (40%), Gaps = 19/435 (4%)

Query: 210 KNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLID 269
           +      +            +    P       D P   S     +              
Sbjct: 40  ERWTRRHWMHASLFATIGALVATIVPG-FSHTIDAPFADSHTSLALPLP---PLTMARQQ 95

Query: 270 KIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQ 329
           ++P  +  ++ +Q   T+ D    AG       ++         + +L     +   +  
Sbjct: 96  QVPGDSWQVLRVQRGQTLSDLFDKAGIPATTLHRVLDHPGAREALTKLRPGAEIAFDMPL 155

Query: 330 KDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDG 389
             D  +I RF      +  L+++ +D          +K  +  +    RT   S  I   
Sbjct: 156 SGDLRSI-RFDRDADNRVELSLSGDD----------IKEKVTKRETSTRTVVTSGEITSS 204

Query: 390 IWRATSFNGMNSNLVKLIMR-TLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLY 448
           ++ A    G++ + +  +        ++  + L+P D             +  D S++L 
Sbjct: 205 LYAAARRAGLSPSAIATMTDDIFKYDIDFSKDLQPGDRFSVVMDETWREGEKVDTSKILA 264

Query: 449 IHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILG 508
                G      +RF    +G  EY++ NG+S +   +R P+PF R++S FG R HP+LG
Sbjct: 265 ATFTTGGKTYSGFRF--DRNGKAEYYDINGRSLKKSFIRMPIPFARLSSTFGARKHPVLG 322

Query: 509 YSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKN 568
             RMH GVD+AA  GTPI+A GD  V+ A    GYG   ++ HG G+ + Y H    A  
Sbjct: 323 KMRMHKGVDYAARTGTPIMAAGDARVQFAGVQRGYGNVVILDHGRGHTTLYGHMSRFAS- 381

Query: 569 IKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFA 628
           I+ G  V QG +IG++G+TGL+TGPHLHYE  VNG   +   V +P  E LKG  L  F 
Sbjct: 382 IRTGQRVAQGTVIGYVGSTGLATGPHLHYEFRVNGEHRNPLTVTMPPPEPLKGAELVAFR 441

Query: 629 MEKKRINSLLNNGEN 643
            +     + +   E 
Sbjct: 442 AQTAPAMARIQGMEK 456


>gi|229530435|ref|ZP_04419823.1| membrane protein [Vibrio cholerae 12129(1)]
 gi|229332208|gb|EEN97696.1| membrane protein [Vibrio cholerae 12129(1)]
          Length = 433

 Score =  329 bits (842), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 88/415 (21%), Positives = 170/415 (40%), Gaps = 24/415 (5%)

Query: 242 HDHPITYSKKIKIIEENRTITSPQVLIDKIPEF--ADDLIPIQHNTTIFDAMVHAGYSNG 299
            D      +   +  +N+ +++P+  +   P      +   + +  +       AG S+ 
Sbjct: 39  PDAQREVGRHYPVTLDNQLVSTPEEEVIAPPSVMLRWETYQVANGESAALLFQRAGLSSR 98

Query: 300 DSAKIAKALKNEVR-VDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNE 358
              ++  +  +    + +L   + L+ G  + +    + R            +  +D+  
Sbjct: 99  VLYELTSSNSDINNQLSKLMPKDELKFGFDRDNQLVQLKRTI---SPYETFVVTRSDSG- 154

Query: 359 YVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQ 418
                     + + +    + +     I    W A    G+++N +  +       ++  
Sbjct: 155 -------FTSEFDKKEVTFQLNYAEAKITSNFWNAGVAAGLSANQIIELANIFGWDIDFA 207

Query: 419 EHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENG 478
             ++  D  +  +              ++        +           D +  Y+++NG
Sbjct: 208 LDIREGDQFKLLYQEKIVEGSVIGRGNIIAATFINQGSTFTAIL----DDNTGNYYDQNG 263

Query: 479 KSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKA 537
           ++ +   LR+P+ F R++S F  R  HP+ G  + H G D+ AP GTPI A GDG+VEK+
Sbjct: 264 RAMKKAFLRSPLDFRRVSSNFNPRRLHPVTGQIKAHRGTDYVAPVGTPIWAAGDGVVEKS 323

Query: 538 NWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHY 597
           ++    G    I H N Y++ Y H     + +K G  VKQGQ IG +G TG  TGPHLHY
Sbjct: 324 SYNQFNGNYVYIRHSNTYITKYLHLQR--RLVKTGERVKQGQTIGTLGGTGRVTGPHLHY 381

Query: 598 ELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
           E +VNGI  +   V +P+ ++L G   + F    K+    +   E   + L+ + 
Sbjct: 382 EFLVNGIHKNPRTVELPQAQSLTGKAKETFIANAKQ---RMEKLERYSQLLYANQ 433


>gi|153217137|ref|ZP_01950901.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|153801751|ref|ZP_01956337.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
 gi|153825687|ref|ZP_01978354.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
 gi|153830949|ref|ZP_01983616.1| conserved hypothetical protein [Vibrio cholerae 623-39]
 gi|229512892|ref|ZP_04402359.1| membrane protein [Vibrio cholerae TMA 21]
 gi|229520921|ref|ZP_04410343.1| membrane protein [Vibrio cholerae TM 11079-80]
 gi|124113830|gb|EAY32650.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|124122716|gb|EAY41459.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
 gi|148873562|gb|EDL71697.1| conserved hypothetical protein [Vibrio cholerae 623-39]
 gi|149740624|gb|EDM54733.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
 gi|229342154|gb|EEO07150.1| membrane protein [Vibrio cholerae TM 11079-80]
 gi|229350141|gb|EEO15094.1| membrane protein [Vibrio cholerae TMA 21]
 gi|327483434|gb|AEA77841.1| membrane protein [Vibrio cholerae LMA3894-4]
          Length = 433

 Score =  329 bits (842), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 88/415 (21%), Positives = 170/415 (40%), Gaps = 24/415 (5%)

Query: 242 HDHPITYSKKIKIIEENRTITSPQVLIDKIPEF--ADDLIPIQHNTTIFDAMVHAGYSNG 299
            D      +   +  +N+ +++P+  +   P      +   + +  +       AG S+ 
Sbjct: 39  PDAQREVGRHYPVTLDNQLVSTPEEEVIAPPSVMLRWETYQVANGESAALLFQRAGLSSR 98

Query: 300 DSAKIAKALKNEVR-VDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNE 358
              ++  +  +    + +L   + L+ G  + +    + R            +  +D+  
Sbjct: 99  VLYELTSSNSDINNQLSKLMPKDELKFGFDKDNQLVQLKRTI---SPYETFVVTRSDSG- 154

Query: 359 YVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQ 418
                     + + +    + +     I    W A    G+++N +  +       ++  
Sbjct: 155 -------FTSEFDKKEVTFQLNYAEAKITSNFWNAGVAAGLSANQIIELANMFGWDIDFA 207

Query: 419 EHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENG 478
             ++  D  +  +              ++        +           D +  Y+++NG
Sbjct: 208 LDIREGDQFKLLYQEKIVEGSVIGRGNIIAATFINQGSTFTAIL----DDNTGNYYDQNG 263

Query: 479 KSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKA 537
           ++ +   LR+P+ F R++S F  R  HP+ G  + H G D+ AP GTPI A GDG+VEK+
Sbjct: 264 RAMKKAFLRSPLDFRRVSSNFNPRRLHPVTGQIKAHRGTDYVAPVGTPIWAAGDGVVEKS 323

Query: 538 NWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHY 597
           ++    G    I H N Y++ Y H     + +K G  VKQGQ IG +G TG  TGPHLHY
Sbjct: 324 SYNQFNGNYVYIRHSNTYITKYLHLQR--RLVKTGERVKQGQTIGTLGGTGRVTGPHLHY 381

Query: 598 ELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
           E +VNGI  +   V +P+ ++L G   + F    K+    +   E   + L+ + 
Sbjct: 382 EFLVNGIHKNPRTVELPQAQSLTGKAKETFIANAKQ---RMEKLERYSQLLYANQ 433


>gi|77747491|ref|NP_297460.2| hypothetical protein XF0167 [Xylella fastidiosa 9a5c]
          Length = 471

 Score =  329 bits (842), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 100/385 (25%), Positives = 167/385 (43%), Gaps = 15/385 (3%)

Query: 260 TITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTK 319
           T+  P             ++ I+   T+         S+ D  ++         + +L+ 
Sbjct: 81  TLALPLPPPYTSTADTWRMVTIKPGQTLSSIFNELKLSSNDMERVLNYADLRKLLTRLSP 140

Query: 320 DEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRT 379
            + +   +        +        +KH + + L+DN         +   ++ +    RT
Sbjct: 141 GDEISFDIPNDG---QLRGMRFNRDEKHRVELTLDDN--------TIHQQVSERQTSTRT 189

Query: 380 SEESPNIYDGIWRATSFNGMNSNLVKLIM-RTLASSVNLQEHLKPTDFLETFFSVNHANN 438
              S  I   +W A    G++   V  +        ++  + L+  D             
Sbjct: 190 VIASGEIKSSLWIAAREAGLSPADVITLTDEIFKYDIDFDKDLQTGDRFSVVMDETWREG 249

Query: 439 QASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSG 498
           +   D+++L      G       RF+      VEYF+++G+  +   +R P+ + R++S 
Sbjct: 250 ERLPDAKILAATFNTGGKIYSGMRFMRDG--KVEYFDKDGRPLKKSFIRMPISYARLSST 307

Query: 499 FGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSS 558
           FG+R HPILG  RMH GVD+AA  GTPI+A GD  V+      GYG   +++HG GY + 
Sbjct: 308 FGLRRHPILGTMRMHKGVDYAAATGTPIMAAGDARVQFIGQQRGYGNVVILNHGKGYRTL 367

Query: 559 YNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPEREN 618
           Y H     K IKAG  + QG +IG++G TGL+TGPHLHYE  VNG   +   + +P  E 
Sbjct: 368 YGHMSRFGK-IKAGQKINQGTVIGYVGMTGLATGPHLHYEFQVNGQHRNPLSITMPPPEP 426

Query: 619 LKGDLLQRFAMEKKRINSLLNNGEN 643
           L+G  L  F  +   + + +   E 
Sbjct: 427 LRGKDLIAFRTQTAPLIAQIQQYEK 451


>gi|229525282|ref|ZP_04414687.1| membrane protein [Vibrio cholerae bv. albensis VL426]
 gi|229338863|gb|EEO03880.1| membrane protein [Vibrio cholerae bv. albensis VL426]
          Length = 433

 Score =  329 bits (842), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 89/415 (21%), Positives = 170/415 (40%), Gaps = 24/415 (5%)

Query: 242 HDHPITYSKKIKIIEENRTITSPQVLIDKIPEF--ADDLIPIQHNTTIFDAMVHAGYSNG 299
            D      +   +  +N+ +++P+  +   P      +   + +  +       AG S+ 
Sbjct: 39  PDAQREVGRHYPVTLDNQLVSTPEEEVIAPPSVMLRWETYQVANGESAALLFQRAGLSSR 98

Query: 300 DSAKIAKALKNEVR-VDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNE 358
              ++  +  +    + +L   + L+ G  + +    + R            +  +D+  
Sbjct: 99  VLYELTSSNSDINNQLSKLMPKDELKFGFDKDNQLVQLKRTI---SPYETFVVTRSDSG- 154

Query: 359 YVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQ 418
                     D + +    + +     I    W A    G+++N +  +       ++  
Sbjct: 155 -------FTSDFDKKEVTFQLNYAEAKITSNFWNAGVAAGLSANQIIELANMFGWDIDFA 207

Query: 419 EHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENG 478
             ++  D  +  +              ++        +           D +  Y+++NG
Sbjct: 208 LDIREGDQFKLLYQEKIVEGSVIGRGNIIAATFINQGSTFTAIL----DDNTGNYYDQNG 263

Query: 479 KSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKA 537
           ++ +   LR+P+ F R++S F  R  HP+ G  + H G D+ AP GTPI A GDG+VEK+
Sbjct: 264 RAMKKAFLRSPLDFRRVSSNFNPRRLHPVTGQIKAHRGTDYVAPVGTPIWAAGDGVVEKS 323

Query: 538 NWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHY 597
           ++    G    I H N Y++ Y H     + +K G  VKQGQ IG +G TG  TGPHLHY
Sbjct: 324 SYNQFNGNYVYIRHSNTYITKYLHLQR--RLVKTGERVKQGQTIGTLGGTGRVTGPHLHY 381

Query: 598 ELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
           E +VNGI  +   V +P+ ++L G   + F    K+    +   E   + L+ + 
Sbjct: 382 EFLVNGIHKNPRTVELPQAQSLTGKAKETFIANAKQ---RMEKLERYSQLLYANQ 433


>gi|40062627|gb|AAR37556.1| peptidase, M23/M37 family [uncultured marine bacterium 311]
          Length = 448

 Score =  329 bits (842), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 87/364 (23%), Positives = 156/364 (42%), Gaps = 14/364 (3%)

Query: 281 IQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFS 340
           I+ N ++F  +   G    +   +  + ++ + + Q+   + L +G+   +   ++    
Sbjct: 95  IKRNDSLFSILKRLGIEEKNIVTLVNSDRSNL-LAQIKIGKTLEVGINDSNIVISLN--- 150

Query: 341 IYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMN 400
            Y K       A      Y +    +  +       +        I + ++      G+ 
Sbjct: 151 -YIKDFKSGVRAEKRGEVYEIEEYELNTEKYRVFKNIE-------INNSLYVDGLKEGLP 202

Query: 401 SNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRF 460
            +++  ++      ++    ++P D     +     N +   D ++L       +     
Sbjct: 203 DSVIMDLVYIFGWDIDFVHDIRPGDSYSLIYEEVFVNGEKKLDGDILIAEFINRDRTHTA 262

Query: 461 YRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFG-MRYHPILGYSRMHTGVDWA 519
            R+      S EYF+  G++ +   LR+PV F  ++S +   R HPIL   R HTGVD+A
Sbjct: 263 IRYKLQNGFS-EYFSLEGRNVKKAFLRSPVKFSYISSSYNLKRRHPILHKIRAHTGVDYA 321

Query: 520 APRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQ 579
           A RGTP+   GDG V  A+  GGYG    I H   Y + Y H +     IK G  V Q +
Sbjct: 322 ASRGTPVRTTGDGTVVFADKKGGYGNLVEIKHTEDYSTRYAHLNKFHSKIKVGKKVNQSE 381

Query: 580 IIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLN 639
            IG++G TG +TG HLHYE  VNG   +   V++P  + +  +    + +  K+I + L 
Sbjct: 382 TIGYVGRTGTATGDHLHYEFRVNGKHTNPLTVKLPNAKPIHENDKDSYGLHAKKILADLK 441

Query: 640 NGEN 643
             +N
Sbjct: 442 KYQN 445


>gi|82523697|emb|CAI78478.1| membrane protein related to metalloendopeptidases [uncultured beta
           proteobacterium]
          Length = 438

 Score =  328 bits (841), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 98/392 (25%), Positives = 160/392 (40%), Gaps = 15/392 (3%)

Query: 254 IIEENRT--ITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNE 311
           I  E  T  IT P +         +    I+   T+  A+        +   +       
Sbjct: 51  ITPETITESITLPVLASVNTNTTFERESVIRSGDTLSSALARLNIDALEIQGLLATDAVR 110

Query: 312 VRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDIN 371
                +   + ++    Q      ++           LTI     + YV          +
Sbjct: 111 QLSSSIRSGKRIQATTTQDG---QLLTIQFERGNAPALTI-RRQGDSYVAAE-------S 159

Query: 372 HQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFF 431
             +   R    S  I   ++ AT   G+   +   +  T ++S++ +E L+  D     +
Sbjct: 160 SAVLETRVVMRSGRILSSLYGATDSAGIPDKIANQMAETFSTSLDFREDLRRGDTFSVIY 219

Query: 432 SVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVP 491
           +VN+ N +     +LL           R   F +    +  ++   G+S +   LR+P+ 
Sbjct: 220 TVNYRNGEPVSAGQLLAAEFVNSGKPYRAVLFRDTSG-NEGFYTPEGESLKKGFLRSPLE 278

Query: 492 FGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIH 550
           F R+TS F     HPI G+ R HTGVD+ AP GT + A GD  V  A   GGYG   ++ 
Sbjct: 279 FSRVTSSFTNSRKHPIYGFHRAHTGVDFGAPTGTRVKATGDAKVVFAGRRGGYGNLLILK 338

Query: 551 HGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTK 610
           H NG+ + Y H  A A  I+ G +V QGQ++ ++GTTG STGPHLHYE+ + G   +   
Sbjct: 339 HSNGFETYYAHLSAFATGIRPGRSVNQGQVVAYVGTTGASTGPHLHYEVRIAGRPQNPMA 398

Query: 611 VRIPERENLKGDLLQRFAMEKKRINSLLNNGE 642
           +++P    L      RF  +    +  L    
Sbjct: 399 IKLPGAPPLAVAQRARFLQQTADWSDKLALLR 430


>gi|319785785|ref|YP_004145260.1| peptidase M23 [Pseudoxanthomonas suwonensis 11-1]
 gi|317464297|gb|ADV26029.1| Peptidase M23 [Pseudoxanthomonas suwonensis 11-1]
          Length = 469

 Score =  328 bits (841), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 99/432 (22%), Positives = 165/432 (38%), Gaps = 20/432 (4%)

Query: 213 IMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIP 272
               +            +    P    Q    P  ++     +    T+ +P        
Sbjct: 43  TRRHWVHASLFATLGALVATIVPGFSAQLEPQPKLHATLPLSLP-PLTVHAPTAAQPGH- 100

Query: 273 EFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDD 332
               +++ IQ   T+       G S     +I +   N   + +L     L   +     
Sbjct: 101 --QWEVVQIQRGQTLGALFESMGVSTQVMHQILEQPGNREPLTRLRAGAELAFALDDDGQ 158

Query: 333 KFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWR 392
                RF     ++  LT+A             +   +  +    R +  S  I   ++ 
Sbjct: 159 LHG-FRFDRSPSERVELTLA----------GGKIHEKVLERATTTRVAVTSAEIEHSLYA 207

Query: 393 ATSFNGMNSNLVKLIM-RTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHA 451
           A    G++   + ++        ++  + ++  D             +      +L    
Sbjct: 208 AGRKAGLSPASIAVMTDEIFKYDIDF-KDVQRGDRFSAVVEEVWREGERIGGGRILAASF 266

Query: 452 RFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSR 511
             G       RF       V Y+   G+  +   +R P+P+ R++S FG R HP+LG  R
Sbjct: 267 TTGGKTYTGLRFEQDG--KVGYYTPEGRPLKKSFIRMPIPYARLSSSFGARRHPVLGKMR 324

Query: 512 MHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKA 571
           MH GVD+AA  GTPI+A GD  V+      GYG   ++ HG G+ + Y H     K ++ 
Sbjct: 325 MHKGVDYAAGTGTPIMAAGDARVQFVGQQRGYGNVVILDHGKGHTTLYAHMSRFGK-VRQ 383

Query: 572 GTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEK 631
           G  V QG +IG++G+TGL+TGPHLHYE  VNG   +   V +P  E LKG  L  F  + 
Sbjct: 384 GQTVSQGTVIGYVGSTGLATGPHLHYEFRVNGQHRNPLSVTMPPPEPLKGPALAAFRAQV 443

Query: 632 KRINSLLNNGEN 643
               + + + E 
Sbjct: 444 APTLARIESMEK 455


>gi|71901535|ref|ZP_00683619.1| Peptidase M23B [Xylella fastidiosa Ann-1]
 gi|71728690|gb|EAO30837.1| Peptidase  M23B [Xylella fastidiosa Ann-1]
          Length = 471

 Score =  328 bits (841), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 100/385 (25%), Positives = 168/385 (43%), Gaps = 15/385 (3%)

Query: 260 TITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTK 319
           T+  P             ++ I+   T+         S+ D  ++         + +L+ 
Sbjct: 81  TLALPLPPTYTSTANTWRMVTIKPGQTLSSIFNELKLSSNDMERVLNYADLRKVLTRLSP 140

Query: 320 DEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRT 379
            + +   +        +        +KH + + L+DN         +   ++ +    RT
Sbjct: 141 GDEISFDIPNDG---QLRGMRFNRDEKHRVELTLDDN--------TIHQQVSERQTSTRT 189

Query: 380 SEESPNIYDGIWRATSFNGMNS-NLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANN 438
              S  I   +W A    G++  +++ L        ++  + L+  D             
Sbjct: 190 VIASGEIKSSLWIAAREAGLSPVDVITLTDEIFKYDIDFDKDLQTGDRFSVVMDETWREG 249

Query: 439 QASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSG 498
           +   D+++L      G       RF+      VEYF++ G+  +   +R P+ + R++S 
Sbjct: 250 ERLPDAKILAATFNTGGKIYSGIRFMRDG--KVEYFDKEGRPLKKSFIRMPISYARLSST 307

Query: 499 FGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSS 558
           FG+R HPILG  RMH GVD+AA  GTPI+A GD  V+      GYG   +++HG GY + 
Sbjct: 308 FGLRRHPILGTMRMHKGVDYAAATGTPIMAAGDARVQFIGQQRGYGNVVILNHGKGYRTL 367

Query: 559 YNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPEREN 618
           Y H     K IKAG  + QG +IG++G TGL+TGPHLHYE  VNG   +   + +P  E 
Sbjct: 368 YGHMSRFGK-IKAGQKINQGTVIGYVGMTGLATGPHLHYEFQVNGQHRNPLSITMPPPEP 426

Query: 619 LKGDLLQRFAMEKKRINSLLNNGEN 643
           L+G  L  F  +   + + +   E 
Sbjct: 427 LRGKDLIAFRTQTAPLIAQIQQYEK 451


>gi|297580756|ref|ZP_06942682.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|297535172|gb|EFH74007.1| conserved hypothetical protein [Vibrio cholerae RC385]
          Length = 433

 Score =  328 bits (840), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 88/415 (21%), Positives = 170/415 (40%), Gaps = 24/415 (5%)

Query: 242 HDHPITYSKKIKIIEENRTITSPQVLIDKIPEF--ADDLIPIQHNTTIFDAMVHAGYSNG 299
            D      +   +  +N+ +++P+  +   P      +   + +  +       AG S+ 
Sbjct: 39  PDAQREVGRHYPVTLDNQLVSTPEEEVIAPPSVMLRWETYQVANGESAALLFQRAGLSSR 98

Query: 300 DSAKIAKALKNEVR-VDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNE 358
              ++  +  +    + +L   + L+ G  + +    + R            +  +D+  
Sbjct: 99  VLYELTSSNSDINNQLSKLMPKDELKFGFDRDNQLVQLKRTI---SPYETFVVTRSDSG- 154

Query: 359 YVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQ 418
                     + + +    + +     I    W A    G+++N +  +       ++  
Sbjct: 155 -------FTSEFDKKEVTFQLNYAEAKITSNFWNAGVAAGLSANQIIELANMFGWDIDFA 207

Query: 419 EHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENG 478
             ++  D  +  +              ++        +           D +  Y+++NG
Sbjct: 208 LDIREGDQFKLLYQEKIVEGSVIGRGNIIAATFINQGSTFTAIL----DDNTGNYYDQNG 263

Query: 479 KSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKA 537
           ++ +   LR+P+ F R++S F  R  HP+ G  + H G D+ AP GTPI A GDG+VEK+
Sbjct: 264 RAMKKAFLRSPLDFRRVSSNFNPRRLHPVTGQIKAHRGTDYVAPVGTPIWAAGDGVVEKS 323

Query: 538 NWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHY 597
           ++    G    I H N Y++ Y H     + +K G  VKQGQ IG +G TG  TGPHLHY
Sbjct: 324 SYNQFNGNYVYIRHSNTYITKYLHLQR--RLVKTGERVKQGQTIGTLGGTGRVTGPHLHY 381

Query: 598 ELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
           E +VNGI  +   V +P+ ++L G   + F    K+    +   E   + L+ + 
Sbjct: 382 EFLVNGIHKNPRTVELPQAQSLTGKAKETFIANAKQ---RMEKLERYSQLLYANQ 433


>gi|15640650|ref|NP_230279.1| hypothetical protein VC0630 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|147675357|ref|YP_001216124.1| hypothetical protein VC0395_A0159 [Vibrio cholerae O395]
 gi|153820320|ref|ZP_01972987.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|153823556|ref|ZP_01976223.1| conserved hypothetical protein [Vibrio cholerae B33]
 gi|227080811|ref|YP_002809362.1| hypothetical protein VCM66_0588 [Vibrio cholerae M66-2]
 gi|229505748|ref|ZP_04395258.1| membrane protein [Vibrio cholerae BX 330286]
 gi|229509219|ref|ZP_04398704.1| membrane protein [Vibrio cholerae B33]
 gi|229519572|ref|ZP_04409015.1| membrane protein [Vibrio cholerae RC9]
 gi|229608859|ref|YP_002879507.1| membrane protein [Vibrio cholerae MJ-1236]
 gi|254850864|ref|ZP_05240214.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|255744153|ref|ZP_05418106.1| membrane protein [Vibrio cholera CIRS 101]
 gi|262155727|ref|ZP_06028851.1| membrane protein [Vibrio cholerae INDRE 91/1]
 gi|262169930|ref|ZP_06037620.1| membrane protein [Vibrio cholerae RC27]
 gi|298500746|ref|ZP_07010549.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|9655065|gb|AAF93796.1| conserved hypothetical protein [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|126509134|gb|EAZ71728.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|126518925|gb|EAZ76148.1| conserved hypothetical protein [Vibrio cholerae B33]
 gi|146317240|gb|ABQ21779.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|227008699|gb|ACP04911.1| conserved hypothetical protein [Vibrio cholerae M66-2]
 gi|227012455|gb|ACP08665.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|229344261|gb|EEO09236.1| membrane protein [Vibrio cholerae RC9]
 gi|229353791|gb|EEO18727.1| membrane protein [Vibrio cholerae B33]
 gi|229357971|gb|EEO22888.1| membrane protein [Vibrio cholerae BX 330286]
 gi|229371514|gb|ACQ61937.1| membrane protein [Vibrio cholerae MJ-1236]
 gi|254846569|gb|EET24983.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|255738093|gb|EET93485.1| membrane protein [Vibrio cholera CIRS 101]
 gi|262021664|gb|EEY40375.1| membrane protein [Vibrio cholerae RC27]
 gi|262030438|gb|EEY49078.1| membrane protein [Vibrio cholerae INDRE 91/1]
 gi|297540527|gb|EFH76585.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
          Length = 433

 Score =  328 bits (840), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 88/415 (21%), Positives = 170/415 (40%), Gaps = 24/415 (5%)

Query: 242 HDHPITYSKKIKIIEENRTITSPQVLIDKIPEF--ADDLIPIQHNTTIFDAMVHAGYSNG 299
            D      +   +  +N+ +++P+  +   P      +   + +  +       AG S+ 
Sbjct: 39  PDAQREVGRHYPVTLDNQLVSTPEEEVIAPPSVMLRWETYQVANGESAALLFQRAGLSSR 98

Query: 300 DSAKIAKALKNEVR-VDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNE 358
              ++  +  +    + +L   + L+ G  + +    + R            +  +D+  
Sbjct: 99  VLYELTSSNSDINNQLSKLMPKDELKFGFDKDNQLVQLKRTI---SPYETFVVTRSDSG- 154

Query: 359 YVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQ 418
                     + + +    + +     I    W A    G+++N +  +       ++  
Sbjct: 155 -------FTSEFDKKEVTFQLNYAEAKITSNFWNAGVTAGLSANQIIELANMFGWDIDFA 207

Query: 419 EHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENG 478
             ++  D  +  +              ++        +           D +  Y+++NG
Sbjct: 208 LDIREGDQFKLLYQEKIVEGSVIGRGNIIAATFINQGSTFTAIL----DDNTGNYYDQNG 263

Query: 479 KSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKA 537
           ++ +   LR+P+ F R++S F  R  HP+ G  + H G D+ AP GTPI A GDG+VEK+
Sbjct: 264 RAMKKAFLRSPLDFRRVSSNFNPRRLHPVTGQIKAHRGTDYVAPVGTPIWAAGDGVVEKS 323

Query: 538 NWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHY 597
           ++    G    I H N Y++ Y H     + +K G  VKQGQ IG +G TG  TGPHLHY
Sbjct: 324 SYNQFNGNYVYIRHSNTYITKYLHLQR--RLVKTGERVKQGQTIGTLGGTGRVTGPHLHY 381

Query: 598 ELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
           E +VNGI  +   V +P+ ++L G   + F    K+    +   E   + L+ + 
Sbjct: 382 EFLVNGIHKNPRTVELPQAQSLTGKAKETFIANAKQ---RMEKLERYSQLLYANQ 433


>gi|71275877|ref|ZP_00652160.1| Peptidase M23B [Xylella fastidiosa Dixon]
 gi|71163254|gb|EAO12973.1| Peptidase  M23B [Xylella fastidiosa Dixon]
          Length = 471

 Score =  328 bits (840), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 100/385 (25%), Positives = 168/385 (43%), Gaps = 15/385 (3%)

Query: 260 TITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTK 319
           T+  P             ++ I+   T+         S+ D  ++         + +L+ 
Sbjct: 81  TLALPLPPQYTSTANTWRMVTIKPGQTLSSIFNELKLSSNDMERVLNYADLRKVLTRLSP 140

Query: 320 DEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRT 379
            + +   +        +        +KH + + L+DN         +   ++ +    RT
Sbjct: 141 GDEISFDIPNDG---QLRGMRFNRDEKHRVELTLDDN--------TIHQQVSERQTSTRT 189

Query: 380 SEESPNIYDGIWRATSFNGMNS-NLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANN 438
              S  I   +W A    G++  +++ L        ++  + L+  D             
Sbjct: 190 VIASGEIKSSLWIAAREAGLSPVDVITLTDEIFKYDIDFDKDLQTGDRFSVVMDETWREG 249

Query: 439 QASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSG 498
           +   D+++L      G       RF+      VEYF++ G+  +   +R P+ + R++S 
Sbjct: 250 ERLPDAKILAATFNTGGKIYSGIRFMRDG--KVEYFDKEGRPLKKSFIRMPISYARLSST 307

Query: 499 FGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSS 558
           FG+R HPILG  RMH GVD+AA  GTPI+A GD  V+      GYG   +++HG GY + 
Sbjct: 308 FGLRRHPILGTMRMHKGVDYAAATGTPIMAAGDARVQFIGQQRGYGNVVILNHGKGYRTL 367

Query: 559 YNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPEREN 618
           Y H     K IKAG  + QG +IG++G TGL+TGPHLHYE  VNG   +   + +P  E 
Sbjct: 368 YGHMSRFGK-IKAGQKINQGTVIGYVGMTGLATGPHLHYEFQVNGQHRNPLSITMPPPEP 426

Query: 619 LKGDLLQRFAMEKKRINSLLNNGEN 643
           L+G  L  F  +   + + +   E 
Sbjct: 427 LRGKDLIAFRTQTAPLIAQIQQYEK 451


>gi|90020734|ref|YP_526561.1| 3'-5' exoribonuclease, VacB and RNase II [Saccharophagus degradans
           2-40]
 gi|89950334|gb|ABD80349.1| peptidase M23B [Saccharophagus degradans 2-40]
          Length = 460

 Score =  327 bits (839), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 87/421 (20%), Positives = 165/421 (39%), Gaps = 19/421 (4%)

Query: 227 SFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLID-KIPEFADDLIPIQHNT 285
             ++  +D  +  +        +   ++ E+  T+       + K   +      ++   
Sbjct: 36  GASMLPSDNASASRHEQVIAIPALS-QVDEQPITLPVEPPPPEVKQTPYRISNQTVRSGD 94

Query: 286 TIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQ 345
            +      AG S+     +     +  R+ +L     L   +    D+  +V       +
Sbjct: 95  NLSLIFKRAGLSDKHMIGLLNGNADSKRLTKLFPGHTLEFSIS---DEGELVELQYVKSR 151

Query: 346 KHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVK 405
            + L     D+            +   +   + ++  S  I   ++ A     ++  L+ 
Sbjct: 152 LNKLVYTKLDSG--------YDFEEIVRQPDIHSASRSGKISTSLFDAGMQANLDDRLIM 203

Query: 406 LIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLN 465
                    V+    ++  D  +  +     + +   + E+L           R  R++N
Sbjct: 204 EFANIFGWDVDFALDIRKGDTFKVLYEEKFLDGEKLGNGEILAAEFINQGEAFRAVRYVN 263

Query: 466 PVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGT 524
               S  Y+  +G S R   LR P+ F R++S F  +  HPI    R H G D+AA RGT
Sbjct: 264 EDGES-SYYAPDGTSMRKAFLRAPLDFRRISSNFNPKRLHPITKVVRPHRGTDYAADRGT 322

Query: 525 PIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWI 584
           P+ A G G V  + +    G   +I HGN   + Y H     + +K G  VKQ Q IG +
Sbjct: 323 PVWAAGAGRVIASGYTQYNGNYIVIQHGNNIQTKYLHLHK--RFVKKGDRVKQKQRIGSV 380

Query: 585 GTTGLSTGPHLHYELIVNGIKVDSTKV--RIPERENLKGDLLQRFAMEKKRINSLLNNGE 642
           G+TGLS  PHLHYE +++G+  +   V  ++P+ +++    + RF  + +   + L    
Sbjct: 381 GSTGLSQAPHLHYEFLLDGVHRNPRTVINKLPKADSIAKSEMARFQNQTQVWIAELEPTT 440

Query: 643 N 643
           N
Sbjct: 441 N 441


>gi|9104961|gb|AAF82980.1|AE003870_6 conserved hypothetical protein [Xylella fastidiosa 9a5c]
          Length = 417

 Score =  327 bits (837), Expect = 4e-87,   Method: Composition-based stats.
 Identities = 100/385 (25%), Positives = 167/385 (43%), Gaps = 15/385 (3%)

Query: 260 TITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTK 319
           T+  P             ++ I+   T+         S+ D  ++         + +L+ 
Sbjct: 27  TLALPLPPPYTSTADTWRMVTIKPGQTLSSIFNELKLSSNDMERVLNYADLRKLLTRLSP 86

Query: 320 DEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRT 379
            + +   +        +        +KH + + L+DN         +   ++ +    RT
Sbjct: 87  GDEISFDIPNDG---QLRGMRFNRDEKHRVELTLDDN--------TIHQQVSERQTSTRT 135

Query: 380 SEESPNIYDGIWRATSFNGMNSNLVKLIM-RTLASSVNLQEHLKPTDFLETFFSVNHANN 438
              S  I   +W A    G++   V  +        ++  + L+  D             
Sbjct: 136 VIASGEIKSSLWIAAREAGLSPADVITLTDEIFKYDIDFDKDLQTGDRFSVVMDETWREG 195

Query: 439 QASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSG 498
           +   D+++L      G       RF+      VEYF+++G+  +   +R P+ + R++S 
Sbjct: 196 ERLPDAKILAATFNTGGKIYSGMRFMRDG--KVEYFDKDGRPLKKSFIRMPISYARLSST 253

Query: 499 FGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSS 558
           FG+R HPILG  RMH GVD+AA  GTPI+A GD  V+      GYG   +++HG GY + 
Sbjct: 254 FGLRRHPILGTMRMHKGVDYAAATGTPIMAAGDARVQFIGQQRGYGNVVILNHGKGYRTL 313

Query: 559 YNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPEREN 618
           Y H     K IKAG  + QG +IG++G TGL+TGPHLHYE  VNG   +   + +P  E 
Sbjct: 314 YGHMSRFGK-IKAGQKINQGTVIGYVGMTGLATGPHLHYEFQVNGQHRNPLSITMPPPEP 372

Query: 619 LKGDLLQRFAMEKKRINSLLNNGEN 643
           L+G  L  F  +   + + +   E 
Sbjct: 373 LRGKDLIAFRTQTAPLIAQIQQYEK 397


>gi|163854916|ref|YP_001629214.1| hypothetical protein Bpet0611 [Bordetella petrii DSM 12804]
 gi|163258644|emb|CAP40943.1| conserved hypothetical protein [Bordetella petrii]
          Length = 494

 Score =  327 bits (837), Expect = 4e-87,   Method: Composition-based stats.
 Identities = 90/422 (21%), Positives = 154/422 (36%), Gaps = 9/422 (2%)

Query: 227 SFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTT 286
           +  L         +        S  + +  +  ++++       I E       I+   T
Sbjct: 72  AAALGMVQQPDHSELPPSRQIQSI-LPLQPDQVSLSTDDSSAPYISETR-----IRPGDT 125

Query: 287 IFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQK 346
           +   +           +      +   + +L     ++     +     +        ++
Sbjct: 126 LAAVLQRLEIDAPGLQRFLTQAPSARSIYKLYPGRAVQAATDAEGKLVWLRYIHTPGDEE 185

Query: 347 HLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKL 406
           +                E             +T      I   ++ AT   G+  ++   
Sbjct: 186 NGQVTTR--MLLVTPSQEGYTAREIADNTDRQTRVAVGTIRSSLFGATDAAGVPDSVTLQ 243

Query: 407 IMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNP 466
           +   L S V+    ++  D     + V     + +    +L +             F +P
Sbjct: 244 MADILNSKVDFLRDIRRGDQFRVVYEVRSHQGRYAGAGRVLALEFVNNGKTYNAVWF-SP 302

Query: 467 VDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPI 526
              S  Y++ +G S R   LRT + F R++S FGMR HPI      H GVD+AAP GTPI
Sbjct: 303 DGKSGSYYDFDGVSLRGAFLRTALKFSRISSTFGMRMHPIHKTWTGHKGVDYAAPSGTPI 362

Query: 527 VAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGT 586
            +  +G VE A    GYG   +I H   Y + Y HQ  IA  IK G  V QGQ+IG++G+
Sbjct: 363 HSTAEGTVEFAGQQRGYGNVVIIKHFGKYSTVYAHQSRIAAGIKPGVKVSQGQLIGYVGS 422

Query: 587 TGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKK 646
           TG +TGPHLHYE  ++   V+     +P    L     ++F          +      ++
Sbjct: 423 TGWATGPHLHYEFRIDNQPVNPLAADLPVSRPLDAAEARKFKAAVLPYKQQIALLTQFQQ 482

Query: 647 PL 648
            L
Sbjct: 483 TL 484


>gi|254517419|ref|ZP_05129476.1| 3'-5' exoribonuclease, VacB and RNase II [gamma proteobacterium
           NOR5-3]
 gi|219674257|gb|EED30626.1| 3'-5' exoribonuclease, VacB and RNase II [gamma proteobacterium
           NOR5-3]
          Length = 443

 Score =  327 bits (837), Expect = 4e-87,   Method: Composition-based stats.
 Identities = 88/387 (22%), Positives = 163/387 (42%), Gaps = 19/387 (4%)

Query: 263 SPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEI 322
           + +        + +    ++    +      AG+S  D  +I         ++++   + 
Sbjct: 60  TEEPAPPASQPWEEF--IVRSGDNLSLLFKRAGFSTSDVYQIVHTAPQGRDLERIYPGQS 117

Query: 323 LRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEE 382
           L     +      +              +    +  +         +   +    R S  
Sbjct: 118 LAFLRDESGGLAAVRHTI----DGLQSVVYRRMDGGFSS-------ERAIREPEQRLSWA 166

Query: 383 SPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASD 442
           +  I   ++ A    G++SNL+      L   ++     +  D +E  +   + + +   
Sbjct: 167 TVEIESSLFLAGKEAGLSSNLIMEAAIILGGVIDFVMDPRKGDTMEILYEELYLDGEKYQ 226

Query: 443 DSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMR 502
           D +++         R   YR+++       Y+NE+G S R   L  PV F R++SGF  R
Sbjct: 227 DGKVVAASYTNRGERFDAYRYIDSNG-MTSYYNEDGVSMRKAFLMAPVDFTRISSGFNPR 285

Query: 503 Y-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNH 561
             HPI    R H G D+AAPRGTP+ + GDG V +A ++   G    I HG+ YV+ Y H
Sbjct: 286 RKHPIYKTVRPHNGTDYAAPRGTPVFSAGDGRVIEAGYSRANGNYVFIQHGDRYVTKYLH 345

Query: 562 QDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVR--IPERENL 619
            +   + +K+G  V Q Q+IG +G+TG +TGPHLHYE +V G+  +   +   +P+ ++L
Sbjct: 346 LNK--RKVKSGQRVVQSQVIGTVGSTGAATGPHLHYEFLVGGVHRNPRTIHKSLPKAKSL 403

Query: 620 KGDLLQRFAMEKKRINSLLNNGENPKK 646
             + + RF +      + L      ++
Sbjct: 404 PEEEMPRFRVAIADAATQLAQLREERR 430


>gi|170729375|ref|YP_001774808.1| metallopeptidase [Xylella fastidiosa M12]
 gi|167964168|gb|ACA11178.1| metallopeptidase [Xylella fastidiosa M12]
          Length = 471

 Score =  327 bits (837), Expect = 5e-87,   Method: Composition-based stats.
 Identities = 99/385 (25%), Positives = 168/385 (43%), Gaps = 15/385 (3%)

Query: 260 TITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTK 319
           T+  P             ++ I+   T+         S+ D  ++         + +L+ 
Sbjct: 81  TLALPLPPQYTSTANTWRMVTIKPGQTLSSIFNELKLSSNDMERVLNYADLRKVLTRLSP 140

Query: 320 DEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRT 379
            + +   +        +        +KH + + L+DN         +   ++ +    RT
Sbjct: 141 GDEISFDIPNDG---QLRGMRFNRDEKHRVELTLDDN--------TIHQQVSERQTSTRT 189

Query: 380 SEESPNIYDGIWRATSFNGMNS-NLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANN 438
              S  I   +W A    G++  +++ L        ++  + L+  D             
Sbjct: 190 VIASGEIKSSLWIAAREAGLSPVDVITLTDEIFKYDIDFDKDLQTGDRFSVVMDETWREG 249

Query: 439 QASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSG 498
           +   D+++L      G       RF+      VEYF++ G+  +   +R P+ + R++S 
Sbjct: 250 ERLPDAKILAATFNTGGKIYSGIRFMRDG--KVEYFDKEGRPLKKSFIRMPISYARLSST 307

Query: 499 FGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSS 558
           FG+R HPILG  RMH GVD+AA  GTPI+A G+  V+      GYG   +++HG GY + 
Sbjct: 308 FGLRRHPILGTMRMHKGVDYAAATGTPIMAAGNARVQFIGQQRGYGNVVILNHGKGYRTL 367

Query: 559 YNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPEREN 618
           Y H     K IKAG  + QG +IG++G TGL+TGPHLHYE  VNG   +   + +P  E 
Sbjct: 368 YGHMSRFGK-IKAGQKINQGTVIGYVGMTGLATGPHLHYEFQVNGQHRNPLSITMPPPEP 426

Query: 619 LKGDLLQRFAMEKKRINSLLNNGEN 643
           L+G  L  F  +   + + +   E 
Sbjct: 427 LRGKDLIAFRTQTAPLIAQIQQYEK 451


>gi|218887170|ref|YP_002436491.1| peptidase M23 [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218758124|gb|ACL09023.1| Peptidase M23 [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 441

 Score =  327 bits (837), Expect = 5e-87,   Method: Composition-based stats.
 Identities = 100/418 (23%), Positives = 165/418 (39%), Gaps = 20/418 (4%)

Query: 223 KKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQ 282
           ++ +       D    D     P           E R         +  PE       + 
Sbjct: 27  RRGEQSAETAVDTTVADCNATAPAGQLP-----PELRAEGGADGQGEGQPEVVQG--VVS 79

Query: 283 HNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIY 342
              T    +     S+ D   +  A +    + +L   +   +          I RF   
Sbjct: 80  TGDTAGKILQEW-LSSVDVHTMVAACEKVYSLARLRAGQPYIVVANASVGG--IERFEYE 136

Query: 343 HKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSN 402
                 L ++   N+ +   VEP++ D++              I   ++++ +  G +  
Sbjct: 137 IDNSQKLIVSKT-NDSFAARVEPIQYDVDVVRVE-------GTIESNLFQSVADAGESPT 188

Query: 403 LVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYR 462
           L   +       V+    ++  D           + +      +L       +   R Y 
Sbjct: 189 LAIRLADIFGWEVDFIRDIREGDSFTVLVEKRFRDGEFKGYGRVLAAIFTNQDQTHRAYL 248

Query: 463 FLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAP 521
           F + +    +Y+N  G S R   L+ P+ F R++SG+ M   HPI    R H GVD+AAP
Sbjct: 249 FHDDLGI-PQYYNPEGASMRRSFLKAPLSFTRISSGYTMTRKHPIFSDVRPHQGVDYAAP 307

Query: 522 RGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQII 581
            GTP+ AVG+G+V  A W  GYG   ++ H NGY S Y H    A+ ++ G  VKQG +I
Sbjct: 308 TGTPVKAVGNGVVSSAGWGNGYGNLIILRHSNGYESYYGHLSGFARGVRKGATVKQGDVI 367

Query: 582 GWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLN 639
           G++G TG +TGPHL + L  +G  ++ TK   P  E +   LL  F  + + I   L+
Sbjct: 368 GYVGATGWATGPHLDFRLKKDGKFINPTKNISPRSEPVARKLLPDFRRQMEAIRPYLD 425


>gi|297182444|gb|ADI18607.1| membrane proteins related to metalloendopeptidases [uncultured
           Rhodospirillales bacterium HF4000_24M03]
          Length = 418

 Score =  326 bits (836), Expect = 6e-87,   Method: Composition-based stats.
 Identities = 96/387 (24%), Positives = 167/387 (43%), Gaps = 11/387 (2%)

Query: 267 LIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIG 326
                       + +    T+   MV AG   G++     A+        +     + + 
Sbjct: 39  SEPSPNPPVIRNLVVARGDTLMALMVKAGVPRGEAYAAITAVSKVYEPRDIKPGLRVTVT 98

Query: 327 V--VQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESP 384
               +  D   +    I    +  + +  +D   +             +    R  +   
Sbjct: 99  RRANEPGDPLLLWGLDIDVDVRQRVALRRDDAGGFRAVS-------LERALTARVVQAGG 151

Query: 385 NIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVN-HANNQASDD 443
            I   ++ A     + + ++  ++R  +  V+ Q  ++P D  E  +         A  +
Sbjct: 152 VIKSSLYLAGRRAEVPAAVLAKLIRIFSFDVDFQRDVQPDDSFEVTYERLHDEAGAAVAE 211

Query: 444 SELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY 503
             +L         R R YR +       +Y++  G+S R  L+ TP+   R++SGFG R 
Sbjct: 212 GAILIAEMVLSGKRMRLYRHVTEDG-ETDYYDARGRSVRKALVVTPIDGARISSGFGRRR 270

Query: 504 HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQD 563
           HPILGY++MH G D+AAPRGTP+   G G++E+A   G +G    I H   Y ++Y H  
Sbjct: 271 HPILGYTKMHRGTDFAAPRGTPVYGAGRGVIERAGRNGAFGHYIRIRHNGTYKTAYAHLK 330

Query: 564 AIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDL 623
             A+ +K G  VKQGQ+IG++G++G STGPHLHYE++ NG +++  ++ +P    LKG  
Sbjct: 331 GYARGVKRGKRVKQGQVIGYVGSSGRSTGPHLHYEILRNGKQINPKRLNLPSGRILKGAD 390

Query: 624 LQRFAMEKKRINSLLNNGENPKKPLFT 650
           L RF   +  +          ++    
Sbjct: 391 LARFQAARGALEERAAGLPGAQRTAGA 417


>gi|312884001|ref|ZP_07743718.1| hypothetical protein VIBC2010_01923 [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309368459|gb|EFP95994.1| hypothetical protein VIBC2010_01923 [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 428

 Score =  326 bits (836), Expect = 6e-87,   Method: Composition-based stats.
 Identities = 95/417 (22%), Positives = 166/417 (39%), Gaps = 20/417 (4%)

Query: 234 DPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVH 293
            P  +D R    +    +   IE N    S +         + +   I    ++      
Sbjct: 29  LPAPIDLRQSETVYQIGQAYPIEINSEQLSIEKNEPTHSFLSWEEYKIGPGDSMALLFQR 88

Query: 294 AGYSNGDSAKIAKALKNEVR-VDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIA 352
           AG S+    ++    K     + ++   +  ++G  ++ +   I R            I 
Sbjct: 89  AGLSSRLLYELTSTSKEIQEQLTRVKPGDKFQLGFDEQHELVQIKR---QLSPYKTFLIT 145

Query: 353 LNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLA 412
            +               +  +    + +    NI    W A    G+  N +  +     
Sbjct: 146 KSSPG--------YTSRVEQKKVNYQFNYAEANIQSNFWNAGVSAGLTPNQIMELAGIFG 197

Query: 413 SSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVE 472
             ++    ++  D  +  +       +     +++           +        D +  
Sbjct: 198 WDIDFALDIRKGDSFKILYQEKIVEGEVIGRGQIIAAIFTNQGDTFKAIL----DDATGN 253

Query: 473 YFNENGKSSRPFLLRTPVPFGRMTSGFGM-RYHPILGYSRMHTGVDWAAPRGTPIVAVGD 531
           Y++ENG++ +   LR+P+ F R++S F   R HP+ G  R H G D+AAP GTPI A GD
Sbjct: 254 YYDENGRAMKKAFLRSPLDFRRVSSNFNPSRRHPVTGKVRAHRGTDYAAPVGTPIWAAGD 313

Query: 532 GIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLST 591
           G+V K+++    G    I H N Y++ Y H     + +K G  VKQGQ IG +G TG  T
Sbjct: 314 GLVIKSSYNQFNGNYVFIKHSNTYITKYLHLKR--RKVKTGQRVKQGQTIGTLGGTGRVT 371

Query: 592 GPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKK-RINSLLNNGENPKKP 647
           GPHLHYE +V+G+  +   V++P+ ++L G     +    K R+  L    E   KP
Sbjct: 372 GPHLHYEFLVHGVHKNPRTVKLPQSKSLTGKAKTTYIANAKLRLAKLSRYSELLAKP 428


>gi|77747632|ref|NP_778381.2| metallopeptidase [Xylella fastidiosa Temecula1]
 gi|182680695|ref|YP_001828855.1| peptidase M23 [Xylella fastidiosa M23]
 gi|182630805|gb|ACB91581.1| Peptidase M23 [Xylella fastidiosa M23]
 gi|307579160|gb|ADN63129.1| peptidase M23 [Xylella fastidiosa subsp. fastidiosa GB514]
          Length = 471

 Score =  326 bits (836), Expect = 7e-87,   Method: Composition-based stats.
 Identities = 99/385 (25%), Positives = 168/385 (43%), Gaps = 15/385 (3%)

Query: 260 TITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTK 319
           T+  P             ++ I+   T+         S+ D  ++         + +L+ 
Sbjct: 81  TLALPLPPQYTSTADTWRMVTIKPGQTLSSIFNELKLSSNDMERVLNYADLRKVLTRLSP 140

Query: 320 DEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRT 379
            + +   +        +        +KH + + ++DN         +   ++ +    RT
Sbjct: 141 GDEISFDIPNDG---QLRGMRFNRDEKHRVELTIDDN--------TIHQQVSQRQTSTRT 189

Query: 380 SEESPNIYDGIWRATSFNGMNS-NLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANN 438
              S  I   +W A    G++  +++ L        ++  + L+  D             
Sbjct: 190 VIASGEIKSSLWIAAREAGLSPVDVITLTDEIFKYDIDFDKDLQTGDRFSVVMDETWREG 249

Query: 439 QASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSG 498
           +   D+++L      G       RF+      VEYF++ G+  +   +R P+ + R++S 
Sbjct: 250 ERLPDAKILAATFNTGGKIYSGIRFMRDG--KVEYFDKEGRPLKKSFIRMPISYARLSST 307

Query: 499 FGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSS 558
           FG+R HPILG  RMH GVD+AA  GTPI+A GD  V+      GYG   +++HG GY + 
Sbjct: 308 FGLRRHPILGTMRMHKGVDYAAATGTPIMAAGDARVQFIGQQRGYGNVVILNHGKGYRTL 367

Query: 559 YNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPEREN 618
           Y H     K IKAG  + QG +IG++G TGL+TGPHLHYE  VNG   +   + +P  E 
Sbjct: 368 YGHMSRFGK-IKAGQKINQGTVIGYVGMTGLATGPHLHYEFQVNGQHRNPLSITMPPPEP 426

Query: 619 LKGDLLQRFAMEKKRINSLLNNGEN 643
           L+G  L  F  +   + + +   E 
Sbjct: 427 LRGKDLIAFRTQTAPLIAQIQQYEK 451


>gi|77920066|ref|YP_357881.1| metalloendopeptidase-like membrane protein [Pelobacter carbinolicus
           DSM 2380]
 gi|77546149|gb|ABA89711.1| metalloendopeptidase-like membrane protein [Pelobacter carbinolicus
           DSM 2380]
          Length = 441

 Score =  326 bits (835), Expect = 8e-87,   Method: Composition-based stats.
 Identities = 87/389 (22%), Positives = 158/389 (40%), Gaps = 15/389 (3%)

Query: 256 EENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVD 315
            E   + +P      + +       +Q   T+   +    ++      + ++ ++   + 
Sbjct: 45  PEKPVLAAPAEPPAPVIDRKVTKSTVQPGDTVTSLLGDI-FTPRQIYLLNQSSQSVFPLS 103

Query: 316 QLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMD 375
           +L   +   + ++          F     ++  L +   + + + +   P++        
Sbjct: 104 RLCAGQNYELCLL----DGRFESFVYDIDREEQLVV-KPEGDGFAVSKIPIEY------- 151

Query: 376 YMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNH 435
            ++T   +  I   ++ A   +G    L   +    A  ++    ++  D  E      +
Sbjct: 152 AVKTELVTGTINSSLFEAVVASGEKEALAINLADIFAWDIDFIRDIQVGDSFEALVEKRY 211

Query: 436 ANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRM 495
                +    +L                    D +  Y++E G+S R   L+ P+ F R+
Sbjct: 212 REGNEAGYGRILAARFTNQGQAYN-AYLFQDGDQAPAYYDEKGRSVRKAFLKAPLSFSRI 270

Query: 496 TSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNG 554
           +SGF MR  HPI    R H  +D+AAP GTPI  V DG V  A +    G    + H  G
Sbjct: 271 SSGFNMRRLHPITKKVRPHPAIDYAAPTGTPIKTVADGTVTFAAYKRYNGNCVKVRHPGG 330

Query: 555 YVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIP 614
           +V+ YNH     + IK G  V+QGQ IG++GTTG STGPHL + +  NG+ V+  KV+ P
Sbjct: 331 WVTMYNHMSRFGRGIKKGVKVRQGQFIGYVGTTGRSTGPHLDFRMYKNGVAVNPLKVKSP 390

Query: 615 ERENLKGDLLQRFAMEKKRINSLLNNGEN 643
               +    L  F +   R+ S L+  + 
Sbjct: 391 PSAPVSSQRLASFKLVVNRLASRLDGIDA 419


>gi|74316476|ref|YP_314216.1| peptidase family protein [Thiobacillus denitrificans ATCC 25259]
 gi|74055971|gb|AAZ96411.1| peptidase family protein [Thiobacillus denitrificans ATCC 25259]
          Length = 438

 Score =  326 bits (835), Expect = 9e-87,   Method: Composition-based stats.
 Identities = 93/392 (23%), Positives = 159/392 (40%), Gaps = 15/392 (3%)

Query: 254 IIEENRT--ITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNE 311
           I  +     I  P           +    IQ   T+  A+      + +  ++       
Sbjct: 51  ITPQTVIEGIALPASYAGSGDMTFERESTIQSGDTLSSALARLQLDDLEIQQLVSNKALR 110

Query: 312 VRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDIN 371
               ++   + ++    Q      +V      +    +T+    +               
Sbjct: 111 PLAAEIRAGKRIQATTTQDG---QLVSLRFERRGAPTMTVTREGDGYVATEASD------ 161

Query: 372 HQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFF 431
                 R    S  I   ++ AT   G+   +   +  T +++++ +E L+  D     +
Sbjct: 162 --ALETRVVMRSGRILLSLYGATDAAGIPDKIADQMAETFSTNLDFREDLRRGDSFSVIY 219

Query: 432 SVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVP 491
           +VN+ N +     +LL           R   F +P     +Y+   G+S +   LR+P+ 
Sbjct: 220 TVNYRNGEPVSPGKLLAAEFVNAGKPYRAVLFQDPFG-REDYYTPEGESLKKGFLRSPLE 278

Query: 492 FGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIH 550
           F R+TS F     HP+ G+ R HTGVD+ AP GT + A GD  V  A   GGYG   ++ 
Sbjct: 279 FSRVTSSFSNSRKHPVYGFHRAHTGVDFGAPTGTRVKATGDATVVFAGRRGGYGNLVVLR 338

Query: 551 HGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTK 610
           H NG+ + Y H  A A  I+ G ++ QGQ+I ++G+TG STGPHLHYE+ + G   +   
Sbjct: 339 HPNGFETYYAHLSAFATGIRPGRSIAQGQLIAYVGSTGASTGPHLHYEVRIAGRPQNPMT 398

Query: 611 VRIPERENLKGDLLQRFAMEKKRINSLLNNGE 642
           V++P    L      RF  +    +  L+   
Sbjct: 399 VKLPGSPPLADAQRARFLQQTAAWSEKLHLLR 430


>gi|114799770|ref|YP_759362.1| M23 family peptidase [Hyphomonas neptunium ATCC 15444]
 gi|114739944|gb|ABI78069.1| peptidase, M23 family [Hyphomonas neptunium ATCC 15444]
          Length = 458

 Score =  326 bits (834), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 112/452 (24%), Positives = 188/452 (41%), Gaps = 16/452 (3%)

Query: 199 QLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEEN 258
                A     K  +      L            A      +     +  ++    +   
Sbjct: 4   DDLPIAPATPPKRNLSQGMKSLVVLGVLGSASAIAGLVMAGRPDAAMVQTAEAATPLPLA 63

Query: 259 RTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKAL--KNEVRVDQ 316
             + S   ++    +       ++ N T+   +   G   G++    +A+  K+ +   +
Sbjct: 64  ARLVSAVDVVGAPKQLVKAEGKLERNETLTGLVNRLGAPVGEANAALQAVYSKDLIDHRR 123

Query: 317 LTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDY 376
           L       +      +   +   +I       L +       +       K+  +++   
Sbjct: 124 LRPG----LEAETFVEDGRLTALAIKADADRSLLVTRTLEGGWQATQLNAKLKPSYKRVA 179

Query: 377 MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVN-H 435
                    I   I+ A    G     V       A  ++ Q  + P D  E FF     
Sbjct: 180 AE-------IDGSIYNAALKLGAGDQQVVDFASAFAYDIDFQREIHPGDRFEIFFETFVD 232

Query: 436 ANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRM 495
                  + E+LY        +  FYRF    DG  +YF+E G+S+  FL++TP+   R+
Sbjct: 233 ERGNPVRNGEVLYAALDGKALKRGFYRFTPSDDGVSDYFDEKGESATKFLMKTPINGARI 292

Query: 496 TSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGY 555
           +S FG R HPI GY+R+H G D+AAP GTP+ A G G V++A+W GGYG    I H  GY
Sbjct: 293 SSNFGTRRHPISGYTRLHKGTDFAAPTGTPVYAAGSGTVQRASWNGGYGNYIKIKHTRGY 352

Query: 556 VSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPE 615
            ++Y H    AK +K+G  V+QG++IG++G+TG STGPHLHYE+ V+G  +++  +++P 
Sbjct: 353 DTAYAHLSRYAKGVKSGRKVRQGEVIGYVGSTGASTGPHLHYEVYVDGKPLNAMSLKLPT 412

Query: 616 RENL--KGDLLQRFAMEKKRINSLLNNGENPK 645
              L     +L  F   K  I++L  +G    
Sbjct: 413 GRKLAEDPAMLAEFRQHKDAIDTLRTSGTAGP 444


>gi|254495997|ref|ZP_05108903.1| M24/M37 family peptidase [Legionella drancourtii LLAP12]
 gi|254354785|gb|EET13414.1| M24/M37 family peptidase [Legionella drancourtii LLAP12]
          Length = 513

 Score =  326 bits (834), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 80/388 (20%), Positives = 151/388 (38%), Gaps = 14/388 (3%)

Query: 259 RTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLT 318
             +         I +     +  +   ++       G +  +   +     +   +  + 
Sbjct: 126 VIVAKAIKTAKVIKDNEWQTVRPRSGDSMATIFHRLGLTAQNLHLVIYKNPHAKVLTSIK 185

Query: 319 KDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMR 378
             + L+  + +K     + +  I       LT+  +            K  ++ +    +
Sbjct: 186 PSQELQFLINKK----KLEKLVIPMNDIQTLTVYRD--------GAVYKTKVDSKKVTNQ 233

Query: 379 TSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANN 438
               +  +   ++      G+ S L++ +   L+  V+    ++  D     +   +  +
Sbjct: 234 DRYVTGIVNGSLYTTAQRLGIPSKLIRQMTTILSKQVDFARGVRSGDRFSIVYEAQYVKD 293

Query: 439 QASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSG 498
           +     +++ +         +  R ++      +Y+   G+S +    R P+ F  ++S 
Sbjct: 294 KMVGTGDIVAVSYTNRGKTAQAVRHISANGTH-DYYTPQGESFKKAFSRYPLKFSHISST 352

Query: 499 FGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVS 557
           F     HPIL Y R H G+D AAP GTPI A GDGI++      GYG    I H   Y +
Sbjct: 353 FTASRYHPILRYRRAHKGIDLAAPIGTPIQATGDGIIKTIGRHNGYGNMIEIKHDKTYST 412

Query: 558 SYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERE 617
            Y H     K I  G+ VK+GQ+IG++G TGL+TGPH HYEL V+    + T   +P   
Sbjct: 413 VYGHMLKFQKGISKGSRVKRGQVIGYVGQTGLATGPHCHYELHVHDQARNPTTTSLPTSS 472

Query: 618 NLKGDLLQRFAMEKKRINSLLNNGENPK 645
            +    +  F    + + S L   E   
Sbjct: 473 PVPAREMASFKARTRNLFSRLKLYEEAS 500


>gi|114778211|ref|ZP_01453083.1| Membrane protein [Mariprofundus ferrooxydans PV-1]
 gi|114551458|gb|EAU54013.1| Membrane protein [Mariprofundus ferrooxydans PV-1]
          Length = 441

 Score =  326 bits (834), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 99/382 (25%), Positives = 166/382 (43%), Gaps = 14/382 (3%)

Query: 265 QVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILR 324
              + K  +     I I         +   G+S  +S +I  A  +   +  +   ++  
Sbjct: 68  SPELSKANKVESKSIRIHRGDHAVSILQRLGFSLSESRQIVIAATDRYNLKDIRTGKVF- 126

Query: 325 IGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESP 384
               ++ D            +   L +         +G +    ++  +    R    + 
Sbjct: 127 ----KRVDSAESTDVYYNINEMAQLHLQR------QIGQQVWTCNMEARTLLTRQRVVTG 176

Query: 385 NIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDS 444
            I D ++ A    GM+      ++   A  ++    ++  D     +  +   +    D+
Sbjct: 177 KIVDSLFGAADEAGMDQRTTMNLVDIFAWDIDFARDMRRGDSFSVVYEEHFGEDGRILDT 236

Query: 445 ELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY- 503
            +L           R  R+    DG+  Y+  +GKS R   L+ PV F R++S F +   
Sbjct: 237 TILAAEFVNQGNHFRAVRYE-KSDGTSSYYTPDGKSMRKAYLKAPVKFSRISSRFQLSRK 295

Query: 504 HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGN-GYVSSYNHQ 562
           HPILGY+R H GVD+AA  GTPI AVGDG +    W  G+G+  LI H N  + ++Y H 
Sbjct: 296 HPILGYTRAHRGVDYAASSGTPIHAVGDGYISFIGWKHGFGRFILITHNNRNHSTAYAHM 355

Query: 563 DAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGD 622
            A A+ +K G  VKQGQ+IG++G +GL+TGPHLH+E  V G+ V+   V+ P    +   
Sbjct: 356 RAFARGLKRGDRVKQGQVIGYVGMSGLATGPHLHFEFRVRGVAVNPLTVKHPPARPIPAK 415

Query: 623 LLQRFAMEKKRINSLLNNGENP 644
              RF  +   +   LN  ++P
Sbjct: 416 ERDRFMQQTAPLLVELNKLQSP 437


>gi|253995572|ref|YP_003047636.1| peptidase M23 [Methylotenera mobilis JLW8]
 gi|253982251|gb|ACT47109.1| Peptidase M23 [Methylotenera mobilis JLW8]
          Length = 460

 Score =  325 bits (833), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 88/402 (21%), Positives = 165/402 (41%), Gaps = 17/402 (4%)

Query: 242 HDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDL---IPIQHNTTIFDAMVHAGYSN 298
               +T +    ++ E  ++ + +   +      +       ++ + T+   +      N
Sbjct: 59  APQTLTSNITTSMVVEEVSLPAVEQAQNDDANLTERFWYKDYVRRDDTLQSVLARVNIRN 118

Query: 299 GDSAKIAKALKNEVRV-DQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNN 357
            D+    +       +   +     ++       +   +  F         LTI    + 
Sbjct: 119 RDALDFIRTDSVASEIARSIIPGRQVKAETDADGN---LFHFEYQINADAFLTITKTTDG 175

Query: 358 EYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNL 417
                        + ++  +R   +S  I   ++ AT    +  N+   +     S +N 
Sbjct: 176 --------YSAKQDDRVLEVRPILKSAKITSSLFGATDAANIPDNIAIQLADIFESEINF 227

Query: 418 QEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNEN 477
              L+  D     +  ++   +     E+L           R   F +  +  ++Y+   
Sbjct: 228 HTDLRRGDHFNVIYEGSYDQGELVKVGEVLAAEFVNDGKVYRAVGFRDGNNQ-MQYYTPE 286

Query: 478 GKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEK 536
           GKS+    LR+P+ F R++SGF +   HP+L   R H GVD+AAP GT I A  D +V+ 
Sbjct: 287 GKSTHKSFLRSPLEFSRVSSGFSVARFHPVLQRMRAHKGVDFAAPTGTRIKASADAVVDF 346

Query: 537 ANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLH 596
               GGYG   ++ H NG  + Y H    A  ++ G  + QGQ+IG++G +G++TGPHLH
Sbjct: 347 VGQKGGYGNVIVLKHANGVSTLYGHLSRFAPELRRGAKITQGQMIGFVGMSGVATGPHLH 406

Query: 597 YELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLL 638
           YE ++NG   D  KV +P+   L+G    +F     ++ + L
Sbjct: 407 YEFLINGQHQDPMKVALPKANILQGSNKAKFESTSSQMTAQL 448


>gi|297568788|ref|YP_003690132.1| Peptidase M23 [Desulfurivibrio alkaliphilus AHT2]
 gi|296924703|gb|ADH85513.1| Peptidase M23 [Desulfurivibrio alkaliphilus AHT2]
          Length = 473

 Score =  325 bits (833), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 102/437 (23%), Positives = 174/437 (39%), Gaps = 12/437 (2%)

Query: 216 QFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFA 275
              +L        +L         +        + ++  I E + +  P         + 
Sbjct: 35  AGAVLFFANITPASLPTPPELPELEESVAKQLATAELAEIVETQALNRP-SEPLWPESYT 93

Query: 276 DDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFT 335
                ++   T+ DA+  A  +  D ++I  AL   +    L   +     +    D   
Sbjct: 94  HIEGELRSGDTLNDALRRAQINGSDRSRIINALDGLLDFRSLRPRDRFTAVLD---DDNA 150

Query: 336 IVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATS 395
           +V +       ++  +   D++ +      V ++   +         S  I   ++ A  
Sbjct: 151 VVEYRYQSGPLNVYLVRRIDDHRFQAEKMSVTLERQTKKI-------SGRIESSLFAAFQ 203

Query: 396 FNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGE 455
            +G  + L+       AS ++    ++  D  +  F   + +++      +LY       
Sbjct: 204 IHGEQARLIYSFAEIFASRMDFNVEIRKGDHFQLVFEKYYRDDEFVGYGPILYARYEQSR 263

Query: 456 TRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHT 514
                     P DG   YF+ +G+      LR+PVP  R+TSGF  R  HPIL   R H 
Sbjct: 264 GEVLEAIRYTPEDGKASYFDPDGRELGASFLRSPVPMARVTSGFNRRRMHPILNEVRPHL 323

Query: 515 GVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTA 574
            VD AAP GTP++A  DG V   +  GG G   ++ H NGY S Y H     + +K G  
Sbjct: 324 AVDLAAPTGTPVMATADGRVVFRSRDGGNGNMVILEHSNGYRSYYAHLSGFKRGMKVGDR 383

Query: 575 VKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRI 634
           V+Q  IIG++G TGL+TGPH+ Y +  NG  ++   +R   R  L G+ L RF      +
Sbjct: 384 VRQRDIIGYVGATGLATGPHVCYRIRHNGEFINPMAMRFTPRSELAGEALARFQAHLGDL 443

Query: 635 NSLLNNGENPKKPLFTS 651
             L +N    ++ +  S
Sbjct: 444 VQLADNLGKKEQAVRVS 460


>gi|323492028|ref|ZP_08097193.1| membrane protein [Vibrio brasiliensis LMG 20546]
 gi|323313757|gb|EGA66856.1| membrane protein [Vibrio brasiliensis LMG 20546]
          Length = 428

 Score =  325 bits (832), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 91/378 (24%), Positives = 159/378 (42%), Gaps = 20/378 (5%)

Query: 263 SPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVR-VDQLTKDE 321
           + Q  +  +     +   I    ++      AG S+    ++    K+  R + ++   +
Sbjct: 58  ALQESVPPMAVLRWEKHTIGSGDSMALLFQRAGLSSRLLYQLTSTNKDIERQLTRVKPGD 117

Query: 322 ILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSE 381
              +G    +    I R            +  +D              I+ +  + + + 
Sbjct: 118 AFELGFDADNQLIQIKRKI---NAYETFLVTKSDKG--------YSSSIDKKEVHYQYNY 166

Query: 382 ESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQAS 441
              +I    W A    G+ +N +  +       ++    ++  D     +       +  
Sbjct: 167 AEADITSNFWNAGMNAGLTANQIMELAGIFGWDIDFALDIRSGDNFRILYQEKVVEGEVV 226

Query: 442 DDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGM 501
               ++           +        D +  Y++ENG++ +   LR+P+ F R+TS F  
Sbjct: 227 GRGRIIAAIFTNQGDTFKAIL----DDKTGNYYDENGRAMKKAFLRSPLDFRRVTSNFNP 282

Query: 502 -RYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYN 560
            R HP+ G  R H G D+AAP GTPI A GDGIV+K+++    G    I H N Y++ Y 
Sbjct: 283 TRRHPVTGKVRAHRGTDYAAPVGTPIWAAGDGIVQKSSYNQFNGNYVFIKHSNTYITKYL 342

Query: 561 HQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLK 620
           H     + +K G  VKQGQ IG +G TG  TGPHLHYE +VNG+  ++  V++P+ ++L 
Sbjct: 343 HLTK--RTVKTGQRVKQGQTIGTLGGTGRVTGPHLHYEFLVNGVHKNARTVKLPQSKSLT 400

Query: 621 GDLLQRFAME-KKRINSL 637
           G     F    K R++ L
Sbjct: 401 GKAKTTFIANAKIRLDKL 418


>gi|297537300|ref|YP_003673069.1| peptidase M23 [Methylotenera sp. 301]
 gi|297256647|gb|ADI28492.1| Peptidase M23 [Methylotenera sp. 301]
          Length = 464

 Score =  325 bits (832), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 83/412 (20%), Positives = 155/412 (37%), Gaps = 15/412 (3%)

Query: 237 TLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFA-DDLIPIQHNTTIFDAMVHAG 295
                    +T +     + E   + S       + E        ++ + T+ + +    
Sbjct: 60  AAFGIAPQTLTGTIATATVVEEIALPSAANTQTNVAEQHFWYKDHVRRDDTLNNVLSRLN 119

Query: 296 YSNGDSAKIAKALKNEVRVDQ-LTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALN 354
             N D+    ++      +   L     +        +   ++           + I   
Sbjct: 120 VHNRDAINFIRSDAVASEITSALKPSHNMEAQTDGDGN---LISLEYQLDTDQFINIEQI 176

Query: 355 DNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASS 414
            +                    +R   +S  I   ++ AT    +  ++   +     S 
Sbjct: 177 PSG--------YTASKVTHKLEIRPILKSAKIKSSLFGATDDANIPDDVAIQVAEMFESQ 228

Query: 415 VNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYF 474
           ++    L+  D     +  ++   +     ++L           +   + +     ++Y+
Sbjct: 229 IDFNTDLRRGDHFNVIYEGSYDEGELVKTGDVLAAEFVNNGKTYQAIGYRDATG-EMQYY 287

Query: 475 NENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGI 533
             +GKS     LR+P+ F R++S F     HPIL   + H GVD AAP GT + A GD +
Sbjct: 288 TPDGKSLHKSFLRSPLEFTRVSSSFSTGRFHPILQRIKAHQGVDLAAPTGTRVKASGDAV 347

Query: 534 VEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGP 593
           V+     GGYG   ++ H NG  + Y H    A  +  G  V QG++IG++G TGL+TGP
Sbjct: 348 VDFVGQKGGYGNVIVLKHENGVSTVYGHLSRFADGLHRGEKVAQGEVIGFVGMTGLATGP 407

Query: 594 HLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPK 645
           HLHYE +VNG   D   V +P+ + + G     F    + + + ++   N  
Sbjct: 408 HLHYEFMVNGEHRDPMTVALPKADPITGQNKVAFDAISRELTAQIDLLGNSN 459


>gi|330828245|ref|YP_004391197.1| metalloprotease, opacity-associated protein A family [Aeromonas
           veronii B565]
 gi|328803381|gb|AEB48580.1| Metalloprotease, opacity-associated protein A family [Aeromonas
           veronii B565]
          Length = 420

 Score =  324 bits (831), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 90/430 (20%), Positives = 155/430 (36%), Gaps = 23/430 (5%)

Query: 216 QFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIE--ENRTITSPQVLIDKIPE 273
               L                 +D         +     I   E    ++P   I     
Sbjct: 10  SAVALLPAPGDILERPLRLELPIDTAGTATNENNTDFNEIPDHELVDQSAPDDDIPVDTT 69

Query: 274 FADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDK 333
                  +++   +     + G S     K+  A      + +L   + + + + Q +  
Sbjct: 70  PQWQDYRVRNGENLTAIFNNLGLSTTTLYKVLDADNKNY-LARLKPGQNIELLIDQDNIL 128

Query: 334 FTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRA 393
             +    I    K  L +A +D+             + ++    +    +  I    + +
Sbjct: 129 QQLK---IRLNIKQTLVMARSDD--------AYTASMINEKVEWQPQRYNGVINGSFYVS 177

Query: 394 TSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARF 453
               G+ +N ++ I       +N  + L+  D  +          +++ +S+LL +    
Sbjct: 178 ARNAGIPANHIQKIANLFQWRMNFAKDLQKGDKFKVLVRQETVEGKSTGNSQLLGVEVTS 237

Query: 454 GETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPF-GRMTSGFGMRY-HPILGYSR 511
                  +   +       Y++  G S      R P     R++S F     HP+ G  R
Sbjct: 238 QGKTVSAWLSDDGN-----YYDGQGNSLERGFRRYPTHSRYRISSNFNPARKHPVTGMVR 292

Query: 512 MHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKA 571
            H G D+A P GTP++A GDGIV+KA      G   +I HG    + Y H   +   +K 
Sbjct: 293 PHEGTDFAVPVGTPVLATGDGIVQKATSHPLAGTYIVIKHGRTLSTRYLHLSKLL--VKT 350

Query: 572 GTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEK 631
           G  VK G  IG  G TG STG HLHYEL +N   V++   ++P  E L G   ++F  + 
Sbjct: 351 GQRVKMGDKIGLSGNTGRSTGAHLHYELRINNRPVNAMTAKLPMAEPLSGKERRQFLAKV 410

Query: 632 KRINSLLNNG 641
           K     L  G
Sbjct: 411 KSYRKELAAG 420


>gi|28056127|gb|AAO28030.1| metallopeptidase [Xylella fastidiosa Temecula1]
          Length = 417

 Score =  324 bits (831), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 99/385 (25%), Positives = 168/385 (43%), Gaps = 15/385 (3%)

Query: 260 TITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTK 319
           T+  P             ++ I+   T+         S+ D  ++         + +L+ 
Sbjct: 27  TLALPLPPQYTSTADTWRMVTIKPGQTLSSIFNELKLSSNDMERVLNYADLRKVLTRLSP 86

Query: 320 DEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRT 379
            + +   +        +        +KH + + ++DN         +   ++ +    RT
Sbjct: 87  GDEISFDIPNDG---QLRGMRFNRDEKHRVELTIDDN--------TIHQQVSQRQTSTRT 135

Query: 380 SEESPNIYDGIWRATSFNGMNS-NLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANN 438
              S  I   +W A    G++  +++ L        ++  + L+  D             
Sbjct: 136 VIASGEIKSSLWIAAREAGLSPVDVITLTDEIFKYDIDFDKDLQTGDRFSVVMDETWREG 195

Query: 439 QASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSG 498
           +   D+++L      G       RF+      VEYF++ G+  +   +R P+ + R++S 
Sbjct: 196 ERLPDAKILAATFNTGGKIYSGIRFMRDG--KVEYFDKEGRPLKKSFIRMPISYARLSST 253

Query: 499 FGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSS 558
           FG+R HPILG  RMH GVD+AA  GTPI+A GD  V+      GYG   +++HG GY + 
Sbjct: 254 FGLRRHPILGTMRMHKGVDYAAATGTPIMAAGDARVQFIGQQRGYGNVVILNHGKGYRTL 313

Query: 559 YNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPEREN 618
           Y H     K IKAG  + QG +IG++G TGL+TGPHLHYE  VNG   +   + +P  E 
Sbjct: 314 YGHMSRFGK-IKAGQKINQGTVIGYVGMTGLATGPHLHYEFQVNGQHRNPLSITMPPPEP 372

Query: 619 LKGDLLQRFAMEKKRINSLLNNGEN 643
           L+G  L  F  +   + + +   E 
Sbjct: 373 LRGKDLIAFRTQTAPLIAQIQQYEK 397


>gi|15602108|ref|NP_245180.1| hypothetical protein PM0243 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12720470|gb|AAK02327.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 531

 Score =  324 bits (831), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 96/489 (19%), Positives = 179/489 (36%), Gaps = 31/489 (6%)

Query: 160 FSEGKIESSSQMLMDTIHNVDSFEVTTQKINFP---TDITRIQLDHTAQDEEIKNAIMNQ 216
            S   +ES S +  D+  +    E + +K       T+ + + +D    D ++  +    
Sbjct: 62  LSTATVESPSSVQADSTLSPPPSEESVEKQAITEHHTESSAVSMDEKNSDTQVDASSQET 121

Query: 217 FFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENR--TITSPQVLIDKIPEF 274
                     + + Y       D+  +       ++    E     ++    ++D+    
Sbjct: 122 TAKPAENTLDATSFYDDLEAKDDEVDEIKPDMLDELAAFPEPVRHALSDLFDVMDQAMRI 181

Query: 275 ADDL-IPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDK 333
            +     +    ++ D +  +G     S ++ KA         L   +     +  + + 
Sbjct: 182 KNQFSHTVVKGDSLKDVLELSGLDASVSERLIKAYPEFKN---LKPGQQFYWILDNQGEL 238

Query: 334 FTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRA 393
             +       ++K         + +Y       + +I  +    +       I      A
Sbjct: 239 EYLNWLVSEREEKIY---EKTADGQY-------QREILKKQSVWKKEVLKGRIDGSFNTA 288

Query: 394 TSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARF 453
               G++   +  +   L   +NL+  LK  D      +  +   + +    +  IH   
Sbjct: 289 LRTLGLDIRQINQLANALQWQINLKR-LKKGDKFAVLVTREYIEGKLTGQGNVDGIHIIS 347

Query: 454 GETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLR-TPVPFGRMTSGFGMRY-HPILGYSR 511
                           +  Y+N  G++      R       R++S F     HP+ G   
Sbjct: 348 AGKSYYAI-----QASNGRYYNRQGETLGKGFARYPLQRQARVSSHFNPYRRHPVTGRIA 402

Query: 512 MHTGVDWAAPRGTPIVAVGDGIVEKANWA-GGYGKQTLIHHGNGYVSSYNHQDAIAKNIK 570
            H GVD+A P GTP++A  DGIVEK  +   G G+  ++ HG  Y + Y H       +K
Sbjct: 403 PHKGVDFAMPVGTPVIAPADGIVEKVAYQANGAGRYIVVRHGREYQTVYMHLSRAL--VK 460

Query: 571 AGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPEREN-LKGDLLQRFAM 629
           AG  VK+GQ I   G TG STGPHLHYE  +NG  V+   V++P   + +     ++F +
Sbjct: 461 AGQNVKRGQRIALSGNTGRSTGPHLHYEFHINGRAVNPLTVKLPGTSSGMGTAERKQFLV 520

Query: 630 EKKRINSLL 638
           + K I   L
Sbjct: 521 KAKEIERQL 529


>gi|332519242|ref|ZP_08395709.1| Peptidase M23 [Lacinutrix algicola 5H-3-7-4]
 gi|332045090|gb|EGI81283.1| Peptidase M23 [Lacinutrix algicola 5H-3-7-4]
          Length = 442

 Score =  324 bits (831), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 93/399 (23%), Positives = 164/399 (41%), Gaps = 20/399 (5%)

Query: 257 ENRTITSPQVLIDKI---PEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVR 313
           E  ++  P+ L +      +F      I+   T    +     S     +IA+A K+   
Sbjct: 37  EVVSVIEPEELYEFGFNLKDFVVKRDTIKRGDTFGVILERNNISYPKIFEIAEASKDSFD 96

Query: 314 VDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQ 373
           V +L   +   I     D   T   F     ++    +   D+ +     +P+K      
Sbjct: 97  VRKLQVGKPYTILCA-NDSLQTPKCFIYQPTKERYAVVDFQDSIKAYTSTKPIKY----- 150

Query: 374 MDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSV 433
                    S  I   I  A    G    L   +    A +++    L+  D  +  ++ 
Sbjct: 151 ----VEKTVSGVINSNISNALDEQGKPFMLALRMSDIYAWTIDFSR-LQKNDKFKVVYTE 205

Query: 434 NHANNQA-SDDSELLYIHARFGETR-TRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVP 491
            + ++   +   E+   +    +     F    + V G  +YF+E  K+ R   L++PV 
Sbjct: 206 KYIDDSIYAGIHEIKAAYFEHNKEPFYAFEFETDTVLGIRDYFSEEAKNLRRAFLKSPVS 265

Query: 492 FGRMTSGFGMRYHPIL--GYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLI 549
           F R++S + ++    L     R H G D+AA  GTPI++  +G V ++   GG G    +
Sbjct: 266 FSRISSRYNLKRRIALYGNRVRPHKGTDFAAKVGTPIMSTANGTVIESARRGGNGNYVKV 325

Query: 550 HHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDST 609
            H   Y + Y H     +  K G  VKQG++IG++G TG ++GPH+ Y    NG +VD  
Sbjct: 326 KHNATYTTQYLHMSK--RKAKVGDFVKQGEVIGYVGMTGNTSGPHVCYRFWKNGKQVDPF 383

Query: 610 KVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPL 648
           K ++PE + +   L   F    K +   L+N + P +P+
Sbjct: 384 KQKLPEAKPISDSLKTEFLEYIKPLKLQLDNIDYPIEPV 422


>gi|27365043|ref|NP_760571.1| membrane protein [Vibrio vulnificus CMCP6]
 gi|27361189|gb|AAO10098.1| membrane protein [Vibrio vulnificus CMCP6]
          Length = 430

 Score =  324 bits (830), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 89/380 (23%), Positives = 156/380 (41%), Gaps = 20/380 (5%)

Query: 261 ITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEV-RVDQLTK 319
           ++   VL  +      +   ++   +        G S     ++         ++ +L  
Sbjct: 58  LSINPVLSTESSVHRWERYRVKDGESAAILFQRIGLSASLLHQLITTNDEIKTQLSRLKP 117

Query: 320 DEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRT 379
            ++L+ G   +D    + R            I  +D              +N++    + 
Sbjct: 118 GDMLQFGFDAQDQLVKLKR---QLNAFETFEITRSDTG--------YNSQLNNKEVNYQY 166

Query: 380 SEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQ 439
           +    +I    W A    G+ +N +  +       ++  + ++  D     +       +
Sbjct: 167 AYAEASITSNFWNAAISAGLTANQIMELAGIFGWDIDFAQDIRERDSFRVLYQEQVVEGE 226

Query: 440 ASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGF 499
                 ++    R               D +  Y++ENG++ +   LR P+ F R++S F
Sbjct: 227 VIGRGRIIAAIFRNQGDTFTAIY----DDKTGNYYDENGRAMKKAFLRAPIDFRRVSSNF 282

Query: 500 GMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSS 558
             R  HP+ G  + H G D+ AP GTPI A GDG+V++A +    G    I H N Y++ 
Sbjct: 283 NPRRLHPVTGQVKAHRGTDYVAPVGTPIWAAGDGVVQQAGYNQFNGNYVFIRHSNTYLTK 342

Query: 559 YNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPEREN 618
           Y H     K +K G  VKQGQ IG +G TG  TGPHLHYE +VNG+  +   V +P+ ++
Sbjct: 343 YLHLQK--KLVKTGQRVKQGQSIGTLGGTGRVTGPHLHYEFLVNGVHKNPRTVSLPQAQS 400

Query: 619 LKGDLLQRFAMEKK-RINSL 637
           L G   + F    K R++ L
Sbjct: 401 LSGQAKETFIANSKLRLDKL 420


>gi|330898957|gb|EGH30376.1| peptidase M23B [Pseudomonas syringae pv. japonica str. M301072PT]
          Length = 428

 Score =  324 bits (830), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 96/415 (23%), Positives = 156/415 (37%), Gaps = 21/415 (5%)

Query: 191 FPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSK 250
           FP+     +  +   D E      +Q     + +  +            Q  +       
Sbjct: 34  FPSSEVEAKRTNIPLDLEA----PDQDIQDQDAQQATQATPETTESPFAQIDNADDQAQD 89

Query: 251 KIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKN 310
                 +                     + +    T+       G       +I  + K 
Sbjct: 90  TASAQPQAEKPAPAAAKDPAH-----REVTVSKGDTLSTLFEKVGLPAATVHEILASDKQ 144

Query: 311 EVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDI 370
             +  +L   + L+  +        +        +   ++++      Y         + 
Sbjct: 145 AKQFSKLQNGQTLQFELTPDGQLKQLHT---KLSEVESISLSKTATGGY-------AFNR 194

Query: 371 NHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETF 430
                 +R +     I   + ++    G+  ++   +       ++  + ++  D  +  
Sbjct: 195 EISKPNVRNAYVHGVINSSLSQSAQRAGLTHSMTMDMANIFGYDIDFAQDIRKGDEFDVV 254

Query: 431 FSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPV 490
           +     N ++     +L              R+ N    +  Y+  +G S R   +RTPV
Sbjct: 255 YEQKVVNGKSVGTGNILSARFTNRGKTYTAVRYTNKQG-NTNYYTADGNSMRKAFIRTPV 313

Query: 491 PFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLI 549
            F R++S F M   HPIL   R H GVD+AAPRGTPI A GDG V  A   GGYG   +I
Sbjct: 314 DFARISSMFSMGRKHPILNKIRAHKGVDYAAPRGTPIKATGDGKVLLAGRRGGYGNTVII 373

Query: 550 HHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGI 604
            HG+ Y + Y H    AK I+ G  VKQGQ+IG+IGTTGLSTGPHLHYE  VNG+
Sbjct: 374 QHGDTYRTLYGHMQGFAKGIQTGGTVKQGQVIGYIGTTGLSTGPHLHYEFQVNGV 428


>gi|157962453|ref|YP_001502487.1| peptidase M23B [Shewanella pealeana ATCC 700345]
 gi|157847453|gb|ABV87952.1| peptidase M23B [Shewanella pealeana ATCC 700345]
          Length = 418

 Score =  324 bits (830), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 94/430 (21%), Positives = 164/430 (38%), Gaps = 23/430 (5%)

Query: 211 NAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDK 270
             I +    +              P   +              I+ +  ++ S ++L  K
Sbjct: 7   AGIPSFHRKVLLGSVLIIGAAVLMPSRHELLPQRIPVQLDIDSILSQTVSVPSTELLEPK 66

Query: 271 IPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQK 330
                +    I    T+       G       ++ +A  N + +D L     ++  +   
Sbjct: 67  PAFQKE----IVKGDTLSGLFEQGGVDQQTMYRVLEADLNVLALDTLRPGNKIQFWL--- 119

Query: 331 DDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGI 390
           +D   + + ++Y      +     D+  +        +D  +     R    S  I+   
Sbjct: 120 NDAGELQKLTLYFNAARQVIFTRFDDGSF-------NVDEINIDGIWRDRAISGQIHGSF 172

Query: 391 WRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIH 450
           + +    G+N+  ++ +   L   +N    L+  D      +    + +A+ +S +L + 
Sbjct: 173 YVSAKKMGLNAAEIQRVESLLKEKLNFARDLRAGDKFSVLMNDQFIDGEATGNSHVLGVT 232

Query: 451 ARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTP-VPFGRMTSGFGMRYH-PILG 508
              G +    Y+  +       +++E G+S      R P +   R++S F    H P+ G
Sbjct: 233 IDRGSSSINAYQHSDGN-----FYDEKGQSLARAFQRIPLMKNYRISSRFNPNRHHPVTG 287

Query: 509 YSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKN 568
            +  H G D+A P GT IVA GDGIV         GK  +I HGN Y + Y H       
Sbjct: 288 RNSPHNGTDFAIPIGTKIVAPGDGIVSLVTNHRFAGKYVVIEHGNKYRTRYLHLSKFL-- 345

Query: 569 IKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFA 628
           +  G  V +GQ+IG  G TG  TGPHLHYE  +NG  VDS K +IP    L    +  F+
Sbjct: 346 VHKGQRVSRGQVIGLSGNTGRVTGPHLHYEFHINGRPVDSMKAKIPMASKLSSKEMAEFS 405

Query: 629 MEKKRINSLL 638
              K    ++
Sbjct: 406 QIVKVRKMMM 415


>gi|260774215|ref|ZP_05883130.1| cell wall endopeptidase family M23/M37 [Vibrio metschnikovii CIP
           69.14]
 gi|260611176|gb|EEX36380.1| cell wall endopeptidase family M23/M37 [Vibrio metschnikovii CIP
           69.14]
          Length = 437

 Score =  324 bits (830), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 98/430 (22%), Positives = 155/430 (36%), Gaps = 19/430 (4%)

Query: 217 FFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIP-EFA 275
             L   KK     L       +    +      K    + E+  + +      +    + 
Sbjct: 11  SALSKRKKVSVIGLPLLALAAISSSINSTTYSKKVALSVPESHIVETIIADASEAKVAYP 70

Query: 276 DDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFT 335
           D    I+    +       G+   D  KI +   N + +D L    ILR    +      
Sbjct: 71  DYEYQIKSGDNLSTIFNQLGFRYQDLMKIMETDLNYLALDTLRPGNILRFW--KSPGSQD 128

Query: 336 IVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATS 395
           + +  +             D+  Y                  R       I     ++ +
Sbjct: 129 LAKMELEFNVVKRAVYTRLDDGNY-------DFSELEIPGQWREFAMIGEIQGSFSQSAN 181

Query: 396 FNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGE 455
             G+ S  +  I+  L   VN    L+  D  E   S      + + + E+  I      
Sbjct: 182 QVGLGSADIDQIVSLLKDKVNFGRDLRAGDRFEVVLSRQFVGEKLTGNREIQAIKLYNRG 241

Query: 456 TRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGR-MTSGFGMRY-HPILGYSRMH 513
                Y + +       Y++ +G+S +    R P      M+SGF     HP+ G    H
Sbjct: 242 NEITAYLYKDGQ-----YYDRDGQSLQRAFQRYPTTGQWRMSSGFDPNRRHPVTGRIAPH 296

Query: 514 TGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGT 573
            G D+AAP GTP+VA GDG+V         G    I HG+ Y++ Y H   I   ++ G 
Sbjct: 297 NGTDFAAPTGTPVVATGDGVVVMTRNHPYAGNYITIQHGSTYMTRYLHLSKIL--VQKGQ 354

Query: 574 AVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKR 633
            V +GQ IG  G TG  TGPH+HYELIV G  VD  K  IP   ++    +  F   +  
Sbjct: 355 KVTRGQRIGLSGATGRVTGPHIHYELIVRGRPVDPMKANIPMATSVPKQDMANFIARRNE 414

Query: 634 INSLLNNGEN 643
           ++ LL   ++
Sbjct: 415 LDRLLAQQDS 424


>gi|163754363|ref|ZP_02161485.1| peptidase, M23/M37 family protein [Kordia algicida OT-1]
 gi|161325304|gb|EDP96631.1| peptidase, M23/M37 family protein [Kordia algicida OT-1]
          Length = 431

 Score =  324 bits (829), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 81/393 (20%), Positives = 157/393 (39%), Gaps = 18/393 (4%)

Query: 253 KIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEV 312
           +I E       P      + +F      ++   +  + +           +IA+  K+  
Sbjct: 28  EIAEIEAPAPDPMEFGFHLNDFVVVKDTVRSGDSFGEILQKNNIGYSKIFQIAEKTKDTF 87

Query: 313 RVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINH 372
            + +L   +   +   + D       F         + I   D+         +      
Sbjct: 88  DIRKLVAGKPYTLLCTKDDSLQRPECFIYQPNSIDYVVIKFKDS---------INAYTES 138

Query: 373 QMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFS 432
           +   +   E S  I   +  A    G++  L   +    A +++    L+  D  +  ++
Sbjct: 139 KPVKIVQKEASGIITSSLSGALDDAGLSQRLAYDMSDIYAWTIDFFR-LQKGDEFKLIYT 197

Query: 433 VNHANNQ-ASDDSELLYIHARFGETRTRFYRFLNPV-DGSVEYFNENGKSSRPFLLRTPV 490
             + N+       ++   + +  +     + F        V+Y++EN K+ R   L+ PV
Sbjct: 198 EKYINDTTFVGIDKIHAAYFKHNKEPFYAFEFETDSIKQIVDYYDENAKNLRRAFLKAPV 257

Query: 491 PFGR--MTSGFGMRYHPIL--GYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQ 546
            +    ++S + +R    L     R H G D+AAP GTPI++  +G+V ++   GG G  
Sbjct: 258 RYKHVRISSRYNLRRRIKLYGNRIRPHKGTDFAAPIGTPIISTANGVVVESARRGGNGNY 317

Query: 547 TLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKV 606
             + H + Y + Y H     + +K G  VKQG IIGW+G TG ++GPH+ Y    NG +V
Sbjct: 318 VKVKHNSTYTTQYLHMKK--RKVKVGEYVKQGDIIGWVGMTGNTSGPHVCYRFWKNGRQV 375

Query: 607 DSTKVRIPERENLKGDLLQRFAMEKKRINSLLN 639
           D  K ++P+ + +   L + +    K +   L+
Sbjct: 376 DPFKQKLPDADPIDAKLKEAYLEFIKPLKIQLD 408


>gi|117618377|ref|YP_858172.1| metalloprotease opacity-associated protein A family [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
 gi|117559784|gb|ABK36732.1| metalloprotease, opacity-associated protein A family [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
          Length = 445

 Score =  324 bits (829), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 86/424 (20%), Positives = 151/424 (35%), Gaps = 23/424 (5%)

Query: 222 NKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIE--ENRTITSPQVLIDKIPEFADDLI 279
                           +          +     I   E     +P+  I           
Sbjct: 41  PAPGDILERPLRLELPIATNGTATNEDNTDFNDIPDHELVEAATPEDDIPTDATPQWQDY 100

Query: 280 PIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRF 339
            +++   +     + G S     K+  A      + +L   + + + + Q +    +   
Sbjct: 101 RVRNGENLTTIFNNLGLSTTTLYKVLDADTKN-NLARLKPGQTIELLIDQDNILQQMK-- 157

Query: 340 SIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGM 399
            I    K  L +   D+            ++ ++    +       I    + +    G+
Sbjct: 158 -IRLNIKQTLILERTDD--------TYSANMLNEEVEWQKKGYDGVINGSFYVSARNAGI 208

Query: 400 NSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTR 459
            +N ++ I       +N  + LK  D  +          +++ +++LL +          
Sbjct: 209 PANHIQKIANLFQWRLNFAKDLKKGDKFKVLVRQETVEGKSTGNTQLLGVEVFSQGQSVS 268

Query: 460 FYRFLNPVDGSVEYFNENGKSSRPFLLRTPVP--FGRMTSGFGMRYHPILGYSRMHTGVD 517
            +   +       Y++  G S      R P    +   +S    R HPI G  R H G D
Sbjct: 269 AWLSEDGN-----YYDGQGNSLERGFRRYPTHSRYRVSSSFNPNRRHPITGQVRPHEGTD 323

Query: 518 WAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQ 577
           +A P GTP++A GDG+V KA      G   +I HG   ++ Y H   +   +K G  VK 
Sbjct: 324 FALPVGTPVMATGDGVVLKATNHPLAGTYVVIKHGRTLMTRYLHLSKLL--VKPGQKVKM 381

Query: 578 GQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSL 637
           G  I   G TG STG HLHYE+ +N   VD+ KV++P  E L G   ++F  + K     
Sbjct: 382 GDKIALSGNTGRSTGAHLHYEVRINNRPVDAMKVKLPMAEPLSGKEKRQFLAKVKSYRKE 441

Query: 638 LNNG 641
           +  G
Sbjct: 442 MEAG 445


>gi|323496788|ref|ZP_08101833.1| peptidase [Vibrio sinaloensis DSM 21326]
 gi|323318213|gb|EGA71179.1| peptidase [Vibrio sinaloensis DSM 21326]
          Length = 435

 Score =  324 bits (829), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 86/419 (20%), Positives = 152/419 (36%), Gaps = 18/419 (4%)

Query: 226 QSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNT 285
              +L       L   +            I E + +++      +   + +    I+   
Sbjct: 20  TLLSLPILAAVALSSVNSSTSLTRTIELSIPETKIVSNILQSEQEEINYPNYEYVIKRGD 79

Query: 286 TIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQ 345
            +       G+   +   +     N + +D L     LR    +       +       +
Sbjct: 80  NLSSIFEQLGFGYSELMSVMSTDLNYLALDSLKPGNTLRFWRNETTGDLQKMELEFSLVE 139

Query: 346 KHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVK 405
           +     +  D+  Y         +         +     ++     ++    G+++N + 
Sbjct: 140 R--AVYSRLDDGSY-------SFEDVKLPGEWSSFALVGDVRGSFSKSVHALGLSTNEIN 190

Query: 406 LIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLN 465
            I+R L   +N    L+  D  E   S  H +   + + EL  I           Y   +
Sbjct: 191 QIVRLLKDKINFSRDLRAGDKFEVVQSRQHVDGVLTGNRELQAIRIVNRGREITAYLHTD 250

Query: 466 PVDGSVEYFNENGKSSRPFLLRTPVPF-GRMTSGFGMRY-HPILGYSRMHTGVDWAAPRG 523
                  Y++ +G S +    R PV    R++S F     HP+ G    H G DWA P G
Sbjct: 251 GQ-----YYDHDGNSLQRAFQRKPVNGKYRLSSHFNPNRKHPVTGRVSPHNGTDWAVPTG 305

Query: 524 TPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGW 583
           TPIV+ GDG+V         G   ++ H + Y + Y H   I   ++ G  V +GQ IG 
Sbjct: 306 TPIVSTGDGVVIMTRKHPYAGNYVVVQHSSRYKTRYLHLSKIL--VRKGQKVSRGQRIGL 363

Query: 584 IGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGE 642
            G TG  TGPH+HYEL+  G  V++ K  IP   ++    +  F   +   +++L   E
Sbjct: 364 SGATGRVTGPHIHYELLDRGRAVNAMKANIPMANSVPKKEMAAFKQRRDEFDAMLKKQE 422


>gi|209965903|ref|YP_002298818.1| M23 peptidase domain protein [Rhodospirillum centenum SW]
 gi|209959369|gb|ACJ00006.1| M23 peptidase domain protein [Rhodospirillum centenum SW]
          Length = 480

 Score =  324 bits (829), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 95/365 (26%), Positives = 162/365 (44%), Gaps = 11/365 (3%)

Query: 273 EFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDD 332
                LI ++   T+   ++        + ++  AL++     +L   + +     + + 
Sbjct: 84  PIERRLISLRPGDTLMQILLRQEVPKEHAHELVSALRSVYNPQRLKSGQEIAFLFDRSEG 143

Query: 333 KFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWR 392
               V        +  ++++  D   +             +    R       I   + +
Sbjct: 144 DGRFVGIEFQPAVERSVSVSF-DGVRFQAAE-------VAKPLQHRLFAVRGTIDSSLAQ 195

Query: 393 ATSFNGMNSNLVKLIM-RTLASSVNLQEHLKPTDFLETFFSV-NHANNQASDDSELLYIH 450
           A S  G+   +  +++ +     V+ Q  ++P D  E  + +      + +   ++ Y  
Sbjct: 196 AASEAGVPIAVQSILINKMFNYDVDWQRDIQPGDRFEVLYELLTTETGEIARVGKVSYAA 255

Query: 451 ARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYS 510
                 R   + F +      +YF   G+S R  LLRTPV   ++TSGFGMR HP+LGYS
Sbjct: 256 LTLSGKRRELFLFEDADG-RPDYFTRKGESVRKALLRTPVDGAKLTSGFGMRMHPLLGYS 314

Query: 511 RMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIK 570
           +MH GVD+ AP GTPI A GDG++E+    G YG    I H     ++Y H        +
Sbjct: 315 KMHKGVDFGAPTGTPIYAAGDGVIEEIGAKGAYGNYIRIRHNREIATAYAHLSRFGSGAR 374

Query: 571 AGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAME 630
            G+ V QG++IG++GTTG STGPHLHYE++  G +V+   V +P    L G  L++F   
Sbjct: 375 RGSRVSQGEVIGYVGTTGRSTGPHLHYEVMRGGKQVNPLSVDLPTGRILAGKELKKFLAV 434

Query: 631 KKRIN 635
              + 
Sbjct: 435 AAELE 439


>gi|311748784|ref|ZP_07722569.1| M23 peptidase domain protein [Algoriphagus sp. PR1]
 gi|126577321|gb|EAZ81569.1| M23 peptidase domain protein [Algoriphagus sp. PR1]
          Length = 456

 Score =  324 bits (829), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 91/374 (24%), Positives = 152/374 (40%), Gaps = 15/374 (4%)

Query: 280 PIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRF 339
            +  N T+   +           +IAK  K    V  +  ++   +         TI +F
Sbjct: 80  TVSKNQTLATILAPFNVPYQIIDEIAKKSKEVFDVRGIATNKKFTVLTPADS---TIAQF 136

Query: 340 SIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGM 399
            IY        +   D+ +     +P++         +R        +  +    +   +
Sbjct: 137 FIYEPNPVEYVVFNLDSKDIYKAEKPIEFVKREVAGVIRK-------HSNLSDEMTNQQV 189

Query: 400 NSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTR 459
           + ++V         SV+    L+  D  +  F             ++   +      +  
Sbjct: 190 SYDIVDQFADLYGWSVDFGA-LQEGDKFKVVFEEKMIEGNVVGVGDIKLAYMEHRGEQFH 248

Query: 460 FYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDW 518
              F    + +  +F++ G S +   LR PV + R++S +  R  HP+    + H G D+
Sbjct: 249 AIPFEQNGEMN--FFDQEGNSLKKAFLRDPVKYTRISSRYSKRRFHPVQKRYKAHLGTDY 306

Query: 519 AAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQG 578
           AA RGT I +VGDG+V  A++ GG G    I H   Y + Y H   IA  IK GT +KQG
Sbjct: 307 AARRGTEIRSVGDGLVTHASYTGGNGNYVKIKHNGTYTTQYLHMSKIASGIKPGTRIKQG 366

Query: 579 QIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLL 638
           Q+IG++G+TGL+TGPHL +    NG + D  + +IP  E +       F   K     LL
Sbjct: 367 QVIGYVGSTGLATGPHLCFRFWKNGKQEDWLREKIPPSEPILAANKAAFESTKFESLQLL 426

Query: 639 NNGENPKK-PLFTS 651
            N   P + P   +
Sbjct: 427 ANINYPGEGPKLVA 440


>gi|90578373|ref|ZP_01234184.1| hypothetical protein VAS14_15019 [Vibrio angustum S14]
 gi|90441459|gb|EAS66639.1| hypothetical protein VAS14_15019 [Vibrio angustum S14]
          Length = 438

 Score =  324 bits (829), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 97/414 (23%), Positives = 162/414 (39%), Gaps = 30/414 (7%)

Query: 240 QRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNG 299
                 +  +   K++++   +                   I++  T+            
Sbjct: 51  PATPKVVLPALSSKVMQKTVDLPP------------TYEYKIKNGDTLSGIFARMSIPYS 98

Query: 300 DSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEY 359
           D   I +A  N +++D+L    ILR  V + D K   +       Q+         +  +
Sbjct: 99  DVQSIMEADLNTLQIDKLQPGNILRFWVNESDHKLNKLELEFSLAQRIDYI--RTKDGNF 156

Query: 360 VLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQE 419
            +    +           R +  +  IY     +    G++ +  + IM  L   +N   
Sbjct: 157 DVKEITL-------PGVWRETVATGTIYGSFSASVRKAGVSHSEAQEIMSILKDKLNFSR 209

Query: 420 HLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGK 479
            LK  D  E      +   QA+DDS+ L     +   R       +  +    +++ENG 
Sbjct: 210 DLKSGDSFEVVTKRKYIKGQATDDSD-LQAIRIYTGKRYITAYLHSDGN----FYDENGD 264

Query: 480 SSRPFLLR-TPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKA 537
           S +   LR     F R++S F     HP+ G  + H GVD+AAP GTP++A GDG+V   
Sbjct: 265 SLQRAFLRYPTAKFYRISSPFNPNRVHPVTGRRQPHNGVDFAAPSGTPVLATGDGVVTLV 324

Query: 538 NWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHY 597
                 G+  +I H   Y + Y H   I   +K G  VK+GQ I   G+TG  TGPH+HY
Sbjct: 325 TNHPYAGRYVVIKHSANYSTRYLHNSRIL--VKKGQHVKRGQEIAISGSTGRVTGPHIHY 382

Query: 598 ELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTS 651
           E ++ G  V+    +IP   ++     + F  E  + N+L+       K    S
Sbjct: 383 EFLIRGKAVNPMTAKIPLAASVPRKEKKEFESEVAKYNTLIKQSLEQDKNQIAS 436


>gi|119899047|ref|YP_934260.1| metalloprotease [Azoarcus sp. BH72]
 gi|119671460|emb|CAL95373.1| metalloprotease precursor [Azoarcus sp. BH72]
          Length = 442

 Score =  323 bits (828), Expect = 5e-86,   Method: Composition-based stats.
 Identities = 94/418 (22%), Positives = 161/418 (38%), Gaps = 14/418 (3%)

Query: 236 QTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAG 295
                  D P   + +  I    + + S   +   +P   DD   +Q   T+       G
Sbjct: 38  AATAVVPDAPEAIATQAVIERLPKPLASSTAVESDLPFVHDDR--VQPGDTVNSIFRRLG 95

Query: 296 YSNGDSAK-IAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALN 354
             + ++   + ++      + QL     +   +       ++           L T A  
Sbjct: 96  IRDDEALAFLLESDDGRNALRQLRAGRSVTATIRSDGVLTSL----------SLPTGANG 145

Query: 355 DNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASS 414
           D        E ++               S  I   ++  T   G+  ++   +     + 
Sbjct: 146 DRITLERADEGLRFRTQAAALSTVVEMRSGTIRHSLFATTDAIGLPDSIATKLADLFGTE 205

Query: 415 VNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYF 474
           ++    L+  D     +   +          +L         R     +        +Y+
Sbjct: 206 IDFHTDLRKGDRFGVVYESIYDQGVPVRTGRILAAEFVNQGKRHAVVLYAGASG-KEQYY 264

Query: 475 NENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIV 534
            E+G+S +   LR+P+ F R+TSGFG R HPI    R H GVD+ AP GTP+ A  DG+V
Sbjct: 265 TEDGRSLKQAFLRSPLEFSRVTSGFGRRLHPIHNNWRSHNGVDFGAPTGTPVKATSDGVV 324

Query: 535 EKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPH 594
           E      GYG   ++ H   Y ++Y H +A A  ++ G  V+QG +IG++G+TG +TGPH
Sbjct: 325 EFVGTQRGYGNIIVLRHRGKYDTAYGHLNAFAARLRKGATVEQGDVIGYVGSTGWATGPH 384

Query: 595 LHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
           LHYE+ VN +  D  K+ +P  E L    +  F      +   L    N  +    + 
Sbjct: 385 LHYEIRVNDVPQDPLKIALPTAEPLSPREVASFKTATAPVLRQLGLLNNNTQMASATQ 442


>gi|145297635|ref|YP_001140476.1| membrane-bound metallopeptidase [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142850407|gb|ABO88728.1| membrane-bound metallopeptidase [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 420

 Score =  323 bits (828), Expect = 5e-86,   Method: Composition-based stats.
 Identities = 85/424 (20%), Positives = 150/424 (35%), Gaps = 23/424 (5%)

Query: 222 NKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIE--ENRTITSPQVLIDKIPEFADDLI 279
                           +          +     I   E     +P+  I           
Sbjct: 16  PAPGDILERPLRLELPIATHGTATNEDNTDFNDIPDHELVEAATPEDDIPTDSTPQWQDY 75

Query: 280 PIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRF 339
            +++   +     + G S     K+  A      + +L   + + + + Q +    +   
Sbjct: 76  RVRNGENLTTIFNNLGLSTTTLYKVLDADSKN-NLARLKPGQTIELLIDQDNILQQMK-- 132

Query: 340 SIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGM 399
            I    K  L +   D+            ++ ++    +       I    + +    G+
Sbjct: 133 -IRLNIKQTLVLERTDD--------TYSANMLNEEVEWQQKSYDGVINGSFYVSARNAGI 183

Query: 400 NSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTR 459
            ++ ++ I       +N  + LK  D             +++ +++LL +          
Sbjct: 184 PASHIQKIANLFQWRLNFAKDLKKGDKFRVLVRQETVEGKSTGNTQLLGVEVFNQGKGVS 243

Query: 460 FYRFLNPVDGSVEYFNENGKSSRPFLLRTPVP--FGRMTSGFGMRYHPILGYSRMHTGVD 517
            +   +       Y++  G S      R P    +   +S    R HPI G  R H G D
Sbjct: 244 AWLSEDGN-----YYDGQGNSLERGFRRYPTHSRYRVSSSFNPNRRHPITGQVRPHEGTD 298

Query: 518 WAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQ 577
           +A P GTP++A GDG+V KA      G   +I HG   ++ Y H   +   +K G  VK 
Sbjct: 299 FALPVGTPVLATGDGVVLKATSHPLAGTYVVIRHGRTLMTRYLHLSKLL--VKTGQKVKM 356

Query: 578 GQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSL 637
           G  I   G TG STG HLHYE+ +N   VD+ KV++P  E L G   ++F  + K     
Sbjct: 357 GDKIALSGNTGRSTGAHLHYEVRINNRPVDAMKVKLPMAEPLSGKAKRQFLAKVKSYRKE 416

Query: 638 LNNG 641
           +  G
Sbjct: 417 MEAG 420


>gi|37680908|ref|NP_935517.1| membrane protein [Vibrio vulnificus YJ016]
 gi|37199658|dbj|BAC95488.1| membrane protein [Vibrio vulnificus YJ016]
          Length = 430

 Score =  323 bits (828), Expect = 6e-86,   Method: Composition-based stats.
 Identities = 89/380 (23%), Positives = 157/380 (41%), Gaps = 20/380 (5%)

Query: 261 ITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEV-RVDQLTK 319
           ++   VL  +      +   ++   +        G S     ++         ++ +L  
Sbjct: 58  LSINPVLSAESSVHRWERYRVKDGESAAILFQRIGLSASLLHQLITTNDEIKTQLSRLKP 117

Query: 320 DEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRT 379
            ++L+ G   +D    + R            I  +D           +  +N++    + 
Sbjct: 118 GDMLQFGFDAQDQLVKLKR---QVNAFETFEITRSDTG--------YRSQLNNKEVNYQY 166

Query: 380 SEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQ 439
           +    +I    W A    G+ +N +  +       ++  + ++  D     +       +
Sbjct: 167 AYAEASITSNFWNAAISAGLTANQIMELAGIFGWDIDFAQDIRERDSFRVLYQEQVVEGE 226

Query: 440 ASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGF 499
                 ++    R               D +  Y++ENG++ +   LR P+ F R++S F
Sbjct: 227 VIGRGRIIAAIFRNQGDTFTAIY----DDKTGNYYDENGRAMKKAFLRAPIDFRRVSSNF 282

Query: 500 GMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSS 558
             R  HP+ G  + H G D+ AP GTPI A GDG+V++A +    G    I H N Y++ 
Sbjct: 283 NPRRLHPVTGQVKAHRGTDYVAPVGTPIWAAGDGVVQQAGYNQFNGNYVFIRHSNTYLTK 342

Query: 559 YNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPEREN 618
           Y H     K +K G  VKQGQ IG +G TG  TGPHLHYE +VNG+  +   V +P+ ++
Sbjct: 343 YLHLQK--KLVKTGQRVKQGQSIGTLGGTGRVTGPHLHYEFLVNGVHKNPRTVSLPQAQS 400

Query: 619 LKGDLLQRFAMEKK-RINSL 637
           L G   + F    K R++ L
Sbjct: 401 LSGQAKETFIANSKLRLDKL 420


>gi|320155425|ref|YP_004187804.1| membrane protein [Vibrio vulnificus MO6-24/O]
 gi|319930737|gb|ADV85601.1| membrane protein [Vibrio vulnificus MO6-24/O]
          Length = 430

 Score =  323 bits (828), Expect = 6e-86,   Method: Composition-based stats.
 Identities = 89/380 (23%), Positives = 158/380 (41%), Gaps = 20/380 (5%)

Query: 261 ITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEV-RVDQLTK 319
           ++   VL  +      +   ++   +        G S     ++     +   ++ +L  
Sbjct: 58  LSINPVLSAESSVHRWERYRVKDGESAAILFQRIGLSASLLHQLITTNDDIKTQLSRLKP 117

Query: 320 DEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRT 379
            ++L+ G   +D    + R            I  +D           +  +N++    + 
Sbjct: 118 GDMLQFGFDAQDQLVKLKR---QVNAFETFEITRSDTG--------YRSQLNNKEVNYQY 166

Query: 380 SEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQ 439
           +    +I    W A    G+ +N +  +       ++  + ++  D     +       +
Sbjct: 167 AYAEASITSNFWNAAISAGLTANQIMELAGIFGWDIDFAQDIRERDSFRVLYQEQVVEGE 226

Query: 440 ASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGF 499
                 ++    R               D +  Y++ENG++ +   LR P+ F R++S F
Sbjct: 227 VIGRGRIIAAIFRNQGDTFTAIY----DDKTGNYYDENGRAMKKAFLRAPIDFRRVSSNF 282

Query: 500 GMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSS 558
             R  HP+ G  + H G D+ AP GTPI A GDG+V++A +    G    I H N Y++ 
Sbjct: 283 NPRRLHPVTGQVKAHRGTDYVAPVGTPIWAAGDGVVQQAGYNQFNGNYVFIRHSNTYLTK 342

Query: 559 YNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPEREN 618
           Y H     K +K G  VKQGQ IG +G TG  TGPHLHYE +VNG+  +   V +P+ ++
Sbjct: 343 YLHLQK--KLVKTGQRVKQGQSIGTLGGTGRVTGPHLHYEFLVNGVHKNPRTVSLPQAQS 400

Query: 619 LKGDLLQRFAMEKK-RINSL 637
           L G   + F    K R++ L
Sbjct: 401 LSGQAKETFIANSKLRLDKL 420


>gi|209695985|ref|YP_002263915.1| putative membrane associated peptidase [Aliivibrio salmonicida
           LFI1238]
 gi|208009938|emb|CAQ80252.1| putative membrane associated peptidase [Aliivibrio salmonicida
           LFI1238]
          Length = 436

 Score =  323 bits (827), Expect = 6e-86,   Method: Composition-based stats.
 Identities = 91/417 (21%), Positives = 167/417 (40%), Gaps = 30/417 (7%)

Query: 234 DPQTLDQRHDHPITYSKKIKIIEENRTITSPQV----------LIDKIPEFADDLIPIQH 283
               +      P + +      + N   T P               K  +   +   ++ 
Sbjct: 21  SAGVVAAIATIPGSVAPDSGFYKLNVGQTYPTEIRQEALISHEQSGKNQQLIWETYTVKS 80

Query: 284 NTTIFDAMVHAGYSNGDSAKIAKALKN-EVRVDQLTKDEILRIGVVQKDDKFTIVRFSIY 342
             +        G S      +  + K  E ++ +L   + L+ G  Q  +   ++R    
Sbjct: 81  GESASVLFNRVGLSARQLYNLTSSDKEIETQLTRLRPGDKLKFGFNQNQEIIQLIRPISQ 140

Query: 343 HKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSN 402
            +   +  +     + Y+  +E  ++         + +     I    W A+   G+N N
Sbjct: 141 FETYRISKV----GDGYLGLLEKQEI-------ETQLNYTKATITSNFWNASITAGLNPN 189

Query: 403 LVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYR 462
            +  +       ++    ++  D     +   ++  + +    ++              R
Sbjct: 190 QIMELAGIFGWDIDFALDIRAGDTFTVLYEEKYSKGEYAGKGNIIATTFTNRGDTFTAIR 249

Query: 463 FLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAP 521
                D +  ++  NG++ +   LR+P+ F  ++S F  R  HP+ G    H G D+ AP
Sbjct: 250 ----NDKNGNFYEPNGRAMKKAFLRSPINFRYVSSNFNPRRLHPVTGQRTAHRGTDYVAP 305

Query: 522 RGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQII 581
            GTPI A GDG+V+K+ +    G    I H N Y++ Y H     + +KAG  VKQG  +
Sbjct: 306 VGTPIWAAGDGVVDKSGYNQFNGNYVFIRHSNTYITKYLHMTK--RYVKAGQRVKQGDTV 363

Query: 582 GWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAME-KKRINSL 637
           G +G TG  TGPHLHYE +VNG+  DS  V +P+ ++L G   + F +  K+R+  L
Sbjct: 364 GTLGGTGRVTGPHLHYEFLVNGVHKDSRTVSLPQSKSLTGKDKKEFEVVAKQRLKEL 420


>gi|56475932|ref|YP_157521.1| peptidase family protein [Aromatoleum aromaticum EbN1]
 gi|56311975|emb|CAI06620.1| Peptidase family protein [Aromatoleum aromaticum EbN1]
          Length = 441

 Score =  323 bits (827), Expect = 6e-86,   Method: Composition-based stats.
 Identities = 88/424 (20%), Positives = 150/424 (35%), Gaps = 15/424 (3%)

Query: 217 FFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFAD 276
              +      +  L       +      P    + +     + T+          P    
Sbjct: 21  RRWMLGTLVGTSLLSVVAATAVVPGDPLPPFPVQSVTEQLGSVTVQPSA----NGPIPFV 76

Query: 277 DLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVR-VDQLTKDEILRIGVVQKDDKFT 335
               +Q   TI          + ++     +       + QL     +   V  +    +
Sbjct: 77  FDERVQPGDTIQSLFRRIKIDDQEALDFLSSDPESRSTLRQLHAGRSVLALVDGRGKLVS 136

Query: 336 IVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATS 395
           +         +   TI                    H          S  I   ++ AT 
Sbjct: 137 LTLPVARGDSR--FTIERTPEG-------IRSRRQAHPEVDTHIEMRSGTIRHTLFGATD 187

Query: 396 FNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGE 455
             G+  ++   +     + ++    L+  D     +   +     +    +L        
Sbjct: 188 SAGVPDSIATKLAEIFGTEIDFSSDLRAGDQFSVVYETIYDKGAPAGSGRVLAAEFVNQG 247

Query: 456 TRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTG 515
            +       +    S  Y+   G+      LR P+ F R++S FG R HPI    R H G
Sbjct: 248 KKYAVVFHRDADG-SEAYYTPEGRGLNEAYLRYPLEFSRISSTFGRRLHPIHRSWRSHNG 306

Query: 516 VDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAV 575
           VD+AAP GTP+ A  DG+V  A    GYG   ++ H +GY ++Y H +  A  ++ GT +
Sbjct: 307 VDFAAPTGTPVKAASDGVVNYAGRQNGYGNIVILQHRDGYSTAYAHLNGFAGGLRKGTKI 366

Query: 576 KQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRIN 635
           +QG +IG++G+TG +TGPHLHYE+ VN I  D  K+ +P  + L    L  F      + 
Sbjct: 367 RQGDLIGYVGSTGWATGPHLHYEIRVNNIARDPMKIALPTVQPLGPTALAAFKSRTAPLL 426

Query: 636 SLLN 639
             L 
Sbjct: 427 QRLA 430


>gi|332991823|gb|AEF01878.1| peptidase, M23/M37 family protein [Alteromonas sp. SN2]
          Length = 441

 Score =  323 bits (827), Expect = 7e-86,   Method: Composition-based stats.
 Identities = 78/389 (20%), Positives = 147/389 (37%), Gaps = 15/389 (3%)

Query: 256 EENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVD 315
             +  I     +     E       ++   T+      AG+++ D   + +A      + 
Sbjct: 61  PLDLNIMPSTDVFSIEEESNWQSYKVRSGDTLAKLFKRAGFTSRDVYNVTQAGDLAKTLV 120

Query: 316 QLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMD 375
            L   + L   +        +     Y            D+         +  ++  +  
Sbjct: 121 TLLPGDELSFKINNDGTFGELK----YKLSSTETLFIRPDS---TSEDNSLTAELEKRDV 173

Query: 376 YMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNH 435
            +R +     I+   W A +  G+ SN +  +       ++    ++  D     F   +
Sbjct: 174 DIRYNFAQGEIHSSFWNAGATAGLTSNQIMNLAGIFGWDIDFATEIRSGDTFNVVFEEQY 233

Query: 436 ANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRM 495
            + +     +++                 +       Y+   G+S R   LR P+ F  +
Sbjct: 234 IDGEFVGYGDIVAAEFTNQGEEFSAILHEDGT-----YYTPEGRSMRKSFLRAPINFRYV 288

Query: 496 TSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNG 554
           +S F     HP+    + H G D+ A  GTP++A GDG V K+ +    G    + HG  
Sbjct: 289 SSNFSKARFHPVQKRWKAHRGTDYVAAVGTPVMAAGDGKVIKSAYDKYNGHHVFVQHGEK 348

Query: 555 YVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIP 614
           Y + Y H     + +K G  VKQGQ IG++G+TGL++GPH+HYE +V+G+  +   V +P
Sbjct: 349 YTTKYLHFKK--RAVKVGDTVKQGQTIGYLGSTGLASGPHVHYEFLVDGVHRNPRTVSLP 406

Query: 615 ERENLKGDLLQRFAMEKKRINSLLNNGEN 643
           +   +  +  + F          LNN + 
Sbjct: 407 KALPIAAEEREAFMEIAHVRQQQLNNNKR 435


>gi|262164659|ref|ZP_06032397.1| cell wall endopeptidase family M23/M37 [Vibrio mimicus VM223]
 gi|262027039|gb|EEY45706.1| cell wall endopeptidase family M23/M37 [Vibrio mimicus VM223]
          Length = 433

 Score =  323 bits (827), Expect = 7e-86,   Method: Composition-based stats.
 Identities = 94/442 (21%), Positives = 165/442 (37%), Gaps = 25/442 (5%)

Query: 210 KNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITY------SKKIKIIEENRTITS 263
           K+ I+    L   KK     L       +    + P           +   +    T  +
Sbjct: 4   KSIILRFSELSTRKKVTLVGLPLLAVAAISTSLNSPTRQHRIELSLPEASFVPFANTEGA 63

Query: 264 PQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEIL 323
            +          D    I+    +       G++  +  K+ +   N + +D L    +L
Sbjct: 64  TEQTEVIKAGHPDYEYEIKPGDNLSTIFSQLGFAYTELMKVMETDLNYLALDTLRPGNVL 123

Query: 324 RIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEES 383
           R    + +   T+ +  +             D+  Y       + +        +     
Sbjct: 124 RFWKGKDN---TLSKMELEFSLVDRAVYTRLDDGSY-------EFEERKIPGTWKVEPLI 173

Query: 384 PNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDD 443
             +      + +  G+ +  V  I+  L   +N    L+  D  E   S     ++ + +
Sbjct: 174 GEVDGSFSLSANRAGLGAADVDQIVTLLKDKINFGRDLRRGDRFEVVLSRQFVGDKLTGN 233

Query: 444 SELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGR-MTSGFGMR 502
           SE+  I           Y   +       Y+++NG S +    R PV     ++S F  +
Sbjct: 234 SEIQAIKIFNRGKEITAYLHQDGQ-----YYDKNGDSLQRAFQRYPVDSKWRISSNFDPK 288

Query: 503 Y-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNH 561
             HP+      H G D+A P GTP+ + GDG+V         G   ++ HGN Y++ Y H
Sbjct: 289 RLHPVTKRVAPHNGTDFAMPIGTPVYSSGDGVVVMTRSHPYAGNYVVVQHGNTYMTRYLH 348

Query: 562 QDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKG 621
              I   +K G  V +GQ IG  G TG  TGPHLHYELIV G  V++ K  IP   ++  
Sbjct: 349 LSKIL--VKKGQKVSRGQRIGSSGNTGRVTGPHLHYELIVRGRAVNAMKANIPMASSVPK 406

Query: 622 DLLQRFAMEKKRINSLLNNGEN 643
             + +F  ++K ++ +L   E+
Sbjct: 407 KEMAQFVAKRKELDQMLARQES 428


>gi|225012393|ref|ZP_03702829.1| Peptidase M23 [Flavobacteria bacterium MS024-2A]
 gi|225003370|gb|EEG41344.1| Peptidase M23 [Flavobacteria bacterium MS024-2A]
          Length = 429

 Score =  323 bits (827), Expect = 7e-86,   Method: Composition-based stats.
 Identities = 90/372 (24%), Positives = 152/372 (40%), Gaps = 17/372 (4%)

Query: 272 PEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKD 331
             +      I    T    +   G        I +A+K +V V +LT  +   +   + D
Sbjct: 45  NAYELRENKINRGDTFGKILEKNGIDYPQVYNILQAIKGKVNVRKLTIGKAYSLFYSK-D 103

Query: 332 DKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIW 391
              T   F  +        I L D+      V+P ++            E S  I   ++
Sbjct: 104 SITTPEYFVYHPGVSGYSVIHLRDSLYGEEIVKPSRL---------VELEASGVIESSLY 154

Query: 392 RATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQA-SDDSELLYIH 450
                +G+N NL   +    A +V+    L+  D  +  ++    ++        +   +
Sbjct: 155 ETMQKSGINENLTYYLSDVYAWTVDFFR-LQKGDRFKVIYTEKFVDDSISVGIERIKAAY 213

Query: 451 ARFGETR-TRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPIL-- 507
                     F    +P  G V+YF+    S R   L+ P+ F R++S + +R       
Sbjct: 214 FEHNGKPLYAFEFISDPEKGIVDYFDNEANSLRRAFLQGPLKFNRVSSRYNLRRRIAYYG 273

Query: 508 GYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAK 567
              R H G D+AA  GTPI+A  +G V KA++  G G    + H   Y + Y H     +
Sbjct: 274 NRIRPHKGTDFAASEGTPILATANGTVVKASYTKGNGNYVTLKHNGTYSTQYLHMKK--R 331

Query: 568 NIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRF 627
            +K G  V+QG +IGW+G TG ++GPH+ Y    NG +VD  K ++P+ + +  DL  +F
Sbjct: 332 KVKVGQFVEQGDVIGWVGMTGNTSGPHVCYRFWKNGKQVDPFKQKLPDAKPISSDLKSKF 391

Query: 628 AMEKKRINSLLN 639
           A       + L+
Sbjct: 392 AEHIIPYKTKLD 403


>gi|149909292|ref|ZP_01897948.1| putative peptidase, M23/M37 family [Moritella sp. PE36]
 gi|149807609|gb|EDM67557.1| putative peptidase, M23/M37 family [Moritella sp. PE36]
          Length = 432

 Score =  323 bits (827), Expect = 7e-86,   Method: Composition-based stats.
 Identities = 86/382 (22%), Positives = 142/382 (37%), Gaps = 20/382 (5%)

Query: 263 SPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEI 322
           +               I ++    +         S     +I   L +  R+  +   + 
Sbjct: 63  TTSANKPVKTRLNSKEIIVKSGDNLSLIGKRGHLSAKTIYEI-DRLASAKRLRNIYPGQK 121

Query: 323 LRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEE 382
           L I     +D    +     +     L I    +  YV      K+        +R    
Sbjct: 122 LTITT---NDAGQFMGLIYPYSATESLYINKTSDG-YVANTVKSKI-------EIREQFA 170

Query: 383 SPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASD 442
             +I    W A     M +  +  +       ++    ++  D     +     +     
Sbjct: 171 RADITSNFWNAGVKANMPAKQIMNLATIFGWDIDFALDIRAGDSFAVIYEEQFIDGDFVS 230

Query: 443 DSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFG-M 501
              +L         + +  R  +       Y+  +G+S R   LR PV F  ++S F   
Sbjct: 231 TGNILAAEFINQGDKFQAVRNNDGS-----YYTPSGRSMRKAFLRAPVNFKYISSSFNRK 285

Query: 502 RYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNH 561
           R HP+ G  R H G+D+AA  GTPIV+ GDG V  + +    G    I H    V+ Y H
Sbjct: 286 RRHPVTGKVRAHNGIDYAARTGTPIVSAGDGKVIASAYNRFNGNYVFIKHNTNIVTKYLH 345

Query: 562 QDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKG 621
            +   + +K G  VKQ Q IG +G TG  TG HLHYE +VNG   +   V +P+ ++L+G
Sbjct: 346 MNK--RTVKQGQRVKQNQKIGTVGATGRVTGAHLHYEFLVNGKHKNPKTVSLPKADSLRG 403

Query: 622 DLLQRFAMEKKRINSLLNNGEN 643
           +   +F  + K I   L +   
Sbjct: 404 NEKTKFVAKAKGIIKQLESNAK 425


>gi|332142560|ref|YP_004428298.1| Peptidase, M23/M37 family protein [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327552582|gb|AEA99300.1| Peptidase, M23/M37 family protein [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 441

 Score =  322 bits (826), Expect = 8e-86,   Method: Composition-based stats.
 Identities = 83/384 (21%), Positives = 145/384 (37%), Gaps = 15/384 (3%)

Query: 261 ITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKD 320
           IT    +     E       ++   T+      AG+++ D   + +A +    +  L   
Sbjct: 66  ITPSTDVFSGEEESTWQTYKVRSGDTLAKLFKRAGFTSRDVYNVTRAGELSKTLVTLLPG 125

Query: 321 EILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTS 380
           + L            +     Y            D          +  ++  +   +R +
Sbjct: 126 DELSFKANNDGSFGELK----YKLSSTETLFVRPDT---SEENSSLVAEVEKRAVDIRYN 178

Query: 381 EESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQA 440
                I+   W A    G+ SN +  +       ++    ++  D     F   + + + 
Sbjct: 179 FAQGEIHSSFWNAARDAGLTSNQIMNLAGIFGWDIDFAMEIRSGDTFNVVFEEQYIDGEF 238

Query: 441 SDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFG 500
               +++                 +       Y+   G+S R   LR PV F  ++S F 
Sbjct: 239 VGYGDIVAAEFTNQGEHFSAILHEDGT-----YYTPEGRSMRKSFLRAPVNFRYVSSNFT 293

Query: 501 MRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSY 559
               HP+    + H G D+ A  GTPI+A GDG V KA +    G    I HG  Y + Y
Sbjct: 294 KARFHPVQKRWKAHRGTDYVAAVGTPIMAAGDGKVIKAGYDKYNGHHVFIQHGEKYTTKY 353

Query: 560 NHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENL 619
            H     + +K G  VKQGQ +G++G++G+ TG HLHYE +V+G+  +   V +P+   +
Sbjct: 354 LHFKK--RAVKVGDVVKQGQTVGYLGSSGMVTGAHLHYEFLVDGVHRNPRTVELPKALPI 411

Query: 620 KGDLLQRFAMEKKRINSLLNNGEN 643
             +  +RF    K     LNN + 
Sbjct: 412 AKEERERFMEIAKLRQQQLNNNKR 435


>gi|239995871|ref|ZP_04716395.1| Peptidase, M23/M37 family protein [Alteromonas macleodii ATCC
           27126]
          Length = 441

 Score =  322 bits (825), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 81/384 (21%), Positives = 152/384 (39%), Gaps = 15/384 (3%)

Query: 261 ITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKD 320
           I     +     E +     ++   T+      AG+++ D   + +A +    +  L   
Sbjct: 66  IAPSTNVFSGEEESSWQTYKVRSGDTLAKLFKRAGFTSRDVYNVTQAGELTKTLVTLLPG 125

Query: 321 EILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTS 380
           + L     +      + ++ +   +   +    +D N        +  ++  +   +R +
Sbjct: 126 DELSFKANKDGSFGEL-KYKLSSTETLFVRPESSDENS------ALTAELEKRDVDIRYN 178

Query: 381 EESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQA 440
                I+   W A S  G+ SN +  +       ++    ++  D     F   + + + 
Sbjct: 179 FAQGEIHSSFWNAASDAGLTSNQIMNLAGIFGWDIDFAIEIRSGDTFNVVFEEQYIDGEF 238

Query: 441 SDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFG 500
               +++                 +       Y+   G+S R   LR PV F  ++S F 
Sbjct: 239 VGYGDIVAAEFTNQGEHFSAILHEDGT-----YYTPEGRSMRKSFLRAPVNFRYVSSNFT 293

Query: 501 MRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSY 559
               HP+    + H G D+ A  GTPI+A GDG V KA +    G    I HG  Y + Y
Sbjct: 294 KARFHPVQKRWKAHRGTDYVAAVGTPIMAAGDGKVIKAGYDKYNGHHVFIQHGEKYTTKY 353

Query: 560 NHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENL 619
            H     + +K G  VKQGQ +G++G++G+ TG HLHYE +V+G+  +   V +P+   +
Sbjct: 354 LHFKK--RAVKVGDTVKQGQTVGYLGSSGMVTGAHLHYEFLVDGVHRNPRTVELPKALPI 411

Query: 620 KGDLLQRFAMEKKRINSLLNNGEN 643
             +  +RF          L+N + 
Sbjct: 412 AKEEKERFMEIAAIRQEQLDNNKR 435


>gi|54309532|ref|YP_130552.1| hypothetical protein PBPRA2365 [Photobacterium profundum SS9]
 gi|46913968|emb|CAG20750.1| conserved hypothetical protein [Photobacterium profundum SS9]
          Length = 434

 Score =  322 bits (825), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 91/432 (21%), Positives = 156/432 (36%), Gaps = 23/432 (5%)

Query: 218 FLLHNKKNQSFTLYYADPQTLDQRHDHPITYS--KKIKIIEENRTITSPQVLIDKIPEFA 275
            LL        T+            D  +  +    +     +         I K P + 
Sbjct: 16  KLLSIAGLSLVTVATVLSFRSSPIQDIELDIASFTSVNTAPASDPRNDSIKDIVKPPNYE 75

Query: 276 DDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFT 335
                IQ   T+ +     G    D  ++ +A  + +R+D L    +LR  +     +  
Sbjct: 76  YQ---IQSGDTLSEIFAKLGIPLSDMQQVMEADLDNLRIDTLRPGHLLRFWLDDSGQRLD 132

Query: 336 IVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATS 395
            +       Q+           E+V    P            ++S  + +IY     +  
Sbjct: 133 KLELEFNAAQRVDYQRVNEGGFEFVEITLP---------GTWKSSVATGSIYGSFSVSAQ 183

Query: 396 FNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGE 455
             G++ + +  I+  L   +N    LK  D  E   +  +   +A+   ++  I      
Sbjct: 184 KAGLDFSEINEIINLLKDKINFSRDLKAGDTFEVVVANQYIEGKATGLHDIKAIRLENRG 243

Query: 456 TRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRM--TSGFGMRYHPILGYSRMH 513
                Y   +       Y++ NG+S +   L  P        ++    R HP+ G    H
Sbjct: 244 RIISAYLHEDGN-----YYDANGESLQRAFLPYPSAKRWRISSNFNANRRHPVTGRRAPH 298

Query: 514 TGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGT 573
            GVD+AAP GTP++A GDG+V         G+  +I HG  Y + Y H   I   +K G 
Sbjct: 299 NGVDFAAPSGTPVLATGDGVVVMTTNHPYAGRYIVIQHGANYRTRYLHNSKIL--VKKGQ 356

Query: 574 AVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKR 633
            V +GQ I   G TG  TGPH+HYE ++    V+    +IP   ++      +F     +
Sbjct: 357 KVSRGQQIALSGQTGRVTGPHIHYEFLIRNKPVNPMTAKIPMASSVPTKEKVQFEQTVAK 416

Query: 634 INSLLNNGENPK 645
            N L+   +   
Sbjct: 417 YNKLMQVEDTNP 428


>gi|285017199|ref|YP_003374910.1| membrane-bound metalloendopeptidase [Xanthomonas albilineans GPE
           PC73]
 gi|283472417|emb|CBA14922.1| hypothetical membrane-bound metalloendopeptidase protein
           [Xanthomonas albilineans]
          Length = 483

 Score =  322 bits (824), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 94/427 (22%), Positives = 168/427 (39%), Gaps = 25/427 (5%)

Query: 229 TLYYADPQTLDQRHDHPITYSKKIKIIEEN-RTITSPQVLIDKIPEFADDLIPIQHNTTI 287
            L            + P+  +     +     ++   Q            ++ IQ   T+
Sbjct: 55  ALVATIVPGFSNAINVPLQTTHATLALPLPPISLAQQQQRASDDN---WQVVRIQSGQTL 111

Query: 288 FDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKH 347
                  G       ++ +   +   + +L     L   + +  +   +          H
Sbjct: 112 GAVFEQLGIPATVMQRVLEHPGSRDALTKLRPGAELAFNLPEAGN---LRGIRFDRDATH 168

Query: 348 LLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLI 407
            + ++L  ++        ++  +  +     +   S  I   ++ A    G++ + +  +
Sbjct: 169 RMELSLRGDD--------IQEKVTERETSTHSVVSSGEITSSLYVAARKAGLSPSAIATM 220

Query: 408 M-RTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNP 466
                   ++  + L+P D             +  D  ++L             +RF   
Sbjct: 221 TDEIFKYDIDFDKDLQPGDRFSVVMDETWREGERIDSGKILAATFTTRGKTYTGFRFERD 280

Query: 467 VDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPI 526
                EYF+ NG+  +   +R PV + R++S FG R HP+LG  RMH G+D+AAP GTPI
Sbjct: 281 -GKPAEYFDVNGRPLKKSFIRMPVSYSRISSTFGERLHPVLGTMRMHKGIDYAAPMGTPI 339

Query: 527 VAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGT 586
           +A GD  V+      GYG   ++ HG GY + Y H       IK G  + QG +IG++G 
Sbjct: 340 MAAGDARVQFVGTQHGYGNMVILDHGKGYSTVYGHMSRFGS-IKMGQHINQGTVIGYVGM 398

Query: 587 TGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAME-------KKRINSLLN 639
           TG++TGPHLHYE  V+G++ +   V +P    L G  L  F  +        +R+  L+ 
Sbjct: 399 TGMATGPHLHYEFRVDGVQRNPASVTMPPPTPLAGAELAAFRAQTSPALARIQRVEKLIY 458

Query: 640 NGENPKK 646
               P K
Sbjct: 459 ADAEPAK 465


>gi|197104314|ref|YP_002129691.1| peptidase, M23/M37 family [Phenylobacterium zucineum HLK1]
 gi|196477734|gb|ACG77262.1| peptidase, M23/M37 family [Phenylobacterium zucineum HLK1]
          Length = 444

 Score =  322 bits (824), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 118/452 (26%), Positives = 200/452 (44%), Gaps = 18/452 (3%)

Query: 204 AQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITS 263
           A+ +  + +      +L         L+ A   T           + +     ++   T 
Sbjct: 2   AEFDPRRFSFRIAPRVLA-GGGALIALFAAWKMTDTTGAPSAPPLAPEAVAALQHAAFTQ 60

Query: 264 PQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEIL 323
            ++         +  + +    T+ +A+  AG +  ++ +   AL   +    +      
Sbjct: 61  AEIE-PGWSRPENVPVKVLRGETLEEAVQRAGVAPDEARQAVAALGQAMDTVHIKAGMAF 119

Query: 324 RIGVVQKDDKF---TIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTS 380
              V +   +     ++  S+       LT++   +         +++    +     T+
Sbjct: 120 DAAVARPRAERGHARLIGLSLRTGPASALTLSRTFDGA-------LRLRSLEEAITEETT 172

Query: 381 EESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNH-ANNQ 439
                I   ++ + +  G    +V  + +  A  ++ Q  ++P D  +  F      + +
Sbjct: 173 VADGEIRGSLYESAAKLGATPEIVAQVSKLFAHKIDFQRDIQPGDDFKLVFGRKVTESGR 232

Query: 440 ASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGF 499
             D  +L Y            +      DG VEYF+E GK+ + FLLRTPV   RMTS F
Sbjct: 233 TVDTGDLEYAELHG-----VKFYRFERGDGDVEYFDETGKNIKGFLLRTPVDGARMTSRF 287

Query: 500 GMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSY 559
           G+R HP+LGY+R H GVD+ A  GTPI+A GDG+V +A+  GGYG    I H  G+ + Y
Sbjct: 288 GLRRHPVLGYARAHQGVDFGAGHGTPILAAGDGVVSRASRWGGYGNWLQIKHSGGWSTGY 347

Query: 560 NHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENL 619
            H    AK ++ G  V+QGQ++G++G+TGLSTGPHLHYE+ +NG +V+    ++P+   L
Sbjct: 348 AHLSRYAKGVRPGVRVRQGQVVGYVGSTGLSTGPHLHYEVWLNGRRVNPVGAKVPQGTVL 407

Query: 620 KGDLLQRFAMEKKRINSLLNNGENPKKPLFTS 651
            G  L RF  +K RI  LL  G         S
Sbjct: 408 AGAELARFKAQKARIQRLLEAGGGEAPRALAS 439


>gi|193215936|ref|YP_001997135.1| peptidase M23 [Chloroherpeton thalassium ATCC 35110]
 gi|193089413|gb|ACF14688.1| Peptidase M23 [Chloroherpeton thalassium ATCC 35110]
          Length = 429

 Score =  322 bits (824), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 92/405 (22%), Positives = 164/405 (40%), Gaps = 23/405 (5%)

Query: 253 KIIEENRTITSPQVLIDKIPEFADDLIP----------IQHNTTIFDAMVHAGYSNGDSA 302
           +  E ++T T+   L  K P+  +  I           ++ + T+ D + +         
Sbjct: 22  RTAEPSQTETAFSTLEKKSPQIDEYGIVTDSLVSLKKNVKRHETLADILTNYDVPYIKIV 81

Query: 303 KIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLG 362
           ++AK         ++       + +   +D    VR+ IY K      +       + L 
Sbjct: 82  EMAKLPSEVFDERRIKAGSNYALYL--SNDSAKSVRYFIYQKTPIDYIV-------FNLS 132

Query: 363 VEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLK 422
              + +    +    +T   +  I   ++      G +  L   +    A  ++    ++
Sbjct: 133 DSLLGVTQGQKPIVSKTRTITGTIEASLYETLIEQGASPMLALKLADVFAWQIDF-YGIQ 191

Query: 423 PTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSR 482
             D+ +  F     ++++    E+   +          Y F         Y++E G S +
Sbjct: 192 KGDYFKAIFEEQFIDDESIGVGEISAAYFYHNGKDY--YAFDFDDGKRRAYYDEEGNSLQ 249

Query: 483 PFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAG 541
              LR P+ F R++S +     HP+L   R H G+D+AAP GTP+ +VGDG+V +  W+ 
Sbjct: 250 KQFLRAPLHFSRISSHYSRSRFHPVLRIYRPHLGIDYAAPTGTPVRSVGDGVVVEKRWSK 309

Query: 542 GYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIV 601
           G G+   I H + Y S Y H    AK I  G  VKQGQ+IG++G+TGLSTGPHL +    
Sbjct: 310 GGGRTLKIRHNSNYQSGYLHLSGYAKGIVKGARVKQGQVIGYVGSTGLSTGPHLDFRFWK 369

Query: 602 NGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKK 646
           +G   +  ++  P    +  +    F        S L+  E    
Sbjct: 370 HGRLTNYLQMEFPPTHPVNPEKKGDFMNLMAGYKSQLDKLEPSSN 414


>gi|326334673|ref|ZP_08200880.1| peptidase M23B [Capnocytophaga sp. oral taxon 338 str. F0234]
 gi|325693123|gb|EGD35055.1| peptidase M23B [Capnocytophaga sp. oral taxon 338 str. F0234]
          Length = 432

 Score =  321 bits (823), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 85/372 (22%), Positives = 154/372 (41%), Gaps = 15/372 (4%)

Query: 273 EFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDD 332
           E+      ++   T    +     S    A+I +  K  +R       +   +   +K  
Sbjct: 50  EYNVVKDTLKTGDTFGAILNDQHISPQKVAEITEKSKELLRPKDFRAGQPYALIFDKK-M 108

Query: 333 KFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWR 392
             ++  F       + + + L D+         + +    +   +   E    I + +  
Sbjct: 109 PDSLAYFIYQPNLLNFIEVRLKDS---------ISVRKIERKVTIVEREGGGYIKNNLIE 159

Query: 393 ATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQA-SDDSELLYIHA 451
               +GM+ +    + +    +++   HL+  D  +  +   + ++   +    +     
Sbjct: 160 DVMKSGMSFSAAYKLSQIFDYTIDF-FHLQEDDKFKIIYDERYVDDTINAGLVRVKAAFF 218

Query: 452 RFGETR-TRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYS 510
                    F    + V+    Y++ENG   +   L++P+   R+TS +GMRYHPIL   
Sbjct: 219 EHKGKPFYAFNFETDTVNHKWGYYDENGNMMKRMFLKSPLDIFRITSHYGMRYHPILHRM 278

Query: 511 RMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIK 570
           + H G D+AAP GTPI A  +G V +A ++ G G    I H   Y + Y H   I    +
Sbjct: 279 KGHFGTDYAAPTGTPIRATANGTVTQAGYSSGNGNYVKIRHDKTYETQYLHMSKIIA--R 336

Query: 571 AGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAME 630
            G  V QG IIG +G+TGL+TGPH+ Y    NG+++D  K R+PE   +   L  R+   
Sbjct: 337 RGQHVSQGDIIGLVGSTGLATGPHVCYRFWKNGVQIDPLKERLPEATPIDAKLKPRYLKF 396

Query: 631 KKRINSLLNNGE 642
            + +   L+   
Sbjct: 397 VEPLKKQLDAVP 408


>gi|89074669|ref|ZP_01161134.1| hypothetical protein SKA34_07289 [Photobacterium sp. SKA34]
 gi|89049607|gb|EAR55167.1| hypothetical protein SKA34_07289 [Photobacterium sp. SKA34]
          Length = 444

 Score =  321 bits (823), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 94/409 (22%), Positives = 161/409 (39%), Gaps = 24/409 (5%)

Query: 250 KKIKIIEENR-TITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKAL 308
             I    E      SP+V+   +         I++  T+            D   I +A 
Sbjct: 48  LSIPATPEVVLPALSPKVMKKTVDLPPTYEYKIKNGDTLSGIFARMSIPYSDIQSIMEAD 107

Query: 309 K-----NEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGV 363
                 +++++D+L    ILR  + + D K   +       Q+         +  + +  
Sbjct: 108 LNTLQIDKLQIDKLQPGNILRFWINESDHKLNKLELEFSLAQRIDYI--RTKDGNFDVKE 165

Query: 364 EPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKP 423
             +           R +  +  IY     +    G++ +  + IM  L   +N    LK 
Sbjct: 166 ITL-------PGVWRETVATGTIYGSFSASVRKAGVSHSEAQEIMSILKDKLNFNRDLKS 218

Query: 424 TDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRP 483
            D  E      +   Q++ DS+ L     +   R       +  +    +++ENG+S + 
Sbjct: 219 GDSFEIVTKRKYIKGQSTGDSD-LQAIRIYTGKRYITAYLHSDGN----FYDENGESLQR 273

Query: 484 FLLR-TPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAG 541
             +R     F R++S F     HP+ G  + H GVD+AAP GTP++A GDG+V       
Sbjct: 274 AFIRYPTAKFYRISSPFNPNRVHPVTGRRQPHNGVDFAAPSGTPVLATGDGVVTLVTNHP 333

Query: 542 GYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIV 601
             G+  +I H   Y + Y H   I   +K G  VK+GQ I   G TG  TGPH+HYE ++
Sbjct: 334 YAGRYVVIKHSANYSTRYLHNSRIL--VKKGQHVKRGQEIALSGGTGRVTGPHIHYEFLI 391

Query: 602 NGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFT 650
            G  V+    +IP   ++     + F ++  + N L+       K    
Sbjct: 392 RGKAVNPMTAKIPLAASVPRKEKKEFEIQVAKYNDLMKQSIEQDKNQIA 440


>gi|262403217|ref|ZP_06079777.1| cell wall endopeptidase family M23/M37 [Vibrio sp. RC586]
 gi|262350716|gb|EEY99849.1| cell wall endopeptidase family M23/M37 [Vibrio sp. RC586]
          Length = 413

 Score =  321 bits (823), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 87/396 (21%), Positives = 157/396 (39%), Gaps = 19/396 (4%)

Query: 250 KKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALK 309
            +  ++  +   ++ +          D    I+    +       G++  +  K+ +   
Sbjct: 30  PESALVPFSTAESAAEQTEVYRAGHPDYEYEIKPGDNLSTIFSQLGFAYTELMKVMETDL 89

Query: 310 NEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMD 369
           N + +D L    +LR    + +   T+ +  +             ++  Y       + +
Sbjct: 90  NYLALDTLRPGNVLRFWKGKDN---TLSKMELEFSLVDRAVYTRLNDGNY-------EFE 139

Query: 370 INHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLET 429
                   +      ++      + S  G+ +  V  I+  L   +N    L+  D  E 
Sbjct: 140 ERKIPGTWKVEPLIGDVDGSFSVSASRAGLGAADVDQIVTLLKDKINFGRDLRSGDRFEV 199

Query: 430 FFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTP 489
             S      + + +SE+  I           Y   +       Y+++NG+S +    R P
Sbjct: 200 VLSRQFVGEKLTGNSEIQAIKIFNRGKEITAYLHQDGQ-----YYDKNGESLQRAFQRYP 254

Query: 490 VPFGR-MTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQT 547
           V     ++S F  +  HP+      H G D+A P GTPI + GDG+V         G   
Sbjct: 255 VDSKWRISSNFDPKRLHPVTKRVAPHNGTDFAMPIGTPIYSSGDGVVVMTRSHPYAGNYV 314

Query: 548 LIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVD 607
           +I HG+ Y++ Y H   I   +K G  V +GQ IG  G TG  TGPHLHYELIV G  V+
Sbjct: 315 VIQHGSTYMTRYLHMSKIL--VKKGQKVSRGQRIGLSGNTGRVTGPHLHYELIVRGRAVN 372

Query: 608 STKVRIPERENLKGDLLQRFAMEKKRINSLLNNGEN 643
           + K  IP   ++    + +F  ++K ++ +L   E+
Sbjct: 373 AMKANIPMASSVPKKEMSQFVAKRKELDQMLARQES 408


>gi|167753204|ref|ZP_02425331.1| hypothetical protein ALIPUT_01475 [Alistipes putredinis DSM 17216]
 gi|167659135|gb|EDS03265.1| hypothetical protein ALIPUT_01475 [Alistipes putredinis DSM 17216]
          Length = 437

 Score =  321 bits (823), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 92/388 (23%), Positives = 163/388 (42%), Gaps = 13/388 (3%)

Query: 255 IEEN--RTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEV 312
            EEN    I    +       +  +   I    T+   +   G S     ++ KA K+  
Sbjct: 28  AEENSDEIIEPNLLYGIPADNYRLEQQIIDRGETLGQILNRYGVSAAQIDQLDKASKDVF 87

Query: 313 RVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINH 372
            +  +         + +       + + +Y +      +       + L  + + +    
Sbjct: 88  PLRNIRAGRSYTAFIHEDSLNAPHLDYLVYEQSISQYVV-------FSLADDSISVTKGE 140

Query: 373 QMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFS 432
           +   +R  +++  I   +W A    GM ++L   +     S+++    ++  D     + 
Sbjct: 141 KEYEIRRQKKTATIDSSLWEAIVGAGMPASLAAEMEDIYQSTISF-FSIQKGDNFTVIYD 199

Query: 433 VNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPF 492
             + +   +    +      +G        F       + Y++++G S R  +L TP+ +
Sbjct: 200 ERYIDTLPAGIGRIWGAKFNYGGKTYYAIPFR--QGNKIAYWDQDGNSLRKLMLITPLKY 257

Query: 493 GRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHH 551
            R++S F     HPI    R HTGVD+AAP+GTP+ AV DG V    W GG G    I H
Sbjct: 258 TRISSRFTYSRLHPIYKTYRAHTGVDFAAPKGTPVHAVADGTVIFKGWGGGGGNTLKIKH 317

Query: 552 GNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKV 611
            NG+++ Y H    AK I+ G+ V QGQ+IG++G+TG STGPHL Y +  NG  +D  K+
Sbjct: 318 NNGFMTGYLHLSGYAKGIRQGSRVSQGQLIGYVGSTGASTGPHLDYRVWRNGKPIDPLKI 377

Query: 612 RIPERENLKGDLLQRFAMEKKRINSLLN 639
                E +       +   + RI + L+
Sbjct: 378 PQEPGEPIHKANRAAYEYVRDRIMAELD 405


>gi|54288342|gb|AAV31630.1| predicted membrane proteins related to metalloendopeptidases
           [uncultured alpha proteobacterium EBAC2C11]
          Length = 478

 Score =  321 bits (822), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 98/451 (21%), Positives = 191/451 (42%), Gaps = 27/451 (5%)

Query: 187 QKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPI 246
            +     + T++  +     + +         +L  ++  +   Y  +P +++     P 
Sbjct: 32  AETPISGESTQVAQNTFGPMQPVLRTQP----VLPTRRPDTALAYPNNPVSINLPVPKPE 87

Query: 247 TYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAK 306
               +        T++        +    +  + ++    I   +   GY +        
Sbjct: 88  ---LEDVFPISTATVSEMIRRQTGLNAVDEVQLSLRAGEGIGALLRRGGYDSKKITAAVN 144

Query: 307 ALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPV 366
           A+  +  + +L      +I            RF     +   +    +     +  + P+
Sbjct: 145 AIAGKASLRRLQIGTKFQIT-------DKGFRFIAKPGRDLYVIQHPDSGWLALTALRPI 197

Query: 367 KMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDF 426
              +         S     +   I+++    G++ +     +R +  SV+ Q  ++  D 
Sbjct: 198 DRYV---------SFFQGAVEGSIYKSAMAAGVSESAYTEYVRVMGFSVDFQREIRTGDR 248

Query: 427 LETFFSVNHA--NNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPF 484
            E  +       + Q      L Y      +    F+R+ +  D  V ++++ G S+   
Sbjct: 249 FELLYETERDGIDGQRIG-GRLHYAGLVLSDRSLGFFRY-DEADDVVGWYDQEGNSAART 306

Query: 485 LLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYG 544
           L+RTP+   R++S FG R HP+ G++ MH GVD+AAP GTPI+A G G++ ++ W G +G
Sbjct: 307 LIRTPITGARLSSSFGKRKHPVSGFNAMHKGVDFAAPLGTPIIAAGSGVIRESGWKGSFG 366

Query: 545 KQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGI 604
           +   I H   Y ++Y H  +IA  I+ G  VKQG++IG++G+TG STG HLHYE++VN  
Sbjct: 367 RYIRIKHNATYDTAYAHMKSIAPQIRVGKYVKQGEVIGFVGSTGRSTGAHLHYEIMVNNR 426

Query: 605 KVDSTKVRIPERENLKGDLLQRFAMEKKRIN 635
           +V+   V +P  E +    L+ F     +I+
Sbjct: 427 QVNPMTVSLPTGERIDIQHLEAFKKTVAKID 457


>gi|297172519|gb|ADI23490.1| membrane proteins related to metalloendopeptidases [uncultured
           gamma proteobacterium HF0770_40P16]
          Length = 378

 Score =  321 bits (822), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 86/365 (23%), Positives = 161/365 (44%), Gaps = 14/365 (3%)

Query: 280 PIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRF 339
            I++N ++F  +   G    +  +I  +  + + + ++  D+ +++ + Q ++  ++   
Sbjct: 24  VIKNNDSLFLILKRLGIHENNIFQIINSENSRL-LSKIKVDKKIKLSINQNNEIVSLN-- 80

Query: 340 SIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGM 399
             Y K       A      Y       ++             +   I + ++      G+
Sbjct: 81  --YIKDFKSGVQAEKKEGTY-------QIKEYQLKTEKFKVFKKVKINNSLYVDGLKQGL 131

Query: 400 NSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTR 459
             +++  ++      ++    ++  D     +     N +   D ++L         +  
Sbjct: 132 PDSVIMDLVYIFGWDIDFSLDIRQGDSYSLIYEEVFVNGEKVIDGDILIAEFSNLGKKHV 191

Query: 460 FYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDW 518
             R+      S EYF+ NG++ +   LR+P+ F  ++S + ++  HPI    + HTGVD+
Sbjct: 192 AIRYKLKSGDS-EYFSPNGRNVKKAFLRSPLKFNYISSKYNLKRKHPIFHQIKAHTGVDY 250

Query: 519 AAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQG 578
           AA RGTP+ A GDG +  ++  GGYG    I H   Y + Y H D I   I     ++Q 
Sbjct: 251 AAGRGTPVRATGDGTIVHSSVKGGYGNLVEIKHTEDYSTRYAHLDRINPRITLDKKIRQA 310

Query: 579 QIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLL 638
            IIG++G TG +TG HLHYE  VNG   +  KVR+P  + +K    + +    KRI   L
Sbjct: 311 DIIGYVGRTGTATGYHLHYEFRVNGKHTNPLKVRLPNAKPIKSSEKENYDFHSKRIIDEL 370

Query: 639 NNGEN 643
            N ++
Sbjct: 371 KNYQS 375


>gi|258622185|ref|ZP_05717211.1| conserved hypothetical protein [Vibrio mimicus VM573]
 gi|258585509|gb|EEW10232.1| conserved hypothetical protein [Vibrio mimicus VM573]
          Length = 433

 Score =  321 bits (822), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 94/442 (21%), Positives = 166/442 (37%), Gaps = 25/442 (5%)

Query: 210 KNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITY------SKKIKIIEENRTITS 263
           K+ I+    L   KK     L       +    + P           +   +  + T  +
Sbjct: 4   KSIILRFSELSTRKKVTLVGLPLLAVAAISTSLNSPTRQHRIELSLPEASFVPFSNTEGA 63

Query: 264 PQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEIL 323
            +          D    I+    +       G++  +  K+ +   N + +D L    +L
Sbjct: 64  TEQTEVIKAGHPDYEYEIKPGDNLSTIFSQLGFAYTELMKVMETDLNYLALDTLRPGNVL 123

Query: 324 RIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEES 383
           R    + +   T+ R  +             D+  Y       + +        +     
Sbjct: 124 RFWKGKDN---TLSRMELEFSLVDRAVYTRLDDGSY-------EFEERKIPGTWKVEPLI 173

Query: 384 PNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDD 443
             +      + +  G+ +  V  I+  L   +N    L+  D  E   S     ++ + +
Sbjct: 174 GEVDGSFSLSANRAGLGAADVDQIVTLLKDKINFGRDLRRGDRFEVVLSRQFVGDKLTGN 233

Query: 444 SELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGR-MTSGFGMR 502
           SE+  I           Y   +       Y+++NG S +    R PV     ++S F  +
Sbjct: 234 SEIQAIKIFNRGKEITAYLHQDGQ-----YYDKNGDSLQRAFQRYPVDSKWRISSNFDPK 288

Query: 503 Y-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNH 561
             HP+      H G D+A P GTP+ + GDG+V         G   ++ HG+ Y++ Y H
Sbjct: 289 RLHPVTKRVAPHNGTDFAMPIGTPVYSSGDGVVVMTRSHPYAGNYVVVQHGSTYMTRYLH 348

Query: 562 QDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKG 621
              I   +K G  V +GQ IG  G TG  TGPHLHYELIV G  V++ K  IP   ++  
Sbjct: 349 LSKIL--VKKGQKVSRGQRIGSSGNTGRVTGPHLHYELIVRGRAVNAMKANIPMASSVPK 406

Query: 622 DLLQRFAMEKKRINSLLNNGEN 643
             + +F  ++K +  +L + E+
Sbjct: 407 KEMAQFVAKRKELEQMLAHQES 428


>gi|304321419|ref|YP_003855062.1| M23/M37 peptidase [Parvularcula bermudensis HTCC2503]
 gi|303300321|gb|ADM09920.1| M23/M37 peptidase [Parvularcula bermudensis HTCC2503]
          Length = 562

 Score =  321 bits (822), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 109/523 (20%), Positives = 198/523 (37%), Gaps = 49/523 (9%)

Query: 135 AYARMTFATPYPKVKDHPKFDP----LKIFSEGKIESSSQMLMDTIHNVDSFEVTTQKIN 190
           A   +   +P  +    P+  P    L   +      S  + + T  +V +     + + 
Sbjct: 58  AQLSLDLTSPLWEWGAAPRVRPDPVRLTFGASRDAAVSPSLALSTERSVPAPGPILEPVV 117

Query: 191 FPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSK 250
            P      + D     + I                ++  L  +D        D   T  +
Sbjct: 118 RPRLKPIYRGDDIPVVKAIDR--------------RAAQLAPSDVLAFASGDD--FTGGR 161

Query: 251 KIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKN 310
           +    +        Q   ++  E     + +    T+   +   G    D   +  A+  
Sbjct: 162 EALFAQ------YQQDKAEERRERGYMTLALNRGETLSQTLESLGGDPDDIDALLTAVAE 215

Query: 311 EVRVDQLTKDEILRIGVVQ-------------KDDKFTIVRFSIYHKQKHLLTIALNDNN 357
                ++     +   +                     + R        HL+T     + 
Sbjct: 216 VADPKRIEAGTAIDYALEPVLRQGLDAQPQTAPIYDVKLTRLRWRPDDNHLVTAWRRSDG 275

Query: 358 EYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNL 417
            Y    E +           R +  +  I   ++ A S   + + +++         V+ 
Sbjct: 276 SYTARHEKIDFAR-------RYAAAAGVISHSLFTAGSRASVPNEVMQRFANLYLYDVDF 328

Query: 418 QEHLKPTDFLETFFSVNHAN-NQASDDSELLYIHARFGETR--TRFYRFLNPVDGSVEYF 474
              +   D  E  + V + +  Q     E+++    +        FYRF    D  + Y+
Sbjct: 329 ARDIYRGDRFEVVYEVFYDDHGQYVGSGEIVFAAMTWRGGSGQRAFYRFEAAGDEDLPYY 388

Query: 475 NENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIV 534
           +  G+S    L++TP+   R+TS FG R HP+LGY++ H GVD+ AP GTPI+A GDG++
Sbjct: 389 DSKGESGARLLMKTPIEGARVTSSFGRRRHPVLGYTKTHKGVDFGAPSGTPIMAAGDGVI 448

Query: 535 EKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPH 594
           E+A   G +G    I H  G+ ++Y H       IK G  V+QG IIG++GTTG STGPH
Sbjct: 449 ERAAMTGSFGNYVKIKHQKGFATAYAHLKGYGPGIKTGARVRQGDIIGYVGTTGRSTGPH 508

Query: 595 LHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSL 637
           LHYE++ +G   +   +++ E   L+  L   F   +  ++++
Sbjct: 509 LHYEVLKDGQVQNPMTLKVTEGRRLEAALQGDFDKRRDFVDTI 551


>gi|213964073|ref|ZP_03392315.1| peptidase M23B [Capnocytophaga sputigena Capno]
 gi|213953299|gb|EEB64639.1| peptidase M23B [Capnocytophaga sputigena Capno]
          Length = 409

 Score =  321 bits (822), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 79/374 (21%), Positives = 152/374 (40%), Gaps = 15/374 (4%)

Query: 272 PEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKD 331
            ++      ++   T    +        +   IA+  K  +                +K 
Sbjct: 49  NDYNIVRDTLKQGDTFGKLLEDQHIGATEIHHIAETTKELISPKNFRVGHPYAFLYDKKH 108

Query: 332 DKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIW 391
              T   F       + + + L D+         +      +   ++       I + + 
Sbjct: 109 -PDTPHSFVYQPDIVNYIVVRLTDS---------IHAYNAERKVSIKEKAIGGEIENNLT 158

Query: 392 RATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQA-SDDSELLYIH 450
                 G++ N    + +    +++    L+  D  +  +   + ++   +   ++   +
Sbjct: 159 VDAQNAGISQNATYQLGQIFDYTIDFFR-LQKGDKFKIIYDERYVDDTIYAGVEKVKAAY 217

Query: 451 ARFGETRTRFYRFLNPV-DGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGY 509
             +G      + F      G+  Y++ENG   +   L++P+   R+TS FGMR+HP+L  
Sbjct: 218 FEWGGKAYYAFNFTTDSIKGTSGYYDENGNMMKRMFLKSPLDIFRITSKFGMRFHPVLHR 277

Query: 510 SRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNI 569
            + H G D+AAP GTPI     G V +A ++ G G    + H N Y + Y H   I    
Sbjct: 278 MKGHFGTDYAAPTGTPIRVTAAGTVIEAGYSSGNGNYVKVRHNNTYTTQYLHMSKILA-- 335

Query: 570 KAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAM 629
           + G  V QG++IG +G+TGL+TGPH+ Y    NG++VD  K ++P+   ++  L  ++  
Sbjct: 336 RKGKYVAQGEVIGLVGSTGLATGPHVCYRFWKNGVQVDPLKEKMPDSVPIEASLKAKYLE 395

Query: 630 EKKRINSLLNNGEN 643
             K +   L+   N
Sbjct: 396 FIKPLKEQLDKLGN 409


>gi|229514587|ref|ZP_04404048.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae TMA 21]
 gi|229348567|gb|EEO13525.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae TMA 21]
          Length = 423

 Score =  320 bits (821), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 95/438 (21%), Positives = 166/438 (37%), Gaps = 28/438 (6%)

Query: 214 MNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITY------SKKIKIIEENRTITSPQVL 267
           M    L   KK     L       +    + P           +  +++ +    + +V+
Sbjct: 1   MRFSELSMRKKATLVGLPLLAVAAISSSLNSPTRQQRIELSLPESPLVQFSSAEHTVEVV 60

Query: 268 IDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGV 327
               P++  +   I+    +       G++  +  K+ +   N + +D L    +LR   
Sbjct: 61  KVGHPDYEYE---IKPGDNLSTIFNQLGFAYTELMKVMETDLNYLALDTLRPGNVLRFW- 116

Query: 328 VQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIY 387
             K    T+ +  +             ++  Y       + +        +       + 
Sbjct: 117 --KGSDNTLAKMELEFSLVDRAVYTRLNDGSY-------EFEERKIPGTWKVEPLIGEVD 167

Query: 388 DGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELL 447
                + +  G+ +  V  I+  L   +N    L+  D  E   S      + + +SE+ 
Sbjct: 168 GSFSLSANRAGLGAADVDQIVTLLKDKINFGRDLRRGDRFEVVLSRQFVGEKLTGNSEIQ 227

Query: 448 YIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGR-MTSGFGMRY-HP 505
            I           Y   +       Y+++NG S +    R PV     ++S F  R  HP
Sbjct: 228 AIKIFNRGKEITAYLHQDGQ-----YYDKNGDSLQRAFQRYPVDSKWRISSNFDPRRLHP 282

Query: 506 ILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAI 565
           +      H G D+A P GTP+   GDG+V         G   +I HGN Y++ Y H   I
Sbjct: 283 VTKRVAPHNGTDFAMPIGTPVYTSGDGVVVMTRNHPYAGNYVVIQHGNTYMTRYLHLSKI 342

Query: 566 AKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQ 625
              +K G  V +GQ IG  G TG  TGPHLHYELIV G  V++ K  IP   ++    + 
Sbjct: 343 L--VKKGQKVSRGQRIGLSGNTGRVTGPHLHYELIVRGRPVNAMKANIPMASSVPKKEMA 400

Query: 626 RFAMEKKRINSLLNNGEN 643
           +F  ++K ++ +L   E+
Sbjct: 401 QFIAKRKELDQMLARQES 418


>gi|254291233|ref|ZP_04962028.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
 gi|150422797|gb|EDN14749.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
          Length = 362

 Score =  320 bits (821), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 84/379 (22%), Positives = 157/379 (41%), Gaps = 22/379 (5%)

Query: 276 DDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVR-VDQLTKDEILRIGVVQKDDKF 334
            +   + +  +       AG S+    ++  +  +    + +L   + L+ G  + +   
Sbjct: 4   WETYQVANGESAALLFQRAGLSSRVLYELTSSNSDINNQLSKLMPKDELKFGFDKDNQLV 63

Query: 335 TIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRAT 394
            + R            +  +D+            + + +    + +     I    W A 
Sbjct: 64  QLKRTI---SPYETFVVTRSDSG--------FTSEFDKKEVTFQLNYAEAKITSNFWNAG 112

Query: 395 SFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFG 454
              G+++N +  +       ++    ++  D  +  +              ++       
Sbjct: 113 VAAGLSANQIIELANMFGWDIDFALDIREGDQFKLLYQEKIVEGSVIGRGNIIAATFINQ 172

Query: 455 ETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMH 513
            +           D +  Y+++NG++ +   LR+P+ F R++S F  R  HP+ G  + H
Sbjct: 173 GSTFTAIL----DDNTGNYYDQNGRAMKKAFLRSPLDFRRVSSNFNPRRLHPVTGQIKAH 228

Query: 514 TGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGT 573
            G D+ AP GTPI A GDG+VEK+++    G    I H N Y++ Y H     + +K G 
Sbjct: 229 RGTDYVAPVGTPIWAAGDGVVEKSSYNQFNGNYVYIRHSNTYITKYLHLQR--RLVKTGE 286

Query: 574 AVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKR 633
            VKQGQ IG +G TG  TGPHLHYE +VNGI  +   V +P+ ++L G   + F    K+
Sbjct: 287 RVKQGQTIGTLGGTGRVTGPHLHYEFLVNGIHKNPRTVELPQAQSLTGKAKETFIANAKQ 346

Query: 634 INSLLNNGENPKKPLFTSH 652
               +   E   + L+ + 
Sbjct: 347 ---RMEKLERYSQLLYANQ 362


>gi|254225852|ref|ZP_04919455.1| conserved hypothetical protein [Vibrio cholerae V51]
 gi|125621579|gb|EAZ49910.1| conserved hypothetical protein [Vibrio cholerae V51]
          Length = 430

 Score =  320 bits (821), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 96/442 (21%), Positives = 169/442 (38%), Gaps = 28/442 (6%)

Query: 210 KNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITY------SKKIKIIEENRTITS 263
           K+ I+    L   KK     L       +    + P           +  +++ +    +
Sbjct: 4   KSIILRFSELSMRKKVTLVGLPLLAVAAISSSLNSPTRQQRIELSLPESPLVQFSSAEHT 63

Query: 264 PQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEIL 323
            +V+    P++  +   I+    +       G++  +  K+ +   N + +D L    +L
Sbjct: 64  VEVVKVGHPDYEYE---IKPGDNLSTIFNQLGFAYTELMKVMETDLNYLALDTLRPGNVL 120

Query: 324 RIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEES 383
           R     K    T+ +  +             ++  Y       + +        +     
Sbjct: 121 RFW---KGSDNTLAKMELEFSLVDRAVYTRLNDGSY-------EFEERKIPGTWKVEPLI 170

Query: 384 PNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDD 443
             +      + +  G+ +  V  I+  L   +N    L+  D  E   S      + + +
Sbjct: 171 GEVDGSFSLSANRAGLGAADVDQIVTLLKDKINFGRDLRRGDRFEVVLSRQLVGEKLTGN 230

Query: 444 SELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGR-MTSGFGMR 502
           SE+  I           Y   +       Y+++NG S +    R PV     ++S F  R
Sbjct: 231 SEIQAIKIFNRGKEITAYLHQDGQ-----YYDKNGDSLQRAFQRYPVDSKWRISSNFDPR 285

Query: 503 Y-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNH 561
             HP+      H G D+A P GTP+   GDG+V         G   +I HGN Y++ Y H
Sbjct: 286 RLHPVTKRVAPHNGTDFAMPIGTPVYTSGDGVVVMTRNHPYAGNYVVIQHGNTYMTRYLH 345

Query: 562 QDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKG 621
              I   +K G  V +GQ IG  G TG  TGPHLHYELIV G  V++ K  IP   ++  
Sbjct: 346 LSKIL--VKKGQKVSRGQRIGLSGNTGRVTGPHLHYELIVRGRPVNAMKANIPMASSVPK 403

Query: 622 DLLQRFAMEKKRINSLLNNGEN 643
             + +F  ++K ++ +L   E+
Sbjct: 404 KEMAQFIAKRKELDQMLARQES 425


>gi|229527935|ref|ZP_04417326.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae 12129(1)]
 gi|229334297|gb|EEN99782.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae 12129(1)]
          Length = 423

 Score =  320 bits (820), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 95/438 (21%), Positives = 166/438 (37%), Gaps = 28/438 (6%)

Query: 214 MNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITY------SKKIKIIEENRTITSPQVL 267
           M    L   KK     L       +    + P           +  +++ +    + +V+
Sbjct: 1   MRFSELSMRKKATLVGLPLLAVAAISSSLNSPTRQQRIELSLPESPLVQFSSAEHTVEVV 60

Query: 268 IDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGV 327
               P++  +   I+    +       G++  +  K+ +   N + +D L    +LR   
Sbjct: 61  KVGHPDYEYE---IKPGDNLSTIFNQLGFAYTELMKVMETDLNYLALDTLRPGNVLRFW- 116

Query: 328 VQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIY 387
             K    T+ +  +             ++  Y       + +        +       + 
Sbjct: 117 --KGSDNTLAKMELEFSLVDRAVYTRLNDGSY-------EFEERKIPGTWKVEPLIGEVD 167

Query: 388 DGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELL 447
                + +  G+ +  V  I+  L   +N    L+  D  E   S      + + +SE+ 
Sbjct: 168 GSFSLSANRAGLGAADVDQIVTLLKDKINFGRDLRRGDRFEVVLSRQFVGEKLTGNSEIQ 227

Query: 448 YIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGR-MTSGFGMRY-HP 505
            I           Y   +       Y+++NG S +    R PV     ++S F  R  HP
Sbjct: 228 AIKIFNRGKEITAYLHQDGQ-----YYDKNGDSLQRAFQRYPVDSKWRISSNFDPRRLHP 282

Query: 506 ILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAI 565
           +      H G D+A P GTP+   GDG+V         G   +I HGN Y++ Y H   I
Sbjct: 283 VTKRVAPHNGTDFAMPIGTPVYTSGDGVVVMTRNHPYAGNYVVIQHGNTYMTRYLHLSKI 342

Query: 566 AKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQ 625
              +K G  V +GQ IG  G TG  TGPHLHYELIV G  V++ K  IP   ++    + 
Sbjct: 343 L--VKKGQKVSRGQRIGLSGNTGRVTGPHLHYELIVRGRPVNAMKANIPMASSVPKKEMA 400

Query: 626 RFAMEKKRINSLLNNGEN 643
           +F  ++K ++ +L   E+
Sbjct: 401 QFIAKRKELDQMLARQES 418


>gi|258624251|ref|ZP_05719200.1| conserved hypothetical protein [Vibrio mimicus VM603]
 gi|258583402|gb|EEW08202.1| conserved hypothetical protein [Vibrio mimicus VM603]
          Length = 433

 Score =  320 bits (820), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 93/442 (21%), Positives = 165/442 (37%), Gaps = 25/442 (5%)

Query: 210 KNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITY------SKKIKIIEENRTITS 263
           K+ I+    L   KK     L       +    + P           +   +  + T  +
Sbjct: 4   KSIILRFSELSTRKKVTLVGLPLLAVAAISTSLNSPTRQHRIELSLPEASFVPFSNTEGA 63

Query: 264 PQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEIL 323
            +          D    I+    +       G++  +  K+ +   N + +D L    +L
Sbjct: 64  TEQTEVIKAGHPDYEYEIKPGDNLSTIFSQLGFAYTELMKVMETDLNYLALDTLRPGNVL 123

Query: 324 RIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEES 383
           R    + +   T+ +  +             D+  Y       + +        +     
Sbjct: 124 RFWKGKDN---TLSKMELEFSLVDRAVYTRLDDGSY-------EFEERKIPGTWKVEPLI 173

Query: 384 PNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDD 443
             +      + +  G+ +  V  I+  L   +N    L+  D  E   S     ++ + +
Sbjct: 174 GEVDGSFSLSANRAGLGAADVDQIVTLLKDKINFGRDLRRGDRFEVVLSRQFVGDKLTGN 233

Query: 444 SELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGR-MTSGFGMR 502
           SE+  I           Y   +       Y+++NG S +    R PV     ++S F  +
Sbjct: 234 SEIQAIKIFNRGKEITAYLHQDGQ-----YYDKNGDSLQRAFQRYPVDSKWRISSNFDPK 288

Query: 503 Y-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNH 561
             HP+      H G D+A P GTP+ + GDG+V         G   ++ HG+ Y++ Y H
Sbjct: 289 RLHPVTKRVAPHNGTDFAMPIGTPVYSSGDGVVVMTRSHPYAGNYVVVQHGSTYMTRYLH 348

Query: 562 QDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKG 621
              I   +K G  V +GQ IG  G TG  TGPHLHYELIV G  V++ K  IP   ++  
Sbjct: 349 LSKIL--VKKGQKVSRGQRIGSSGNTGRVTGPHLHYELIVRGRAVNAMKANIPMASSVPK 406

Query: 622 DLLQRFAMEKKRINSLLNNGEN 643
             + +F  ++K +  +L   E+
Sbjct: 407 KEMAQFVAKRKELEQMLAQQES 428


>gi|21233265|ref|NP_639182.1| hypothetical protein XCC3842 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66770223|ref|YP_244985.1| hypothetical protein XC_3926 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|21115101|gb|AAM43073.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66575555|gb|AAY50965.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 472

 Score =  320 bits (820), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 91/374 (24%), Positives = 155/374 (41%), Gaps = 14/374 (3%)

Query: 271 IPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQK 330
            P    +++ ++   T+       G       ++      +  + +L     +   +   
Sbjct: 96  GPGTDWEILKVKSGQTLSTLFGELGIPTTVMYQVLAHPGTKEALTKLRPGTEIAFDMPTP 155

Query: 331 DDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGI 390
            +   +          H + + L          + V+ ++  +    RT   S  I   +
Sbjct: 156 GE---LRALRFDRDDSHRVELRL--------LGDSVRENVTERATSTRTVVASGEITSSL 204

Query: 391 WRATSFNGMNSNLVKLIMR-TLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYI 449
           + + S +G++   V ++        ++  + L+P D             +     ++L  
Sbjct: 205 YASASKSGLSPAAVAVMTDDIFKYDIDFDKDLQPGDRFSVVMDETWREGERISTGDILAA 264

Query: 450 HARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGY 509
               G      +RF        EYF+  G+  +   +R PV + R++S FG R HP+LG 
Sbjct: 265 TFTTGGKTYTGFRFE-RAGKPAEYFDITGRPLKKSFIRMPVAYSRISSTFGARKHPVLGT 323

Query: 510 SRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNI 569
            RMH GVD+AA  GTPI+A GD  V       GYG   ++ HG  Y + Y H     K +
Sbjct: 324 MRMHKGVDYAAASGTPIMAAGDARVVFVGTQRGYGNVVILDHGKNYSTLYGHMSRFGK-V 382

Query: 570 KAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAM 629
           KAG  + QG +IG++G TGL+TGPHLHYE  V G + +   V +P  E L+G  L  F  
Sbjct: 383 KAGQRINQGTVIGYVGMTGLATGPHLHYEFRVGGQQRNPMSVTMPPPEPLQGAELAAFRA 442

Query: 630 EKKRINSLLNNGEN 643
           +     + +   E 
Sbjct: 443 QTAPAMARIEGMEK 456


>gi|121728274|ref|ZP_01681306.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|121629468|gb|EAX61895.1| conserved hypothetical protein [Vibrio cholerae V52]
          Length = 368

 Score =  320 bits (820), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 84/387 (21%), Positives = 157/387 (40%), Gaps = 22/387 (5%)

Query: 268 IDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVR-VDQLTKDEILRIG 326
                    +   + +  +       AG S+    ++  +  +    + +L   + L+ G
Sbjct: 2   APPSVMLRWETYQVANGESAALLFQRAGLSSRVLYELTSSNSDINNQLSKLMPKDELKFG 61

Query: 327 VVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNI 386
             + +    + R            +  +D+            + + +    + +     I
Sbjct: 62  FDKDNQLVQLKRTI---SPYETFVVTRSDSG--------FTSEFDKKEVTFQLNYAEAKI 110

Query: 387 YDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSEL 446
               W A    G+++N +  +       ++    ++  D  +  +              +
Sbjct: 111 TSNFWNAGVTAGLSANQIIELANMFGWDIDFALDIREGDQFKLLYQEKIVEGSVIGRGNI 170

Query: 447 LYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HP 505
           +        +           D +  Y+++NG++ +   LR+P+ F R++S F  R  HP
Sbjct: 171 IAATFINQGSTFTAIL----DDNTGNYYDQNGRAMKKAFLRSPLDFRRVSSNFNPRRLHP 226

Query: 506 ILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAI 565
           + G  + H G D+ AP GTPI A GDG+VEK+++    G    I H N Y++ Y H    
Sbjct: 227 VTGQIKAHRGTDYVAPVGTPIWAAGDGVVEKSSYNQFNGNYVYIRHSNTYITKYLHLQR- 285

Query: 566 AKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQ 625
            + +K G  VKQGQ IG +G TG  TGPHLHYE +VNGI  +   V +P+ ++L G   +
Sbjct: 286 -RLVKTGERVKQGQTIGTLGGTGRVTGPHLHYEFLVNGIHKNPRTVELPQAQSLTGKAKE 344

Query: 626 RFAMEKKRINSLLNNGENPKKPLFTSH 652
            F    K+    +   E   + L+ + 
Sbjct: 345 TFIANAKQ---RMEKLERYSQLLYANQ 368


>gi|188993421|ref|YP_001905431.1| membrane-anchored metalloprotease [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167735181|emb|CAP53393.1| membrane-anchored metalloprotease [Xanthomonas campestris pv.
           campestris]
          Length = 478

 Score =  320 bits (820), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 91/374 (24%), Positives = 155/374 (41%), Gaps = 14/374 (3%)

Query: 271 IPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQK 330
            P    +++ ++   T+       G       ++      +  + +L     +   +   
Sbjct: 96  GPGTDWEILKVKSGQTLSTLFGELGIPTTVMYQVLAHPGTKEALTKLRPGTEIAFDMPTP 155

Query: 331 DDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGI 390
            +   +          H + + L          + V+ ++  +    RT   S  I   +
Sbjct: 156 GE---LRALRFDRDDSHRVELRL--------LGDSVRENVTERATSTRTVVASGEITSSL 204

Query: 391 WRATSFNGMNSNLVKLIMR-TLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYI 449
           + + S +G++   V ++        ++  + L+P D             +     ++L  
Sbjct: 205 YASASKSGLSPAAVAVMTDDIFKYDIDFDKDLQPGDRFSVVMDETWREGERISTGDILAA 264

Query: 450 HARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGY 509
               G      +RF        EYF+  G+  +   +R PV + R++S FG R HP+LG 
Sbjct: 265 TFITGGKTYTGFRFE-RAGKPAEYFDITGRPLKKSFIRMPVAYSRISSTFGARKHPVLGT 323

Query: 510 SRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNI 569
            RMH GVD+AA  GTPI+A GD  V       GYG   ++ HG  Y + Y H     K +
Sbjct: 324 MRMHKGVDYAAASGTPIMAAGDARVVFVGTQRGYGNVVILDHGKNYSTLYGHMSRFGK-V 382

Query: 570 KAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAM 629
           KAG  + QG +IG++G TGL+TGPHLHYE  V G + +   V +P  E L+G  L  F  
Sbjct: 383 KAGQRINQGTVIGYVGMTGLATGPHLHYEFRVGGQQRNPMSVTMPPPEPLQGAELAAFRA 442

Query: 630 EKKRINSLLNNGEN 643
           +     + +   E 
Sbjct: 443 QTAPAMARIEGMEK 456


>gi|317486109|ref|ZP_07944956.1| peptidase family M23 [Bilophila wadsworthia 3_1_6]
 gi|316922632|gb|EFV43871.1| peptidase family M23 [Bilophila wadsworthia 3_1_6]
          Length = 447

 Score =  320 bits (819), Expect = 5e-85,   Method: Composition-based stats.
 Identities = 100/461 (21%), Positives = 176/461 (38%), Gaps = 24/461 (5%)

Query: 184 VTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHD 243
           V +++           +  ++  + +++ +    F L  +   +  +   +P        
Sbjct: 4   VNSRREASLLIPESQPVAVSSVAQRLQDQVTPSLFALWERAKSAVAVLPEEP-------P 56

Query: 244 HPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAK 303
                  +  I+ E + +    +  +   + +     I    +  + +     S     +
Sbjct: 57  AQEMPEGEAAIVSEMQQVP---LEQEPPSDPSVINGVIAKGDSASELLSPY-MSASSVQQ 112

Query: 304 IAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGV 363
           +    +    ++ L   +   +            RF      +  L +   D    V  V
Sbjct: 113 LLNVTRKLHPLNNLRTGQPYTLVCSPDGRDME--RFEYEINDRKKLIVTKTDEG-LVAHV 169

Query: 364 EPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKP 423
           EP+  D +           S  I   ++   +  G +  L   I     S +N  + L+ 
Sbjct: 170 EPIVYDFSLVRV-------SGTIRSSLFETLASTGESPILAVRIADIFGSEINFIKDLRE 222

Query: 424 TDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRP 483
            D            N+     ++L             Y F         +FN  G+S + 
Sbjct: 223 GDSFSLLIEKRFRENEFKGYGKVLGATFTNQGKTYEAYNFATEDG--EAFFNAKGESLKK 280

Query: 484 FLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGG 542
            LL+ P+ F R++SG+ M   HPI    + H GVD+AAP GTP+ AVGDG +EKA W  G
Sbjct: 281 TLLKAPLAFTRISSGYSMNRKHPIFKTHKPHQGVDYAAPTGTPVKAVGDGTIEKAGWGNG 340

Query: 543 YGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVN 602
           +G   ++ H  G  S Y+H    A   K G  V+QGQ+IG++G TG +TGPHL + L  N
Sbjct: 341 FGNMVILKHSGGLESMYSHLSGFASGAKRGARVRQGQVIGYVGATGYATGPHLDFRLKQN 400

Query: 603 GIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGEN 643
           G  V+  KV  P   ++  + +  F   K  I   L+   +
Sbjct: 401 GKYVNPAKVVAPRGGSIPRNRMNDFKNRKALIGEYLSGKRS 441


>gi|194334779|ref|YP_002016639.1| peptidase M23 [Prosthecochloris aestuarii DSM 271]
 gi|194312597|gb|ACF46992.1| Peptidase M23 [Prosthecochloris aestuarii DSM 271]
          Length = 460

 Score =  320 bits (819), Expect = 5e-85,   Method: Composition-based stats.
 Identities = 95/413 (23%), Positives = 168/413 (40%), Gaps = 17/413 (4%)

Query: 232 YADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAM 291
              P          + Y  ++ I EE+  +   Q  + +     ++   IQ   +++  +
Sbjct: 43  SITPAAEKLYSSIFVNYDDELGITEESAVVEIEQGEVPEKNSIVEN--KIQRGESLYILL 100

Query: 292 VHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTI 351
              G S  +  ++++ LK +  +  L   +  R+    ++     + FS+       L +
Sbjct: 101 TANGLSPAEVNEVSQQLKGKFSIKSLRPGQSYRVEKDPEN---RFLSFSLQQSLISTLHL 157

Query: 352 ALN-DNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRT 410
             N ++  + +  E ++ D        R +  +  I   +      N    +L+  +   
Sbjct: 158 EKNLESGTFHVWQEIMEYD-------TRLASLTGTIESNLSLELQKNKR-YSLIGQLQNL 209

Query: 411 LASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGS 470
            AS +N +  + P    +  +  N      ++   ++     F       YR+ +     
Sbjct: 210 FASKINFRRDIHPGTTYKILYEENWLGEDYANSGNIMAAEISFNGNTYTAYRYTDAQG-K 268

Query: 471 VEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVG 530
             Y++ENG+S   F L  P  + R++S FG R HPILG    H G+D AAP GTP+ AV 
Sbjct: 269 TGYYDENGRSLNSFFLAKPCNYSRISSSFGYRRHPILGRKHFHGGIDLAAPTGTPVYAVA 328

Query: 531 DGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLS 590
           DG +      G  G    I+H NGY + Y H    +     G+ V QG IIG++G+TG S
Sbjct: 329 DGKIVYRGRKGAAGNMITINHSNGYYTKYLHLSRFSSKHPYGSKVHQGDIIGYVGSTGRS 388

Query: 591 TGPHLHYELIVNGIKVDSTKV--RIPERENLKGDLLQRFAMEKKRINSLLNNG 641
           TGPHL + +I NG   +             +    +Q F  +     + LN  
Sbjct: 389 TGPHLDFRVIKNGKLQNPLTALKSSSSTRGVSKAEMQNFMAQLSVFRAQLNES 441


>gi|315182363|gb|ADT89276.1| hypothetical metalloprotease [Vibrio furnissii NCTC 11218]
          Length = 409

 Score =  320 bits (819), Expect = 5e-85,   Method: Composition-based stats.
 Identities = 91/406 (22%), Positives = 159/406 (39%), Gaps = 18/406 (4%)

Query: 239 DQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSN 298
               +       ++ I E +   +      +    + D    I+    +       G+S 
Sbjct: 6   SSLSNPSYPRKIELSIPESHIVESILSETTEPRQSYPDYEYEIKSGDNLSTIFNQLGFSY 65

Query: 299 GDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNE 358
            +  KI +   N + +D L    +LR    +  D  ++ +  +             D+  
Sbjct: 66  QELMKIMETDLNYLALDTLKPGNVLRFW--RSQDGRSLAKMELKFSLVERAVYVRTDDGS 123

Query: 359 YVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQ 418
           +       +          +       I     ++ +  G+ S+ +  I+  L   +N  
Sbjct: 124 F-------EFKDVKIPGTWKEYPLIGEIQGSFSQSANQLGLGSSDIDQIVTLLKDKINFV 176

Query: 419 EHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENG 478
             ++  D  E   S     +Q + +SE+  I           Y + +       Y+++NG
Sbjct: 177 RDVRAGDRFEVVLSRQFVGDQLTGNSEIQAIKIFSRSNDVTAYLYKDGQ-----YYDKNG 231

Query: 479 KSSRPFLLRTPVPFGR-MTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEK 536
           +S +    R P      ++SGF     HP+ G    H G D+AAP GTP+V+ GDG+V  
Sbjct: 232 ESLQRAFQRYPTTGKWRLSSGFDPNRRHPVTGRIAPHNGTDFAAPTGTPVVSTGDGVVVM 291

Query: 537 ANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLH 596
                  G   +I HG+ Y++ Y H   I   +  G  V +GQ IG  G TG  TGPH+H
Sbjct: 292 TRNHPYAGNYVVIQHGSTYMTRYLHLSKIL--VSKGQKVSRGQRIGLSGATGRVTGPHIH 349

Query: 597 YELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGE 642
           YELIV G  VD+ K  IP   ++    +  F   +  ++ +L + E
Sbjct: 350 YELIVRGRPVDAMKANIPMANSVPKKDMANFTARRNELDRMLAHQE 395


>gi|298369465|ref|ZP_06980782.1| M23 peptidase domain protein [Neisseria sp. oral taxon 014 str.
           F0314]
 gi|298282022|gb|EFI23510.1| M23 peptidase domain protein [Neisseria sp. oral taxon 014 str.
           F0314]
          Length = 440

 Score =  320 bits (819), Expect = 6e-85,   Method: Composition-based stats.
 Identities = 101/412 (24%), Positives = 167/412 (40%), Gaps = 23/412 (5%)

Query: 237 TLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGY 296
                   P     K++ + E   + S  V              +Q   ++ D +   G 
Sbjct: 36  AYAVTEPMPRDSGLKVERVLEE--LPSVYVETGSFQSSYWAQEAVQTGDSLADVLTRMGV 93

Query: 297 SNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHL--LTIALN 354
           +  +  +I      E  ++QL   + + I V        +     +  ++    L     
Sbjct: 94  AEAEIKQIMAKNNPERNMNQLRAGQSVSIRVNASG---QVTDVQFFTDEELERNLVALEK 150

Query: 355 DNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASS 414
            N ++           +        +  S  +      A +   +   + + +    A  
Sbjct: 151 VNGKWQAST-------SEVDMKTMPTLRSVIVRTSARGAMAQAEIPVEIRESLSEIFADV 203

Query: 415 VNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDG--SVE 472
           ++L+  LK  D +   ++  +   Q     ++L      G    + Y +        S  
Sbjct: 204 LSLE-DLKEGDTVRLLYNSMYFRGQQMGTGDILAAEIVKGGKTYQAYYYSQGKGDEESGS 262

Query: 473 YFNENGKSSRP--FLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVG 530
           Y+++NGKS +        PV + R++S +G R HP+L   RMHTG+D+AAP GTPI A  
Sbjct: 263 YYDQNGKSLQQKEGFNIQPVVYTRISSPYGYRVHPVLHTVRMHTGIDYAAPEGTPIKAAA 322

Query: 531 DGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLS 590
           DG+V    W GGYG   +I H NG  + Y H  A +     G  V  G+IIG++GTTG S
Sbjct: 323 DGVVVFKGWKGGYGNTVMIQHANGVETLYGHMSAFSP--SQG-KVSAGEIIGYVGTTGRS 379

Query: 591 TGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGE 642
           TGPHLHYE  VNG  V+ T V +P  + L    +  F  +++  N+ L    
Sbjct: 380 TGPHLHYEARVNGQPVNPTTVALPTPK-LTPTNMAAFRKQQQEANATLAAVR 430


>gi|294625180|ref|ZP_06703822.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292600499|gb|EFF44594.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 472

 Score =  320 bits (819), Expect = 6e-85,   Method: Composition-based stats.
 Identities = 92/379 (24%), Positives = 154/379 (40%), Gaps = 14/379 (3%)

Query: 266 VLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRI 325
                 P    +++ ++   T+       G       ++      +  + +L     +  
Sbjct: 91  SRKQLAPSTDWEILQVKPGQTLSTLFGELGIPTTVMYQVLAHPGTKEALTKLRPGTEIAF 150

Query: 326 GVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPN 385
            +        +          H + + L          + V+ ++  +    RT   S  
Sbjct: 151 DMPTPG---QLRALRFDRDDSHRVELRL--------LGDAVRENVTERATTTRTVVASGE 199

Query: 386 IYDGIWRATSFNGMNSNLVKLIM-RTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDS 444
           I   ++ +   +G++   V ++        ++  + L+P D             +     
Sbjct: 200 ISSSLYASAGKSGLSPAAVAIMTDEIFKYDIDFDKDLQPGDRFSVVMDETWREGERISTG 259

Query: 445 ELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYH 504
           ++L      G      +RF        EYF+ NG+  +   +R PV + R++S FG R H
Sbjct: 260 DILAATFTTGGKTYTGFRFE-RAGKPAEYFDINGRPLKKSFIRMPVAYSRISSTFGARKH 318

Query: 505 PILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDA 564
           P+LG  RMH GVD+AA  GTPI+A GD  V       GYG   ++ HG  Y + Y H   
Sbjct: 319 PVLGTMRMHKGVDYAAASGTPIMAAGDARVVFVGTQRGYGNVVILDHGKNYSTLYGHMSR 378

Query: 565 IAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLL 624
             K IKAG  + QG +IG++G TGL+TGPHLHYE  V G + +   V +P  E L+G  L
Sbjct: 379 FGK-IKAGQRINQGTVIGYVGMTGLATGPHLHYEFRVGGQQRNPMSVTMPPPEPLQGAEL 437

Query: 625 QRFAMEKKRINSLLNNGEN 643
             F  +     + +   E 
Sbjct: 438 AAFRAQTAPAMARIEGMEK 456


>gi|294666116|ref|ZP_06731374.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292604130|gb|EFF47523.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 472

 Score =  320 bits (819), Expect = 6e-85,   Method: Composition-based stats.
 Identities = 92/379 (24%), Positives = 154/379 (40%), Gaps = 14/379 (3%)

Query: 266 VLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRI 325
                 P    +++ ++   T+       G       ++      +  + +L     +  
Sbjct: 91  SRKQLAPSTDWEILQVKPGQTLSTLFGELGIPTTVMYQVLAHPGTKEALTKLRPGTEIAF 150

Query: 326 GVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPN 385
            +        +          H + + L          + V+ ++  +    RT   S  
Sbjct: 151 DMPTPG---QLRALRFDRDDSHRVELRL--------LGDAVRENVTERATTTRTVVASGE 199

Query: 386 IYDGIWRATSFNGMNSNLVKLIM-RTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDS 444
           I   ++ +   +G++   V ++        ++  + L+P D             +     
Sbjct: 200 ISSSLYASAGKSGLSPAAVAIMTDEIFKYDIDFDKDLQPGDRFSVVMDETWREGERISTG 259

Query: 445 ELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYH 504
           ++L      G      +RF        EYF+ NG+  +   +R PV + R++S FG R H
Sbjct: 260 DILAATFTTGGKTYTGFRFE-RAGKPAEYFDINGRPLKKSFIRMPVAYSRISSTFGARKH 318

Query: 505 PILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDA 564
           P+LG  RMH GVD+AA  GTPI+A GD  V       GYG   ++ HG  Y + Y H   
Sbjct: 319 PVLGTMRMHKGVDYAAASGTPIMAAGDARVVFVGTQRGYGNVVILDHGKNYSTLYGHMSR 378

Query: 565 IAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLL 624
             K IKAG  + QG +IG++G TGL+TGPHLHYE  V G + +   V +P  E L+G  L
Sbjct: 379 FGK-IKAGQRINQGTVIGYVGMTGLATGPHLHYEFRVGGQQRNPMSVTMPPPEPLQGAEL 437

Query: 625 QRFAMEKKRINSLLNNGEN 643
             F  +     + +   E 
Sbjct: 438 AAFRAQTAPALARIEGMEK 456


>gi|297182712|gb|ADI18868.1| membrane proteins related to metalloendopeptidases [uncultured
           Pseudomonadales bacterium HF0010_05E14]
          Length = 432

 Score =  320 bits (819), Expect = 6e-85,   Method: Composition-based stats.
 Identities = 96/410 (23%), Positives = 160/410 (39%), Gaps = 19/410 (4%)

Query: 236 QTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAG 295
            +LD  +      + + K  E   +I          PE       I +   +        
Sbjct: 36  ASLDILNSIDAVKNHESKTKE--ISINLNSENKSLQPELVWISQKINNGDNLSTVFERVN 93

Query: 296 YSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALND 355
            +  D  K+  A K    ++ +   E L  G+   +                    +  +
Sbjct: 94  LNALDLIKLINATK-IANLNNVFPGEKLLFGLTSANSLQEFH-----------YIKSRTE 141

Query: 356 NNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSV 415
              +   ++  +++          +     I D ++ A     ++  ++  I+      +
Sbjct: 142 RYIFKRVIDQYQVEHRIAKPDKIVNYRHVVIQDSLYLAGKKAQLSDQIIMEIVNIFGWDI 201

Query: 416 NLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFN 475
           +    ++P D     F  N  N +   D +++              R+ N     V YF 
Sbjct: 202 DFVFDIRPDDTFTVLFEENFVNGEKLPDEKVIAASFNLKSNEIIALRYQNNSGL-VGYFT 260

Query: 476 ENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIV 534
             G + +   LR P+   +++SGF +R  HPI    + H GVD+AAP GT + A GDG V
Sbjct: 261 PQGINMKKAFLRAPLDIFKISSGFNLRRKHPIHKKIKAHRGVDYAAPVGTSVYASGDGKV 320

Query: 535 EKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPH 594
             A +    G    I HG  Y + Y H D +   +K G  V+Q Q IG +G+TG STGPH
Sbjct: 321 VDAGFNRFNGNYVFIEHGGIYHTKYLHLDKLF--VKRGDKVRQRQTIGTVGSTGYSTGPH 378

Query: 595 LHYELIVNGIKVDSTKVRIPERENLKGDLLQRF-AMEKKRINSLLNNGEN 643
           LHYE +VNG+  +   V +P+ E+L G     F    K  I  L  N ++
Sbjct: 379 LHYEFLVNGVHRNPRTVSLPKAESLSGQTRASFQESTKDLIEKLRKNKQS 428


>gi|260769632|ref|ZP_05878565.1| cell wall endopeptidase family M23/M37 [Vibrio furnissii CIP
           102972]
 gi|260614970|gb|EEX40156.1| cell wall endopeptidase family M23/M37 [Vibrio furnissii CIP
           102972]
          Length = 409

 Score =  319 bits (818), Expect = 7e-85,   Method: Composition-based stats.
 Identities = 91/406 (22%), Positives = 159/406 (39%), Gaps = 18/406 (4%)

Query: 239 DQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSN 298
               +       ++ I E +   +      +    + D    I+    +       G+S 
Sbjct: 6   SSLSNPSYPRKIELSIPESHIVESILSETTEPRQSYPDYEYEIKSGDNLSTIFNQLGFSY 65

Query: 299 GDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNE 358
            +  KI +   N + +D L    +LR    +  D  ++ +  +             D+  
Sbjct: 66  QELMKIMETDLNYLALDTLKPGNVLRFW--RSQDGRSLAKMELKFSLVERAVYVRTDDGS 123

Query: 359 YVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQ 418
           +       +          +       I     ++ +  G+ S+ +  I+  L   +N  
Sbjct: 124 F-------EFKDVKIPGTWKEYPLIGEIQGSFSQSANQLGLGSSDIDQIVTLLKDKINFV 176

Query: 419 EHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENG 478
             ++  D  E   S     +Q + +SE+  I           Y + +       Y+++NG
Sbjct: 177 RDVRAGDRFEVVLSRQFVGDQLTGNSEIQAIKIFSRSNDVTAYLYKDGQ-----YYDKNG 231

Query: 479 KSSRPFLLRTPVPFGR-MTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEK 536
           +S +    R P      ++SGF     HP+ G    H G D+AAP GTP+V+ GDG+V  
Sbjct: 232 ESLQRAFQRYPTTGKWRLSSGFDPNRRHPVTGRIAPHNGTDFAAPTGTPVVSTGDGVVVM 291

Query: 537 ANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLH 596
                  G   +I HG+ Y++ Y H   I   +  G  V +GQ IG  G TG  TGPH+H
Sbjct: 292 TRNHPYAGNYVVIQHGSTYMTRYLHLSKIL--VSKGQKVSRGQRIGLSGATGRVTGPHIH 349

Query: 597 YELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGE 642
           YELIV G  VD+ K  IP   ++    +  F   +  ++ +L + E
Sbjct: 350 YELIVRGRPVDAMKANIPMANSVPKKDMANFTARRNELDRMLAHQE 395


>gi|315179206|gb|ADT86120.1| Membrane protein [Vibrio furnissii NCTC 11218]
          Length = 430

 Score =  319 bits (818), Expect = 7e-85,   Method: Composition-based stats.
 Identities = 85/372 (22%), Positives = 149/372 (40%), Gaps = 19/372 (5%)

Query: 258 NRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKN-EVRVDQ 316
           N    SP   I        +   +    +        G S      +  +      ++ +
Sbjct: 54  NSEALSPGSTILPSAILRWEKHTVHAGESAAVLFQRIGLSARQLYALTSSNSEINHQLSR 113

Query: 317 LTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDY 376
           L   + L+ G  + +D   + R            ++  +               + +  +
Sbjct: 114 LRPGDELQFGFDENNDLIQLKR-----------KLSAYETFSITKAESGYTSAFDKKEIF 162

Query: 377 MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHA 436
            + +    +I    W A    G+ +N +  +       ++    ++  D  +  +     
Sbjct: 163 YQYNYAEADISSNFWNAAMGAGLTANQIMELAGIFGWDIDFALDIRAGDNFKLLYQEKVV 222

Query: 437 NNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMT 496
             +      ++        T           D +  Y++ENG++ +   LR+P+ F R++
Sbjct: 223 EGEVIGRGNIIAAMFTNQGTTFTAIL----DDNTGNYYDENGRAMKKAFLRSPLDFRRVS 278

Query: 497 SGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGY 555
           S F     HP+ G  + H G D+ AP GTPI A GDGIVEK+++    G    I H N Y
Sbjct: 279 SNFNPNRLHPVTGQVKAHRGTDYVAPVGTPIWAAGDGIVEKSSYNQFNGNYVFIRHSNTY 338

Query: 556 VSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPE 615
           ++ Y H     + +K G  VKQGQ+IG +G TG  TGPHLHYE +VNG+  +   V +P+
Sbjct: 339 ITKYLHLTR--RTVKTGQRVKQGQVIGTLGGTGRVTGPHLHYEFLVNGVHKNPRTVALPQ 396

Query: 616 RENLKGDLLQRF 627
            ++L G     F
Sbjct: 397 SKSLNGKAKDTF 408


>gi|260778060|ref|ZP_05886953.1| cell wall endopeptidase family M23/M37 [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260606073|gb|EEX32358.1| cell wall endopeptidase family M23/M37 [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 417

 Score =  319 bits (818), Expect = 8e-85,   Method: Composition-based stats.
 Identities = 90/418 (21%), Positives = 155/418 (37%), Gaps = 18/418 (4%)

Query: 227 SFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTT 286
             +L       L   +            + E+  +      ++ I +  +    IQ    
Sbjct: 3   LLSLPVVAALVLSATNKSNQYQRTIDLSLPESSIVNDLLTDVEVIHDMPNYEYVIQKGDN 62

Query: 287 IFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQK 346
           +       G+   +  KI +   N + +D L     LR       +   + +  +     
Sbjct: 63  LSSIFSQLGFGYSELMKIMETDLNYLALDTLKPGNTLRFWRD--AETKNLAKMELEFSIV 120

Query: 347 HLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKL 406
                  +D+  Y         +        +       I     ++    G+ S+  + 
Sbjct: 121 ERAVYNRHDDGSY-------TFEDVKIPGTWKEQALVGEIAGSFSQSLHRLGLGSSENEQ 173

Query: 407 IMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNP 466
           I+  L   +N    L+  D  E   S  +   Q + + EL  +           Y   + 
Sbjct: 174 IVSLLKDKLNFARDLRAGDVFEVVLSKQYVGEQLTGNKELQAVKIYNRGKEVTAYLHSDG 233

Query: 467 VDGSVEYFNENGKSSRPFLLRTPVP-FGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGT 524
                 Y+++NG S +    R P+    R++S F     HP+ G    H G DWAAP GT
Sbjct: 234 Q-----YYDKNGNSLQRAFQRKPLNANYRLSSNFNPTRKHPVTGRIAPHNGTDWAAPTGT 288

Query: 525 PIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWI 584
           PIV+ GDG+V         G   +I HG+ Y + Y H   I   ++ G  V +G+ IG  
Sbjct: 289 PIVSTGDGVVVMTRKHPYAGNYVVIQHGSRYKTRYLHLSKIL--VRKGQKVSRGERIGLS 346

Query: 585 GTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGE 642
           G TG  TGPH+HYELI  G  V++    IP   ++    +  F + +  ++++L   E
Sbjct: 347 GATGRVTGPHIHYELIDRGRPVNAMTANIPMASSVPKSEMTAFKIRRDELDAMLRQQE 404


>gi|297172661|gb|ADI23629.1| membrane proteins related to metalloendopeptidases [uncultured
           gamma proteobacterium HF4000_06A21]
          Length = 553

 Score =  319 bits (818), Expect = 8e-85,   Method: Composition-based stats.
 Identities = 92/485 (18%), Positives = 172/485 (35%), Gaps = 16/485 (3%)

Query: 162 EGKIESSSQMLMDTIHNVDSFEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLH 221
           E +    +         V +   T +      D         +    +   +      + 
Sbjct: 82  ETEQTQITAAQQSANAPVAALGNTIEVPATTPDHRPPGSRLVSPTLPLDEIVRELGLDMD 141

Query: 222 NKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPI 281
                  ++    P             +   +   E     +      K  +       I
Sbjct: 142 LAYQLVISIPPVTPSPTRLTQREEHVPALSNRASAE-LLNKTETTTEKKTKKIGWRRATI 200

Query: 282 QHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSI 341
           +   T+       G +   + +++      + ++QL     L + +     +  I+    
Sbjct: 201 EDGDTLTAIFKRLGINPTTAVQLSHLPNGPL-LNQLRPGPHLEVLL-----RGKILEALR 254

Query: 342 YHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNS 401
           Y   +          N YV+     + DI  +            I   ++      G++ 
Sbjct: 255 YQHNQLRFVEVKRTGNTYVVQPIERQFDIVERKIE-------GTILSSLYSDGLQAGLDE 307

Query: 402 NLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFY 461
            ++  + R     ++    L+  D      +  H + Q   +  +            +  
Sbjct: 308 TVLYKLTRIFRWQIDFTRDLQKGDRFAVIVNEQHLDGQKVSNGPIQAAAFIVKGKPYQAL 367

Query: 462 RFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAA 520
             + P      Y+  +G+S     LR+P+ F R+TS F     HP+L   R H GVD+ A
Sbjct: 368 LHVGPSGVGR-YYTPSGESLESVFLRSPLRFSRVTSHFSNNRYHPVLKKWRAHKGVDYGA 426

Query: 521 PRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQI 580
           PRG P++A   G V +    G YG+   + HG  Y + Y H   +AK ++  T+VKQGQ+
Sbjct: 427 PRGEPVMATAAGKVVQMGIKGAYGRLVTLQHGKTYQTVYAHLSRVAKGLRKSTSVKQGQV 486

Query: 581 IGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNN 640
           IG++G++GL+TGPHLHYE  VNG   +   V++P   ++       F+ + K   + L  
Sbjct: 487 IGFVGSSGLATGPHLHYEFRVNGQHRNPLTVKLPRSSSIARKEKNAFSHKAKLWTARLET 546

Query: 641 GENPK 645
                
Sbjct: 547 LSTTS 551


>gi|297182356|gb|ADI18523.1| membrane proteins related to metalloendopeptidases [uncultured
           gamma proteobacterium HF4000_19M20]
          Length = 451

 Score =  319 bits (818), Expect = 8e-85,   Method: Composition-based stats.
 Identities = 84/391 (21%), Positives = 162/391 (41%), Gaps = 10/391 (2%)

Query: 261 ITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKD 320
           +      ID+          ++ N T+F  +   G  +     +  +  + + + Q+   
Sbjct: 60  LVPTIQNIDEPSFNQTKATDVKRNDTLFSILKRLGVKDYSIYNLMYSPNSRL-LTQIKVG 118

Query: 321 EILRIGVVQKDDKFTIVRFSIYHK----QKHLLTIALNDNNEYVLGVE---PVKMDINHQ 373
           + + + +   ++  ++     +      +K      + +    V   +      ++    
Sbjct: 119 KRIEVEINSLNEIESLKYIEDFKSGVVAKKVENFKCIKNFGSGVTDKKAECNYLVENYEL 178

Query: 374 MDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSV 433
                   +   I + ++      G+  +++  ++      ++    ++  D     +  
Sbjct: 179 KTEEFKVFKRVKITNSLYADGLKEGLPDSVIMDLVYIFGWDIDFVHDIRRGDSYSLIYEE 238

Query: 434 NHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFG 493
              + +   + ++L         +    RF      S EYF+ +G++ +   LR+PV F 
Sbjct: 239 IFVDGEKKLNGDILIAEFINRNRKNVAIRFKLSEGNS-EYFSADGRNVKKAFLRSPVKFS 297

Query: 494 RMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHG 552
            ++ G+ ++  HP+L   R HTGVD+AA +G+P+ A GDG +  A+  GGYG    I H 
Sbjct: 298 YISDGYNLKRLHPVLHQIRAHTGVDYAATKGSPVRATGDGTIVYADKKGGYGNLVEIKHT 357

Query: 553 NGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVR 612
             Y + Y H D     IK G  VKQ   IG++G TG +TG HLHYE  VNG   +   VR
Sbjct: 358 EDYSTRYAHLDKFHSKIKIGKKVKQSDTIGYVGRTGTATGDHLHYEFRVNGKHTNPLTVR 417

Query: 613 IPERENLKGDLLQRFAMEKKRINSLLNNGEN 643
            P  + +     + + +  K I S L N +N
Sbjct: 418 FPNAKPINTSDKENYELHAKEILSDLKNYQN 448


>gi|15600850|ref|NP_232480.1| hypothetical protein VCA0079 [Vibrio cholerae O1 biovar eltor str.
           N16961]
 gi|121590628|ref|ZP_01677963.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gi|121726969|ref|ZP_01680165.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|147671781|ref|YP_001214901.1| hypothetical protein VC0395_0060 [Vibrio cholerae O395]
 gi|153212880|ref|ZP_01948497.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|153801204|ref|ZP_01955790.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
 gi|153819236|ref|ZP_01971903.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|153823630|ref|ZP_01976297.1| conserved hypothetical protein [Vibrio cholerae B33]
 gi|227811706|ref|YP_002811716.1| hypothetical protein VCM66_A0077 [Vibrio cholerae M66-2]
 gi|254284804|ref|ZP_04959771.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
 gi|254850344|ref|ZP_05239694.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|297579785|ref|ZP_06941712.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|298499943|ref|ZP_07009749.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|9657464|gb|AAF95993.1| conserved hypothetical protein [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121547521|gb|EAX57626.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gi|121630603|gb|EAX62992.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|124116258|gb|EAY35078.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|124123222|gb|EAY41965.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
 gi|126510228|gb|EAZ72822.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|126518850|gb|EAZ76073.1| conserved hypothetical protein [Vibrio cholerae B33]
 gi|146314164|gb|ABQ18704.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|150425589|gb|EDN17365.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
 gi|227010848|gb|ACP07059.1| conserved hypothetical protein [Vibrio cholerae M66-2]
 gi|227014711|gb|ACP10920.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|254846049|gb|EET24463.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|297535431|gb|EFH74265.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|297541924|gb|EFH77975.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
          Length = 430

 Score =  319 bits (818), Expect = 8e-85,   Method: Composition-based stats.
 Identities = 96/442 (21%), Positives = 169/442 (38%), Gaps = 28/442 (6%)

Query: 210 KNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITY------SKKIKIIEENRTITS 263
           K+ I+    L   KK     L       +    + P           +  +++ +    +
Sbjct: 4   KSIILRFSELSMRKKATLVGLPLLAVAAISSSLNSPTRQQRIELSLPESPLVQFSSAEHT 63

Query: 264 PQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEIL 323
            +V+    P++  +   I+    +       G++  +  K+ +   N + +D L    +L
Sbjct: 64  VEVVKVGHPDYEYE---IKPGDNLSTIFNQLGFAYTELMKVMETDLNYLALDTLRPGNVL 120

Query: 324 RIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEES 383
           R     K    T+ +  +             ++  Y       + +        +     
Sbjct: 121 RFW---KGSDNTLAKMELEFSLVDRAVYTRLNDGSY-------EFEERKIPGTWKVEPLI 170

Query: 384 PNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDD 443
             +      + +  G+ +  V  I+  L   +N    L+  D  E   S      + + +
Sbjct: 171 GEVDGSFSLSANRAGLGAADVDQIVTLLKDKINFGRDLRRGDRFEVVLSRQLVGEKLTGN 230

Query: 444 SELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGR-MTSGFGMR 502
           SE+  I           Y   +       Y+++NG S +    R PV     ++S F  R
Sbjct: 231 SEIQAIKIFNRGKEITAYLHQDGQ-----YYDKNGDSLQRAFQRYPVDSKWRISSNFDPR 285

Query: 503 Y-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNH 561
             HP+      H G D+A P GTP+   GDG+V         G   +I HGN Y++ Y H
Sbjct: 286 RLHPVTKRVAPHNGTDFAMPIGTPVYTSGDGVVVMTRNHPYAGNYVVIQHGNTYMTRYLH 345

Query: 562 QDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKG 621
              I   +K G  V +GQ IG  G TG  TGPHLHYELIV G  V++ K  IP   ++  
Sbjct: 346 LSKIL--VKKGQKVSRGQRIGLSGNTGRVTGPHLHYELIVRGRPVNAMKANIPMASSVPK 403

Query: 622 DLLQRFAMEKKRINSLLNNGEN 643
             + +F  ++K ++ +L   E+
Sbjct: 404 KEMAQFIAKRKELDQMLARQES 425


>gi|229506747|ref|ZP_04396256.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae BX 330286]
 gi|229510458|ref|ZP_04399938.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae B33]
 gi|229517411|ref|ZP_04406856.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae RC9]
 gi|229522748|ref|ZP_04412164.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae TM
           11079-80]
 gi|229605221|ref|YP_002875925.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae MJ-1236]
 gi|229340733|gb|EEO05739.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae TM
           11079-80]
 gi|229345447|gb|EEO10420.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae RC9]
 gi|229352903|gb|EEO17843.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae B33]
 gi|229357098|gb|EEO22016.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae BX 330286]
 gi|229371707|gb|ACQ62129.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae MJ-1236]
          Length = 423

 Score =  319 bits (818), Expect = 8e-85,   Method: Composition-based stats.
 Identities = 95/438 (21%), Positives = 166/438 (37%), Gaps = 28/438 (6%)

Query: 214 MNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITY------SKKIKIIEENRTITSPQVL 267
           M    L   KK     L       +    + P           +  +++ +    + +V+
Sbjct: 1   MRFSELSMRKKATLVGLPLLAVAAISSSLNSPTRQQRIELSLPESPLVQFSSAEHTVEVV 60

Query: 268 IDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGV 327
               P++  +   I+    +       G++  +  K+ +   N + +D L    +LR   
Sbjct: 61  KVGHPDYEYE---IKPGDNLSTIFNQLGFAYTELMKVMETDLNYLALDTLRPGNVLRFW- 116

Query: 328 VQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIY 387
             K    T+ +  +             ++  Y       + +        +       + 
Sbjct: 117 --KGSDNTLAKMELEFSLVDRAVYTRLNDGSY-------EFEERKIPGTWKVEPLIGEVD 167

Query: 388 DGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELL 447
                + +  G+ +  V  I+  L   +N    L+  D  E   S      + + +SE+ 
Sbjct: 168 GSFSLSANRAGLGAADVDQIVTLLKDKINFGRDLRRGDRFEVVLSRQLVGEKLTGNSEIQ 227

Query: 448 YIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGR-MTSGFGMRY-HP 505
            I           Y   +       Y+++NG S +    R PV     ++S F  R  HP
Sbjct: 228 AIKIFNRGKEITAYLHQDGQ-----YYDKNGDSLQRAFQRYPVDSKWRISSNFDPRRLHP 282

Query: 506 ILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAI 565
           +      H G D+A P GTP+   GDG+V         G   +I HGN Y++ Y H   I
Sbjct: 283 VTKRVAPHNGTDFAMPIGTPVYTSGDGVVVMTRNHPYAGNYVVIQHGNTYMTRYLHLSKI 342

Query: 566 AKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQ 625
              +K G  V +GQ IG  G TG  TGPHLHYELIV G  V++ K  IP   ++    + 
Sbjct: 343 L--VKKGQKVSRGQRIGLSGNTGRVTGPHLHYELIVRGRPVNAMKANIPMASSVPKKEMA 400

Query: 626 RFAMEKKRINSLLNNGEN 643
           +F  ++K ++ +L   E+
Sbjct: 401 QFIAKRKELDQMLARQES 418


>gi|78049567|ref|YP_365742.1| membrane-bound metalloendopeptidase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|78037997|emb|CAJ25742.1| membrane-bound metalloendopeptidase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 472

 Score =  319 bits (817), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 92/379 (24%), Positives = 153/379 (40%), Gaps = 14/379 (3%)

Query: 266 VLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRI 325
                 P    +++ ++   T+       G       ++      +  + +L     +  
Sbjct: 91  SRKQLAPSTDWEILQVKPGQTLSTLFGELGIPTTVMYQVLAHPGTKEALTKLRPGTEIAF 150

Query: 326 GVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPN 385
            +        +          H + + L          E V+ ++  +    RT   S  
Sbjct: 151 DMPTPG---QLRALRFDRDDSHRVELRL--------LGEAVRENVTERATTTRTVVASGE 199

Query: 386 IYDGIWRATSFNGMNSNLVKLIM-RTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDS 444
           I   ++ +   +G++   V ++        ++  + L+P D             +     
Sbjct: 200 ISSSLYASAGKSGLSPAAVAIMTDEIFKYDIDFDKDLQPGDRFSVVMDETWREGERISTG 259

Query: 445 ELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYH 504
           ++L      G      +RF        EYF+  G+  +   +R PV + R++S FG R H
Sbjct: 260 DILAATFTTGGKTYTGFRFK-RAGKPAEYFDITGRPLKKSFIRMPVAYSRISSTFGARKH 318

Query: 505 PILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDA 564
           P+LG  RMH GVD+AA  GTPI+A GD  V       GYG   ++ HG  Y + Y H   
Sbjct: 319 PVLGTMRMHKGVDYAAASGTPIMAAGDARVVFVGTQRGYGNVVILDHGKNYSTLYGHMSR 378

Query: 565 IAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLL 624
             K IKAG  + QG +IG++G TGL+TGPHLHYE  V G + +   V +P  E L+G  L
Sbjct: 379 FGK-IKAGQRINQGTVIGYVGMTGLATGPHLHYEFRVGGQQRNPMSVTMPPPEPLQGAEL 437

Query: 625 QRFAMEKKRINSLLNNGEN 643
             F  +     + +   E 
Sbjct: 438 AAFRAQTAPAMARIEGMEK 456


>gi|261212770|ref|ZP_05927054.1| cell wall endopeptidase family M23/M37 [Vibrio sp. RC341]
 gi|260837835|gb|EEX64512.1| cell wall endopeptidase family M23/M37 [Vibrio sp. RC341]
          Length = 364

 Score =  319 bits (816), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 87/373 (23%), Positives = 145/373 (38%), Gaps = 19/373 (5%)

Query: 273 EFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDD 332
            + D    I+    +       G+   +  KI +   N + +D L    +LR     K  
Sbjct: 4   GYPDYEYEIKPGDNLSTIFSQLGFPYTELMKIMETDLNYLALDTLRPGNVLRFW---KGS 60

Query: 333 KFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWR 392
             T+ +  +              +  Y       + +        +       +      
Sbjct: 61  DNTLSKMELEFSLVDRAVYTRLSDGSY-------EFEERKIPGTWKVEPLIGEVDGSFSL 113

Query: 393 ATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHAR 452
           + +  G+ +  V  I+  L   +N    L+  D  E   S      + + +SE+  I   
Sbjct: 114 SANRAGLGTADVDQIVTLLKDKINFGRDLRRGDRFEVVLSRQFVGEKLTGNSEIQAIKIF 173

Query: 453 FGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGR-MTSGFGMRY-HPILGYS 510
                   Y   +       Y+++NG S +    R PV     ++S F  +  HP+    
Sbjct: 174 NRGKEITAYLHQDGQ-----YYDKNGDSLQRAFQRYPVDSKWRISSNFDPKRFHPVTKRV 228

Query: 511 RMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIK 570
             H G D+A P GTP+   GDG+V         G   +I HG+ Y++ Y H   I   +K
Sbjct: 229 APHNGTDFAMPIGTPVYTSGDGVVVMTRSHPYAGNYVVIQHGSTYMTRYLHLSKIL--VK 286

Query: 571 AGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAME 630
            G  V +GQ IG  G TG  TGPHLHYELIV G  V++ K  IP   ++    + +F  +
Sbjct: 287 KGQKVSRGQRIGLSGNTGRVTGPHLHYELIVRGRAVNAMKANIPMASSVPKKEMAQFIAK 346

Query: 631 KKRINSLLNNGEN 643
           +K ++ +L   E+
Sbjct: 347 RKELDQMLARQES 359


>gi|297172442|gb|ADI23415.1| membrane proteins related to metalloendopeptidases [uncultured
           gamma proteobacterium HF0770_33G18]
          Length = 535

 Score =  319 bits (816), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 99/543 (18%), Positives = 186/543 (34%), Gaps = 48/543 (8%)

Query: 102 SPKTKSKHPEKIIIEVPTLIKDHNKDIIKKIPFAYARMTFATPYPKVKDHPKFDPLKIFS 161
           SP++      K+  ++  +++  ++            +    P P     P  +      
Sbjct: 39  SPESLEARRTKLASQLSAVLEAEDR-------LVRDSLALRKPLPGSLSIPDIN------ 85

Query: 162 EGKIESSSQMLMDTIHNVDSFEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLH 221
                    +       +         ++ P           A       A+     L  
Sbjct: 86  ---------ISPAGRVGIPGASGPLSAVDDPISDMPPWRLTPATPNSATRAL--DLNLSS 134

Query: 222 NKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPI 281
              + +     A    L                       T+      + P      I I
Sbjct: 135 GTPSNAAITRAALQFDLAYLLMLQPRLES---------PKTAFPKSTIETPIEHWVNINI 185

Query: 282 QHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSI 341
           +   ++         +   +  IA+     + +++L     L+I V        ++    
Sbjct: 186 RPGDSLTKIFKRLDLNPRIAVTIAQRSDARI-LNRLRTGPYLQILVR----GQQLLALRY 240

Query: 342 YHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNS 401
                 +L++   +   Y       K D+  +         +  I   ++++   NG++ 
Sbjct: 241 QPDLLTILSVER-EGQRYRTSTIKRKFDVTERAL-------TGVIRSSLFQSGMKNGVSR 292

Query: 402 NLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFY 461
           +L+  +       ++  + L+P D     +     + +      +L           R  
Sbjct: 293 DLLYNLSSIFQWQIDFSKDLRPGDRYGLIYEERSLDGRKFSSGPILAAEFVVRGKTYRAI 352

Query: 462 RFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAA 520
           R ++    S  YF  +G+S     LR+P+   ++TS F  R  HP+L     H GVD+  
Sbjct: 353 RQVSRNGTS-HYFTPDGESLEGLFLRSPMRMAQITSPFSNRRYHPVLKKWGAHKGVDYGG 411

Query: 521 PRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQI 580
             G P++A  +G+V        YG    + HG  Y + Y H    A N++ G+ V QGQ+
Sbjct: 412 STGDPVMATAEGMVTFIGRKHQYGNVITLQHGQKYTTLYAHLSRFANNVRNGSTVTQGQV 471

Query: 581 IGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNN 640
           IG++GTTGLSTGPHLHYE  VNG+  +   V++P    +   L   F    +   + LN 
Sbjct: 472 IGYVGTTGLSTGPHLHYEFRVNGVHKNPITVKLPRSFAIDRALRPEFMKIAEFWATQLNQ 531

Query: 641 GEN 643
              
Sbjct: 532 LAR 534


>gi|229526287|ref|ZP_04415691.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae bv.
           albensis VL426]
 gi|229336445|gb|EEO01463.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae bv.
           albensis VL426]
          Length = 423

 Score =  319 bits (816), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 95/438 (21%), Positives = 165/438 (37%), Gaps = 28/438 (6%)

Query: 214 MNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITY------SKKIKIIEENRTITSPQVL 267
           M    L   KK     L       +    + P           +  +++ +    + +V+
Sbjct: 1   MRFSELSMRKKATLVGLPLLAVAAISSSLNSPTRQQRIELSLPESPLVQFSSAEHTVEVV 60

Query: 268 IDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGV 327
               P++  +   I+    +       G++  +  K+ +   N + +D L    +LR   
Sbjct: 61  KVGHPDYEYE---IKPGDNLSTIFNQLGFAYTELMKVMETDLNYLALDTLRPGNVLRFW- 116

Query: 328 VQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIY 387
             K    T+ +  +             ++  Y       + +        +       + 
Sbjct: 117 --KGSDNTLAKMELEFSLVDRAVYTRLNDGSY-------EFEERKIPGTWKVEPLIGEVD 167

Query: 388 DGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELL 447
                + +  G+    V  I+  L   +N    L+  D  E   S      + + +SE+ 
Sbjct: 168 GSFSLSANRAGLGVADVDQIVTLLKDKINFGRDLRRGDRFEVVLSRQLVGEKLTGNSEIQ 227

Query: 448 YIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGR-MTSGFGMRY-HP 505
            I           Y   +       Y+++NG S +    R PV     ++S F  R  HP
Sbjct: 228 AIKIFNRGKEITAYLHQDGQ-----YYDKNGDSLQRAFQRYPVDSKWRISSNFDPRRLHP 282

Query: 506 ILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAI 565
           +      H G D+A P GTP+   GDG+V         G   +I HGN Y++ Y H   I
Sbjct: 283 VTKRVAPHNGTDFAMPIGTPVYTSGDGVVVMTRNHPYAGNYVVIQHGNTYMTRYLHLSKI 342

Query: 566 AKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQ 625
              +K G  V +GQ IG  G TG  TGPHLHYELIV G  V++ K  IP   ++    + 
Sbjct: 343 L--VKKGQKVSRGQRIGLSGNTGRVTGPHLHYELIVRGRPVNAMKANIPMASSVPKKEMA 400

Query: 626 RFAMEKKRINSLLNNGEN 643
           +F  ++K ++ +L   E+
Sbjct: 401 QFIAKRKELDQMLARQES 418


>gi|228471805|ref|ZP_04056578.1| peptidase, family M23 [Capnocytophaga gingivalis ATCC 33624]
 gi|228276958|gb|EEK15653.1| peptidase, family M23 [Capnocytophaga gingivalis ATCC 33624]
          Length = 433

 Score =  319 bits (816), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 86/404 (21%), Positives = 154/404 (38%), Gaps = 24/404 (5%)

Query: 250 KKIKIIEENRTITSPQVLIDKIPEFADDLI----------PIQHNTTIFDAMVHAGYSNG 299
              K   +    ++            +              ++   T    +     S  
Sbjct: 19  PSCKREPKTEPQSTVVETPPPPKPVYEYGFNLLEYNIVKDTLKQGDTFGALLGAQHISAQ 78

Query: 300 DSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEY 359
             A+IA   K  +R       +   +   +K    ++  F       H + I L D+   
Sbjct: 79  KVAEIADLSKELIRPKNFRAGQPYALVYDKK-QPDSLAYFVYQPDLLHFIEIKLRDS--- 134

Query: 360 VLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQE 419
                 + +    +   +   E    I + +      +GM+      + +    +++   
Sbjct: 135 ------LAIRRIDRKVTIVEREGGGYIKNNLIDDVMKSGMSFAAAYKLSQIFDYTIDF-F 187

Query: 420 HLKPTDFLETFFSVNHANNQA-SDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENG 478
           HL+  D  +  +   + ++   +    +              + F +    +  Y++ENG
Sbjct: 188 HLQEDDKFKIIYDERYVDDTINAGLVRVKAAFFEHKGKPYYAFHFQSDTTKAGGYYDENG 247

Query: 479 KSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKAN 538
              +   L++P+   R+TS +GMRYHPIL   + H G D+AAP GTPI A   G V +A 
Sbjct: 248 NMMKRMFLKSPLDIFRITSHYGMRYHPILHRMKGHFGTDYAAPTGTPIRATASGTVTQAG 307

Query: 539 WAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYE 598
           +  G G    I H   Y + Y H   I    + G  V QG +IG +G+TGL+TGPH+ Y 
Sbjct: 308 YGSGNGNYVKIRHDKTYETQYLHMSKIIA--RKGQHVSQGDVIGLVGSTGLATGPHVCYR 365

Query: 599 LIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGE 642
              NG+++D  K ++PE   + G L  R+      +   L+   
Sbjct: 366 FWKNGVQIDPLKEKLPEATPIDGALKPRYMEFVTPLKKQLDAVP 409


>gi|325917547|ref|ZP_08179750.1| metalloendopeptidase-like membrane protein [Xanthomonas vesicatoria
           ATCC 35937]
 gi|325536263|gb|EGD08056.1| metalloendopeptidase-like membrane protein [Xanthomonas vesicatoria
           ATCC 35937]
          Length = 472

 Score =  319 bits (816), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 91/379 (24%), Positives = 154/379 (40%), Gaps = 14/379 (3%)

Query: 266 VLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRI 325
                 P    +++ ++   T+       G       ++      +  + +L     +  
Sbjct: 91  SRKQLAPGTEWEILQVKPGQTLSTLFGELGIPTAVMYQVLAHPGTKEALTKLRPGTEIAF 150

Query: 326 GVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPN 385
            +    +   +          H + + L          + V+  +  +    RT   S  
Sbjct: 151 DLPTPGE---LRALRFDRDDSHRVELRL--------LGDSVREKVTERATTTRTVVASGE 199

Query: 386 IYDGIWRATSFNGMNSNLVKLIM-RTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDS 444
           I   ++ +   +G++   V ++        ++  + L+P D             +     
Sbjct: 200 ISSSLYASAGKSGLSPAAVAIMTDEIFKYDIDFDKDLQPGDRFSVVMDETWREGERISTG 259

Query: 445 ELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYH 504
           ++L      G      +RF   V    EY++  G+  +   +R PV + R++S FG R H
Sbjct: 260 DILAATFTTGGKTYTGFRFE-RVGKPAEYYDITGRPLKKSFIRMPVAYSRISSTFGARKH 318

Query: 505 PILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDA 564
           P+LG  RMH GVD+AA  GTPI+A GD  V       GYG   ++ HG  Y + Y H   
Sbjct: 319 PVLGTMRMHKGVDYAAASGTPIMAAGDARVVFVGTQRGYGNVVILDHGKNYSTLYGHMSR 378

Query: 565 IAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLL 624
             K IKAG  + QG +IG++G TGL+TGPHLHYE  V G + +   V +P  E L+G  L
Sbjct: 379 FGK-IKAGQRINQGTVIGYVGMTGLATGPHLHYEFRVAGQQRNPMSVTMPPPEPLQGAEL 437

Query: 625 QRFAMEKKRINSLLNNGEN 643
             F  +     + +   E 
Sbjct: 438 AAFRAQTAPAMARIEGMEK 456


>gi|153825752|ref|ZP_01978419.1| hypothetical metalloprotease YebA [Vibrio cholerae MZO-2]
 gi|149740591|gb|EDM54702.1| hypothetical metalloprotease YebA [Vibrio cholerae MZO-2]
          Length = 362

 Score =  319 bits (816), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 88/370 (23%), Positives = 146/370 (39%), Gaps = 19/370 (5%)

Query: 276 DDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFT 335
           D    I+    +       G++  +  K+ +   N + +D L    +LR     K    T
Sbjct: 5   DYEYEIKPGDNLSTIFNQLGFAYTELMKVMETDLNYLALDTLRPGNVLRFW---KGSDNT 61

Query: 336 IVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATS 395
           + +  +             ++  Y       + +        +       +      + +
Sbjct: 62  LAKMELEFSLVDRAVYTRLNDGSY-------EFEERKIPGTWKVEPLIGEVDGSFSLSAN 114

Query: 396 FNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGE 455
             G+ +  V  I+  L   +N    L+  D  E   S      + + +SE+  I      
Sbjct: 115 RAGLGAADVDQIVTLLKDKINFGRDLRRGDRFEVVLSRQFVGEKLTGNSEIQAIKIFNRG 174

Query: 456 TRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGR-MTSGFGMRY-HPILGYSRMH 513
                Y   +       Y+++NG S +    R PV     ++S F  R  HP+      H
Sbjct: 175 KEITAYLHQDGQ-----YYDKNGDSLQRAFQRYPVDSKWRISSNFDPRRLHPVTKRVAPH 229

Query: 514 TGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGT 573
            G D+A P GTP+   GDG+V         G   +I HGN Y++ Y H   I   +K G 
Sbjct: 230 NGTDFAMPIGTPVYTSGDGVVVMTRNHPYAGNYVVIQHGNTYMTRYLHLSKIL--VKKGQ 287

Query: 574 AVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKR 633
            V +GQ IG  G TG  TGPHLHYELIV G  V++ K  IP   ++    + +F  ++K 
Sbjct: 288 KVSRGQRIGLSGNTGRVTGPHLHYELIVRGRPVNAMKANIPMASSVPKKEMAQFIAKRKE 347

Query: 634 INSLLNNGEN 643
           ++ +L   E+
Sbjct: 348 LDQMLARQES 357


>gi|294085502|ref|YP_003552262.1| membrane protein [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292665077|gb|ADE40178.1| Membrane protein [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 492

 Score =  319 bits (816), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 109/364 (29%), Positives = 174/364 (47%), Gaps = 20/364 (5%)

Query: 275 ADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKF 334
            +    ++    + + +  AGYSN D A    A++    +  L     + I  +      
Sbjct: 124 KEADYQLKAGDGLANVLRRAGYSNTDIANSVTAIQTRTSLRSLPVGMKITISDLGYRFTT 183

Query: 335 TIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRAT 394
              R     K      IA+                   +      +  +  I   I+++T
Sbjct: 184 RDGRDIYALKDPESGWIAI----------------RAIRPVDTYLTFANGVIDGSIYKST 227

Query: 395 SFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHAN--NQASDDSELLYIHAR 452
              G+        +R +  SV+ Q  ++  D  E  +  ++      A +   L Y   +
Sbjct: 228 ITAGVPDAAFNEYVRVMGFSVDFQREIRNGDVFELLYETSYDQITGNAVNT-RLHYAGLK 286

Query: 453 FGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRM 512
               +  FYR+ N  D  + +F+ NG S+   L+RTP+   R++S FG R HP+ GY+ M
Sbjct: 287 LSGNQLAFYRYEN-SDAGIGWFDRNGASAARTLIRTPISGARLSSSFGRRKHPVSGYTAM 345

Query: 513 HTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAG 572
           H GVD+AAP GTPI+A G G+V KA W G YG+   I H + Y ++Y H  +IA+ ++AG
Sbjct: 346 HKGVDFAAPTGTPIIAAGSGVVSKAGWRGSYGRYVRIRHNSTYDTAYAHMKSIARGVRAG 405

Query: 573 TAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKK 632
             V+QGQIIG++GTTG STGPHLHYE++VN  +V+   VR+P    L    L  F+ +  
Sbjct: 406 ARVQQGQIIGYVGTTGRSTGPHLHYEILVNNRQVNPVTVRLPTGTRLDEAFLPAFSRQVD 465

Query: 633 RINS 636
            +++
Sbjct: 466 LVDA 469


>gi|58580136|ref|YP_199152.1| hypothetical protein XOO0513 [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84622136|ref|YP_449508.1| hypothetical protein XOO_0479 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188578878|ref|YP_001915807.1| membrane-bound metalloendopeptidase [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|58424730|gb|AAW73767.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84366076|dbj|BAE67234.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188523330|gb|ACD61275.1| membrane-bound metalloendopeptidase [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 472

 Score =  319 bits (816), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 88/379 (23%), Positives = 155/379 (40%), Gaps = 14/379 (3%)

Query: 266 VLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRI 325
                 P    +++ ++   T+       G       ++      +  + +L     +  
Sbjct: 91  SRKQLAPSTDWEILQVKPGQTLSTLFGELGIPTTLMYQVLAHPGTKEALTKLRPGAEIAF 150

Query: 326 GVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPN 385
            +        +        + H + + L          + V+ ++  +    RT   S  
Sbjct: 151 DMPTPG---QLRALRFDRDESHRVELRL--------LGDSVRENVTERATTTRTVVASGE 199

Query: 386 IYDGIWRATSFNGMNSNLVKLIM-RTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDS 444
           I   ++ +   +G++   V ++        ++  + L+P D             +     
Sbjct: 200 INSSLYASAGKSGLSPAAVAIMTDEIFKYDIDFDKDLQPGDRFSVVMDETWREGERISTG 259

Query: 445 ELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYH 504
           ++L      G      +RF        EY++ +G+  +   +R PV + R++S FG R H
Sbjct: 260 DILAATFTTGGKTYTGFRFE-RAGKPAEYYDISGRPLKKSFIRMPVAYSRISSTFGARMH 318

Query: 505 PILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDA 564
           P+LG  RMH GVD+AA  GTPI+A GD  V       GYG   ++ HG  Y + Y H   
Sbjct: 319 PVLGTMRMHKGVDYAAASGTPIMAAGDARVVFVGTQRGYGNVVILDHGKNYSTLYGHMSR 378

Query: 565 IAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLL 624
             K IK G  + QG +IG++G TG++TGPHLHYE  V+G + +   V +P  E L+G  L
Sbjct: 379 FGK-IKVGQHINQGTVIGYVGMTGMATGPHLHYEFRVDGQQRNPMSVTMPPPEPLQGAEL 437

Query: 625 QRFAMEKKRINSLLNNGEN 643
             F  +     + +   E 
Sbjct: 438 AAFRAQTAPALARIEGMEK 456


>gi|261379252|ref|ZP_05983825.1| M23 peptidase domain protein [Neisseria subflava NJ9703]
 gi|319639129|ref|ZP_07993885.1| M23 peptidase domain-containing protein [Neisseria mucosa C102]
 gi|284797679|gb|EFC53026.1| M23 peptidase domain protein [Neisseria subflava NJ9703]
 gi|317399606|gb|EFV80271.1| M23 peptidase domain-containing protein [Neisseria mucosa C102]
          Length = 431

 Score =  319 bits (816), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 99/425 (23%), Positives = 165/425 (38%), Gaps = 17/425 (4%)

Query: 223 KKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQ 282
           K      L  A           P       K+   +  + +  V  +           +Q
Sbjct: 11  KATLLAFLLPASGIMTAYAITDPQPAQTDFKVERISEELPAVYVETNTYQSSYWAQEAVQ 70

Query: 283 HNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIY 342
              ++ D +   G +  D  +I       + +  L  ++ + I +        +     +
Sbjct: 71  AGDSLADVLTRMGVNQEDIKQIMAKNNANLDMKNLRTNQSVNIRIDSSG---QVTDVQFF 127

Query: 343 HKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSN 402
             ++        +           ++           +  S  I            + S 
Sbjct: 128 TDEELE-----RNLVALEKVKGKWRISNAEIDMKTMPTLRSVQIRTSAIGDMLRAEIPSE 182

Query: 403 LVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYR 462
           +   +    A S N+   LK  D +   ++  +   Q     ++L           + Y 
Sbjct: 183 VYIQLKEIFADSFNMS-DLKEGDTVRLLYNSMYFRGQQMAVGDILAAEVVKDGKTYQAYY 241

Query: 463 FLNPVDG--SVEYFNENGKSSRP--FLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDW 518
           +        S  Y+++NGKS +        PV + R++S FG R HP+L   RMHTG+D+
Sbjct: 242 YSQGKGDEESGSYYDQNGKSLQQKEGFNTEPVAYTRISSPFGYRVHPVLHTVRMHTGIDY 301

Query: 519 AAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQG 578
           AAP GTPI A  DG V    W GGYG   +I H NG  + Y H  A +     G  V+ G
Sbjct: 302 AAPTGTPIKAAADGEVIFKGWKGGYGNTVMIRHANGVETLYGHMSAFSP--ADG-RVRAG 358

Query: 579 QIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLL 638
           ++IG++GTTG STGPHLHYE  VNG  V+ T V +P  + L    +  F  ++K  +++L
Sbjct: 359 EVIGFVGTTGRSTGPHLHYEARVNGQPVNPTTVALPTPK-LTPTNMAAFRKQQKDASTML 417

Query: 639 NNGEN 643
           +   +
Sbjct: 418 STIRS 422


>gi|218680319|ref|ZP_03528216.1| putative transmembrane peptidase family protein [Rhizobium etli
           CIAT 894]
          Length = 397

 Score =  319 bits (816), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 121/390 (31%), Positives = 209/390 (53%), Gaps = 13/390 (3%)

Query: 11  DILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQK 70
            ++ S G+ PP+L +        +RR+VSLRWLS TF  GITS V++G +L  ALDG Q+
Sbjct: 1   MMIRSLGNEPPLLADGRRA---PDRREVSLRWLSGTFLTGITSSVLMGVALFAALDGRQQ 57

Query: 71  IAIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIK 130
           +AIP   +   +   A              ++P   +K  ++ I+EV T++ D  K++++
Sbjct: 58  LAIP---AEAYASAAADAHEDTAVVRGGRLIAPAIAAKPSDRAIMEVSTVVHDGEKEVVR 114

Query: 131 KIPFAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVD-SFEVTTQKI 189
           + PFA+ +MT A  +   +D+P FDPL IFS  + + + Q     I+  D   EV+ + I
Sbjct: 115 RQPFAHVKMTLAANHVATEDYPDFDPLAIFSADEPQPAPQSRTGAIYGSDVESEVSLKTI 174

Query: 190 NFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRH-DHPITY 248
            FPT  + +++      EE++  + +   +L +   Q   LYY DP+       D  +T 
Sbjct: 175 PFPTGKSSMKMASGLSLEEVEENVRSNGSVLTDGNTQLAALYYVDPRRFSNEDADVDLTA 234

Query: 249 SKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKAL 308
               +++E+N T+++ + +  +  EFADD++P++ +T I  A+  +GY    +  IA  +
Sbjct: 235 GLSARVLEQNMTVSASESITPQTEEFADDILPVRVDTPIAKALTDSGYPQQYADGIAGFI 294

Query: 309 KNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKM 368
             ++    L K ++LRIG++QK ++  I+R S+Y   +HL+T+A++D   YV G EP  +
Sbjct: 295 SQQLGSTDLDKGDVLRIGIIQKGEQAKIIRASVYRGTRHLVTVAVDDKGRYVPGSEPPML 354

Query: 369 DINHQMDYMRTSEES-----PNIYDGIWRA 393
           D         +         P +YDGI+RA
Sbjct: 355 DAIATAFDDNSFAPPPGQNLPRVYDGIYRA 384


>gi|325924894|ref|ZP_08186326.1| metalloendopeptidase-like membrane protein [Xanthomonas perforans
           91-118]
 gi|325544681|gb|EGD16032.1| metalloendopeptidase-like membrane protein [Xanthomonas perforans
           91-118]
          Length = 472

 Score =  319 bits (816), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 91/379 (24%), Positives = 153/379 (40%), Gaps = 14/379 (3%)

Query: 266 VLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRI 325
                 P    +++ ++   T+       G       ++      +  + +L     +  
Sbjct: 91  SRKQLAPSTDWEILQVKPGQTLSTLFGELGIPTTVMYQVLAHPGTKEALTKLRPGTEIAF 150

Query: 326 GVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPN 385
            +        +          H + + L          + V+ ++  +    RT   S  
Sbjct: 151 DMPTPG---QLRALRFDRDDSHRVELRL--------LGDAVRENVTERATTTRTVVASGE 199

Query: 386 IYDGIWRATSFNGMNSNLVKLIM-RTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDS 444
           I   ++ +   +G++   V ++        ++  + L+P D             +     
Sbjct: 200 ISSSLYASAGKSGLSPAAVAIMTDEIFKYDIDFDKDLQPGDRFSVVMDETWREGERISTG 259

Query: 445 ELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYH 504
           ++L      G      +RF        EYF+  G+  +   +R PV + R++S FG R H
Sbjct: 260 DILAATFTTGGKTYTGFRFE-RAGKPAEYFDITGRPLKKSFIRMPVAYSRISSTFGARKH 318

Query: 505 PILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDA 564
           P+LG  RMH GVD+AA  GTPI+A GD  V       GYG   ++ HG  Y + Y H   
Sbjct: 319 PVLGTMRMHKGVDYAAASGTPIMAAGDARVVFVGTQRGYGNVVILDHGKNYSTLYGHMSR 378

Query: 565 IAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLL 624
             K IKAG  + QG +IG++G TGL+TGPHLHYE  V G + +   V +P  E L+G  L
Sbjct: 379 FGK-IKAGQRINQGTVIGYVGMTGLATGPHLHYEFRVGGQQRNPMSVTMPPPEPLQGAEL 437

Query: 625 QRFAMEKKRINSLLNNGEN 643
             F  +     + +   E 
Sbjct: 438 AAFRAQTAPAMARIEGMEK 456


>gi|297172839|gb|ADI23802.1| membrane proteins related to metalloendopeptidases [uncultured
           gamma proteobacterium HF4000_47G05]
          Length = 483

 Score =  319 bits (816), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 90/383 (23%), Positives = 158/383 (41%), Gaps = 17/383 (4%)

Query: 260 TITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTK 319
           ++ +  V       + D  I I+   ++             +  IA   K +V +  L  
Sbjct: 114 SVPTQTVASSTKSNWVD--IDIRPGDSLTRIFNRLKLDPAVAITIAAHRKGQV-LTSLKT 170

Query: 320 DEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRT 379
              L+I +                  K LL +   DN         ++ D  ++   +  
Sbjct: 171 GPRLKIRLT----DGQFRELEYEKSLKQLLLVKTTDNG--------LRFDTVNRSFEVIE 218

Query: 380 SEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQ 439
            + +  I   ++ +    G++  L+  +M T    ++    ++  D     +       +
Sbjct: 219 QKATGVIASTLFDSGLKAGLSEPLLYKLMSTFEWQIDFNTDIRSGDQFAVIYEERFLEGR 278

Query: 440 ASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGF 499
                 +L              R      G V YF+ +G S +   L +PV   R+TSG+
Sbjct: 279 KIGTGTVLAASFILSGKPHHAIRH-TDSAGIVRYFSLDGTSMQGKFLHSPVRNSRITSGY 337

Query: 500 GMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSS 558
            +R  HPIL   R H G+D++   G  +++  DG V      G YGK  +I HG+ Y + 
Sbjct: 338 SLRRFHPILKVWRPHRGLDFSGRNGNSVLSTADGKVVFVGRKGNYGKTVIIKHGSNYRTL 397

Query: 559 YNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPEREN 618
           Y H     K ++ G  V+QGQIIG++G+TGLST PHLHYEL +NG + +  K+++P   +
Sbjct: 398 YAHLSKYGKKVRKGRWVQQGQIIGYVGSTGLSTSPHLHYELWLNGKRRNPLKLKLPRATS 457

Query: 619 LKGDLLQRFAMEKKRINSLLNNG 641
           ++ +    F       ++ LN  
Sbjct: 458 VRQNEKSEFLRRASTFSAALNRL 480


>gi|21244617|ref|NP_644199.1| hypothetical protein XAC3898 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21110299|gb|AAM38735.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 472

 Score =  318 bits (815), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 92/379 (24%), Positives = 155/379 (40%), Gaps = 14/379 (3%)

Query: 266 VLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRI 325
                 P    +++ ++   T+       G       ++      +  + +L     +  
Sbjct: 91  SRKQLAPSTDWEILQVKPGQTLSTLFGELGIPTTVMYQVLAHPGTKEVLTKLRPGTEIAF 150

Query: 326 GVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPN 385
            +  +     +          H + + L          + V+ ++  +    RT   S  
Sbjct: 151 DMPTRG---QLRALRFDRDDSHRVELRL--------LGDAVRENVTERATTTRTVVASGE 199

Query: 386 IYDGIWRATSFNGMNSNLVKLIM-RTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDS 444
           I   ++ +   +G++   V ++        ++  + L+P D             +     
Sbjct: 200 ISSSLYASAGKSGLSPAAVAIMTDEIFKYDIDFDKDLQPGDRFSVVMDETWREGERISTG 259

Query: 445 ELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYH 504
           ++L      G      +RF        EYF+ NG+  +   +R PV + R++S FG R H
Sbjct: 260 DILAATFTTGGKTYTGFRFE-RAGKPAEYFDINGRPLKKSFIRMPVAYSRISSTFGARKH 318

Query: 505 PILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDA 564
           P+LG  RMH GVD+AA  GTPI+A GD  V       GYG   ++ HG  Y + Y H   
Sbjct: 319 PVLGTMRMHKGVDYAAASGTPIMAAGDARVVFVGTQRGYGNVVILDHGKNYSTLYGHMSR 378

Query: 565 IAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLL 624
             K IKAG  + QG +IG++G TGL+TGPHLHYE  V G + +   V +P  E L+G  L
Sbjct: 379 FGK-IKAGQRINQGTVIGYVGMTGLATGPHLHYEFRVGGQQRNPMSVTMPPPEPLQGVEL 437

Query: 625 QRFAMEKKRINSLLNNGEN 643
             F  +     + +   E 
Sbjct: 438 AAFRAQTAPAMARIEGMEK 456


>gi|166710377|ref|ZP_02241584.1| hypothetical protein Xoryp_02580 [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 472

 Score =  318 bits (814), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 88/379 (23%), Positives = 155/379 (40%), Gaps = 14/379 (3%)

Query: 266 VLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRI 325
                 P    +++ ++   T+       G       ++      +  + +L     +  
Sbjct: 91  SRKQLAPSTDWEILQVKPGQTLSTLFGELGIPTALMYQVLAHPGTKEALTKLRPGAEIAF 150

Query: 326 GVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPN 385
            +        +        + H + + L          + V+ ++  +    RT   S  
Sbjct: 151 DMPTPG---QLRALRFDRDESHRVELRL--------LGDSVRENVTERATTTRTVVASGE 199

Query: 386 IYDGIWRATSFNGMNSNLVKLIM-RTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDS 444
           I   ++ +   +G++   V ++        ++  + L+P D             +     
Sbjct: 200 INSSLYASAGKSGLSPAAVAIMTDEIFKYDIDFDKDLQPGDRFSVVMDETWREGERISTG 259

Query: 445 ELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYH 504
           ++L      G      +RF        EY++ +G+  +   +R PV + R++S FG R H
Sbjct: 260 DILAATFTTGGKTYTGFRFE-RAGKPAEYYDISGRPLKKSFIRMPVAYSRISSTFGARMH 318

Query: 505 PILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDA 564
           P+LG  RMH GVD+AA  GTPI+A GD  V       GYG   ++ HG  Y + Y H   
Sbjct: 319 PVLGTMRMHKGVDYAAASGTPIMAAGDARVVFVGTQHGYGNVVILDHGKNYSTLYGHMSR 378

Query: 565 IAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLL 624
             K IK G  + QG +IG++G TG++TGPHLHYE  V+G + +   V +P  E L+G  L
Sbjct: 379 FGK-IKVGQHINQGTVIGYVGMTGMATGPHLHYEFRVDGQQRNPMSVTMPPPEPLQGTEL 437

Query: 625 QRFAMEKKRINSLLNNGEN 643
             F  +     + +   E 
Sbjct: 438 AAFRAQTAPALARIEGMEK 456


>gi|262173154|ref|ZP_06040831.1| cell wall endopeptidase family M23/M37 [Vibrio mimicus MB-451]
 gi|261890512|gb|EEY36499.1| cell wall endopeptidase family M23/M37 [Vibrio mimicus MB-451]
          Length = 413

 Score =  318 bits (814), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 86/396 (21%), Positives = 154/396 (38%), Gaps = 19/396 (4%)

Query: 250 KKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALK 309
            +   +  + T  + +          D    I+    +       G++  +  K+ +   
Sbjct: 30  PEASFVPFSNTEGATEQTEVIKAGHPDYEYEIKPGDNLSTIFSQLGFAYTELMKVMETDL 89

Query: 310 NEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMD 369
           N + +D L    +LR    + +   T+ +  +             D+  Y       + +
Sbjct: 90  NYLALDTLRPGNVLRFWKGKDN---TLSKMELEFSLVDRAVYTRLDDGSY-------EFE 139

Query: 370 INHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLET 429
                   +       +      + +  G+ +  V  I+  L   +N    L+  D  E 
Sbjct: 140 ERKIPGTWKVEPLIGEVDGSFSLSANRAGLGAADVDQIVTLLKDKINFGRDLRRGDRFEV 199

Query: 430 FFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTP 489
             S     ++ + +SE+  I           Y   +       Y+++NG S +    R P
Sbjct: 200 VLSRQFVGDKLTGNSEIQAIKIFNRGKEITAYLHQDGQ-----YYDKNGDSLQRAFQRYP 254

Query: 490 VPFGR-MTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQT 547
           V     ++S F  +  HP+      H G D+A P GTP+ + GDG+V         G   
Sbjct: 255 VDSKWRISSNFDPKRLHPVTKRVAPHNGTDFAMPIGTPVYSSGDGVVVMTRSHPYAGNYV 314

Query: 548 LIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVD 607
           ++ HG+ Y++ Y H   I   +K G  V +GQ IG  G TG  TGPHLHYELIV G  V+
Sbjct: 315 VVQHGSTYMTRYLHLSKIL--VKKGQKVSRGQRIGSSGNTGRVTGPHLHYELIVRGRAVN 372

Query: 608 STKVRIPERENLKGDLLQRFAMEKKRINSLLNNGEN 643
           + K  IP   ++    + +F  ++K +  +L   E+
Sbjct: 373 AMKANIPMASSVPKKEMAQFVAKRKELEQMLAQQES 408


>gi|327485311|gb|AEA79717.1| Cell wall endopeptidase, family M23/M37 [Vibrio cholerae LMA3894-4]
          Length = 416

 Score =  318 bits (814), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 89/396 (22%), Positives = 158/396 (39%), Gaps = 22/396 (5%)

Query: 250 KKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALK 309
            +  +++ +    + +V+    P++  +   I+    +       G++  +  K+ +   
Sbjct: 36  PESPLVQFSSAEHTVEVVKVGHPDYEYE---IKPGDNLSTIFNQLGFAYTELMKVMETDL 92

Query: 310 NEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMD 369
           N + +D L    +LR     K    T+ +  +             ++  Y       + +
Sbjct: 93  NYLALDTLRPGNVLRFW---KGSDNTLAKMELEFSLVDRAVYTRLNDGSY-------EFE 142

Query: 370 INHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLET 429
                   +       +      + +  G+ +  V  I+  L   +N    L+  D  E 
Sbjct: 143 ERKIPGTWKVEPLIGEVDGSFSLSANRAGLGAADVDQIVTLLKDKINFGRDLRRGDRFEV 202

Query: 430 FFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTP 489
             S      + + +SE+  I           Y   +       Y+++NG S +    R P
Sbjct: 203 VLSRQLVGEKLTGNSEIQAIKIFNRGKEITAYLHQDGQ-----YYDKNGDSLQRAFQRYP 257

Query: 490 VPFGR-MTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQT 547
           V     ++S F  R  HP+      H G D+A P GTP+   GDG+V         G   
Sbjct: 258 VDSKWRISSNFDPRRLHPVTKRVAPHNGTDFAMPIGTPVYTSGDGVVVMTRNHPYAGNYV 317

Query: 548 LIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVD 607
           +I HGN Y++ Y H   I   +K G  V +GQ IG  G TG  TGPHLHYELIV G  V+
Sbjct: 318 VIQHGNTYMTRYLHLSKIL--VKKGQKVSRGQRIGLSGNTGRVTGPHLHYELIVRGRPVN 375

Query: 608 STKVRIPERENLKGDLLQRFAMEKKRINSLLNNGEN 643
           + K  IP   ++    + +F  ++K ++ +L   E+
Sbjct: 376 AMKANIPMASSVPKKEMAQFIAKRKELDQMLARQES 411


>gi|170727399|ref|YP_001761425.1| peptidase M23B [Shewanella woodyi ATCC 51908]
 gi|169812746|gb|ACA87330.1| peptidase M23B [Shewanella woodyi ATCC 51908]
          Length = 438

 Score =  318 bits (814), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 91/398 (22%), Positives = 152/398 (38%), Gaps = 23/398 (5%)

Query: 243 DHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSA 302
              +     I  I    T ++P  +    P++   ++      T+    V AG       
Sbjct: 57  PQRVPVELDIDAILAQLTPSTPVEVQSSQPDYVKSIV---SGDTLSGLFVDAGVDQQSMY 113

Query: 303 KIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLG 362
            + +A  + + +D L     +   +    DK  + +  +Y      +  +  D+ +Y   
Sbjct: 114 HVLEADLDVLALDTLKPGNKISFWLD---DKGELQKLELYFSAARQVVFSRFDDGDY--- 167

Query: 363 VEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLK 422
               K+D  +     +    S +I    + +    G+N+  ++ I   L   +N    L+
Sbjct: 168 ----KVDEINIDGIWQNRTVSGDIQGSFYLSAKRAGLNAAEIQRIESLLKEKLNFARDLR 223

Query: 423 PTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSR 482
             D      +    +  A+  S++L I               +  +    ++++ G+S  
Sbjct: 224 AGDTFSVLMNDQFIDGNATGSSDILGITI-HRGRSDINAYQNSDGN----FYDDQGRSLS 278

Query: 483 PFLLRTP-VPFGRMTSGFGMRYH-PILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWA 540
               R P     R++S F    H P+ G    H G D+A P GT IVA GDGIV      
Sbjct: 279 RAFQRIPLQKNYRISSNFNRNRHHPVTGRVTHHNGTDFATPIGTKIVAPGDGIVSLVTKH 338

Query: 541 GGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELI 600
              G   +I HGN Y + Y H       +  G  V +GQ+I   G TG  TGPHLHYE  
Sbjct: 339 RFAGTYVVIEHGNKYRTRYLHLSKAL--VHKGQRVSRGQVIALSGNTGRVTGPHLHYEFH 396

Query: 601 VNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLL 638
           VNG  V+  K  IP    L    +  F     +I  ++
Sbjct: 397 VNGRPVNPMKANIPMASKLSSKEMSEFQQLV-KIRQMM 433


>gi|297183696|gb|ADI19821.1| membrane proteins related to metalloendopeptidases [uncultured
           alpha proteobacterium EB000_37G09]
          Length = 382

 Score =  317 bits (813), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 96/365 (26%), Positives = 166/365 (45%), Gaps = 6/365 (1%)

Query: 283 HNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIY 342
              T+   +   G      + I+KAL  ++ + +L       +G    +    +      
Sbjct: 3   KGDTLAKLLARGGAPAQARSAISKALAVQMDLRRLQIGTKFTLGFDSDETVTALQVHVPR 62

Query: 343 HKQKHLLTIALNDNNEYVLGVEP---VKMDINHQMDYMRTSEESPNIYDGIWRATSFNGM 399
            K+  L        + + L  E           +    +  +    I   ++R+ S   +
Sbjct: 63  LKRSGLSRREGAYLDLFALKSEELGGWISLKALRPLSSQLVQSGNFIDYSLYRSASQVKI 122

Query: 400 NSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHAN--NQASDDSELLYIHARFGETR 457
               +   +R +  SV+ Q  ++  D  E  +               EL+Y        +
Sbjct: 123 PPPTLDEFVRVMGFSVDFQRQIRQNDQFELIYEKTVDALTGNELSSGELIYAGIILSGNK 182

Query: 458 TRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVD 517
             F+R ++       +++ NG S+   L+RTPV   R++SGFG+R HP+ G+S MH G+D
Sbjct: 183 IEFFRHVSATG-KTSWYDRNGNSAVRTLMRTPVNGARLSSGFGVRRHPVTGFSAMHRGID 241

Query: 518 WAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQ 577
           +A P+GTPI+A G G++E + W G YGK   I H + Y ++Y H   IA     G  V+Q
Sbjct: 242 FAVPKGTPILAAGSGVIESSGWNGNYGKYIRIRHDSTYKTAYAHMSRIASRAVVGRYVEQ 301

Query: 578 GQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSL 637
           G +IG++G+TG STGPHLHYE++VN  +++   V++P  E L     + F      + S 
Sbjct: 302 GDVIGFVGSTGRSTGPHLHYEIMVNNRQLNPLTVQLPTAEELPDAEREDFLASIALLESQ 361

Query: 638 LNNGE 642
           +++  
Sbjct: 362 ISDTP 366


>gi|163751111|ref|ZP_02158341.1| peptidase, M23/M37 family protein [Shewanella benthica KT99]
 gi|161329067|gb|EDQ00139.1| peptidase, M23/M37 family protein [Shewanella benthica KT99]
          Length = 414

 Score =  317 bits (813), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 88/376 (23%), Positives = 150/376 (39%), Gaps = 19/376 (5%)

Query: 259 RTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLT 318
            T   P+  ++ I    D +  I    T+    + A        ++ +A  N + +D L 
Sbjct: 47  ITQLKPRTRVENIITRPDFMHKITSGDTLSGLFMQASVDQQTMYRVLEADLNVLALDTLK 106

Query: 319 KDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMR 378
               ++  +    DK  + +  +Y    H +     D+  + +    ++        + R
Sbjct: 107 PGNQIKFWLD---DKGELEKLQLYFSAAHQVVFTRFDDGSFNVDDINIE-------GFWR 156

Query: 379 TSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANN 438
               S  I+   + +    G+N+  ++ I   L   +N    L+  D      +    + 
Sbjct: 157 NRSVSGEIHGSFYVSAKKIGLNAGEIQRIESLLKEKLNFSRDLRAGDRFSVLMNDQFIDG 216

Query: 439 QASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPV-PFGRMTS 497
            A+  S++L I    G +    ++  +       ++++ G+S      R P+    R++S
Sbjct: 217 TATGASDILGITIHRGRSDITAFQNSDGN-----FYDDQGRSLSRAFQRIPLLKNYRISS 271

Query: 498 GFGMRYH-PILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYV 556
            F    H P+ G +  H G D+A P GT ++A GDGIV         GK  +I HGN Y 
Sbjct: 272 RFNRHRHHPVTGRTSPHNGTDFATPIGTKVIAPGDGIVTLVTNHRYAGKYVVIQHGNKYR 331

Query: 557 SSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPER 616
           + Y H       +  G  V +GQ+I   G TG  TGPHLHYE  VNG  V+     IP  
Sbjct: 332 TRYLHLSKAL--VHKGQRVTRGQVIALSGNTGRITGPHLHYEFHVNGRPVNPMTANIPMS 389

Query: 617 ENLKGDLLQRFAMEKK 632
             L    +  F    K
Sbjct: 390 SKLSKKQMNEFEQLVK 405


>gi|255746096|ref|ZP_05420043.1| cell wall endopeptidase family M23/M37 [Vibrio cholera CIRS 101]
 gi|262162066|ref|ZP_06031081.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae INDRE 91/1]
 gi|262169004|ref|ZP_06036698.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae RC27]
 gi|255735850|gb|EET91248.1| cell wall endopeptidase family M23/M37 [Vibrio cholera CIRS 101]
 gi|262022703|gb|EEY41410.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae RC27]
 gi|262028141|gb|EEY46799.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae INDRE 91/1]
          Length = 362

 Score =  317 bits (813), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 88/370 (23%), Positives = 146/370 (39%), Gaps = 19/370 (5%)

Query: 276 DDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFT 335
           D    I+    +       G++  +  K+ +   N + +D L    +LR     K    T
Sbjct: 5   DYEYEIKPGDNLSTIFNQLGFAYTELMKVMETDLNYLALDTLRPGNVLRFW---KGSDNT 61

Query: 336 IVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATS 395
           + +  +             ++  Y       + +        +       +      + +
Sbjct: 62  LAKMELEFSLVDRAVYTRLNDGSY-------EFEERKIPGTWKVEPLIGEVDGSFSLSAN 114

Query: 396 FNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGE 455
             G+ +  V  I+  L   +N    L+  D  E   S      + + +SE+  I      
Sbjct: 115 RAGLGAADVDQIVTLLKDKINFGRDLRRGDRFEVVLSRQLVGEKLTGNSEIQAIKIFNRG 174

Query: 456 TRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGR-MTSGFGMRY-HPILGYSRMH 513
                Y   +       Y+++NG S +    R PV     ++S F  R  HP+      H
Sbjct: 175 KEITAYLHQDGQ-----YYDKNGDSLQRAFQRYPVDSKWRISSNFDPRRLHPVTKRVAPH 229

Query: 514 TGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGT 573
            G D+A P GTP+   GDG+V         G   +I HGN Y++ Y H   I   +K G 
Sbjct: 230 NGTDFAMPIGTPVYTSGDGVVVMTRNHPYAGNYVVIQHGNTYMTRYLHLSKIL--VKKGQ 287

Query: 574 AVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKR 633
            V +GQ IG  G TG  TGPHLHYELIV G  V++ K  IP   ++    + +F  ++K 
Sbjct: 288 KVSRGQRIGLSGNTGRVTGPHLHYELIVRGRPVNAMKANIPMASSVPKKEMAQFIAKRKE 347

Query: 634 INSLLNNGEN 643
           ++ +L   E+
Sbjct: 348 LDQMLARQES 357


>gi|330447670|ref|ZP_08311318.1| putative uncharacterized protein VC0503 [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328491861|dbj|GAA05815.1| putative uncharacterized protein VC0503 [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 441

 Score =  317 bits (812), Expect = 4e-84,   Method: Composition-based stats.
 Identities = 98/435 (22%), Positives = 161/435 (37%), Gaps = 21/435 (4%)

Query: 221 HNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTIT-SPQVLIDKIPEFADDLI 279
                   T+  A           P      I    E      SP+ +   +        
Sbjct: 19  TLAGISLLTVAAALSINTSTTQHKPTQVQLPISTTPEVVLKALSPKEMKKTVELPPSYEY 78

Query: 280 PIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRF 339
            IQ   T+ +              I +A  N +++D+L     LR  + + D K   +  
Sbjct: 79  KIQKGDTLSEIFDRLSIPYSTIQDIMEADLNTLQIDKLKPGNTLRFWINESDHKLNKLEL 138

Query: 340 SIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGM 399
                Q+       +D+           +           S  + +I+     +    G+
Sbjct: 139 EFSLAQRIDYIRQKDDS---------FDVKEITLPGVWHESVATGSIHGSFTASARKAGL 189

Query: 400 NSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTR 459
           + + ++ IM  L   VN    LK  DF E      +  N  + DSE L     +      
Sbjct: 190 SHSEIQEIMSLLKDKVNFNRDLKAGDFFEVVTKRKYIQNHLTGDSE-LQAIRIYNGKSLI 248

Query: 460 FYRFLNPVDGSVEYFNENGKSSRPFLLRTPVP---FGRMTSGFGMRY-HPILGYSRMHTG 515
                +  +    ++++NG+S +   LR P P     R++S F     HP+ G  + H G
Sbjct: 249 SAYLHSDGN----FYDQNGESLQRAFLRYPYPASKHFRISSPFNPNRVHPVTGRRQPHNG 304

Query: 516 VDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAV 575
           VD+A P GTP++A GDG+V         G+  +I H   Y + Y H   I   +K G  V
Sbjct: 305 VDFATPSGTPVLATGDGVVTLVTNHPYAGRYVVIKHSANYSTRYLHNSRIL--VKQGQHV 362

Query: 576 KQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRIN 635
           K+GQ I   G TG  TGPH+HYE ++ G  V+    +IP   ++     + F ++  + N
Sbjct: 363 KRGQEIALSGRTGRVTGPHIHYEFLIRGKAVNPMTAKIPLAASVPHKEKKEFELQVAQYN 422

Query: 636 SLLNNGENPKKPLFT 650
            L+       K    
Sbjct: 423 KLMKQALETDKNQIA 437


>gi|325919687|ref|ZP_08181689.1| metalloendopeptidase-like membrane protein [Xanthomonas gardneri
           ATCC 19865]
 gi|325549795|gb|EGD20647.1| metalloendopeptidase-like membrane protein [Xanthomonas gardneri
           ATCC 19865]
          Length = 472

 Score =  317 bits (812), Expect = 4e-84,   Method: Composition-based stats.
 Identities = 89/379 (23%), Positives = 155/379 (40%), Gaps = 14/379 (3%)

Query: 266 VLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRI 325
                 P    +++ ++   T+       G       ++      +  + +L     +  
Sbjct: 91  SRKQLAPSTDWEIVQVKSGQTLSTLFGELGLPTTVMYQVLAHPGTKDALTKLRPGAEIAF 150

Query: 326 GVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPN 385
            +    +   +          H + + L          + V+ ++  +    RT   S  
Sbjct: 151 DMPTPGE---LRALRFDRDDSHRVELRL--------LGDSVRENVTERATTTRTVVASGE 199

Query: 386 IYDGIWRATSFNGMNSNLVKLIM-RTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDS 444
           I   ++ +   +G++   V ++        ++  + L+P D             +  +  
Sbjct: 200 ISSSLYASAGKSGLSPAAVAIMTDEIFKYDIDFDKDLQPGDRFSVVMDETWREGERINTG 259

Query: 445 ELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYH 504
           ++L      G      +RF        EYF+  G+  +   +R PV + R++S FG R H
Sbjct: 260 DILAATFTTGGKTYTGFRFE-RAGKPAEYFDITGRPLKKSFIRMPVAYSRISSTFGARRH 318

Query: 505 PILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDA 564
           P+LG  RMH GVD+AA  GTPI+A GD  V       GYG   ++ HG  + + Y H   
Sbjct: 319 PVLGTMRMHKGVDYAAASGTPIMAAGDARVVFVGTQRGYGNVVILDHGRNFSTLYGHMSR 378

Query: 565 IAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLL 624
             K +KAG  + QG +IG++G TGL+TGPHLHYE  V G + +   V +P  E L+G  L
Sbjct: 379 FGK-VKAGQRINQGTVIGYVGMTGLATGPHLHYEFRVAGQQRNPMSVTMPPPEPLQGAEL 437

Query: 625 QRFAMEKKRINSLLNNGEN 643
             F  +     + +   E 
Sbjct: 438 AAFRAQTAPALARIEGMEK 456


>gi|217969657|ref|YP_002354891.1| peptidase M23 [Thauera sp. MZ1T]
 gi|217506984|gb|ACK53995.1| Peptidase M23 [Thauera sp. MZ1T]
          Length = 441

 Score =  317 bits (812), Expect = 4e-84,   Method: Composition-based stats.
 Identities = 82/435 (18%), Positives = 154/435 (35%), Gaps = 14/435 (3%)

Query: 206 DEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQ 265
            +     +      +         L       +       +     ++ + E     +  
Sbjct: 10  ADLPARLLSRPRTWVAAGITGVSMLGVVAATAVAPGS---LPSDLLVERVVEALPAPAVT 66

Query: 266 VLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDS-AKIAKALKNEVRVDQLTKDEILR 324
                          IQ   T+          + ++ A ++ +      + QL     + 
Sbjct: 67  RTGTDASLPFVHYERIQAGDTLQAMFNRLRIDDAEALAHLSASDAGRKALRQLRAGRSVT 126

Query: 325 IGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESP 384
             V  +     ++ FS+         +   D+    L       + +           S 
Sbjct: 127 AVVSPQG---RLLSFSLPVGNTDAEVVLERDDAGLALR------ESSGATQTTMVEMRSG 177

Query: 385 NIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDS 444
            I   ++ AT   G+  N+   +     + ++    L+  D     +   +         
Sbjct: 178 TITHSLFGATDDAGLPDNVATQLATIFGTWIDFHTDLRKGDRFNVVYEAIYEEGNPVRAG 237

Query: 445 ELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYH 504
            +L         R     +  P     +Y++++G+S +   LR+P+ F R++S FG R H
Sbjct: 238 RILAAEFINNGDRHAVVLYRGPSG-KEQYYSDDGESLQQGFLRSPLEFSRVSSNFGRRLH 296

Query: 505 PILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDA 564
           PI G  R H G D++AP GTP++A  D  +E      G+G   ++ H +   + Y H + 
Sbjct: 297 PIHGNWRDHNGTDFSAPVGTPVMATSDATIEFIGTQRGFGNLIVLKHRSDITTHYAHLNG 356

Query: 565 IAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLL 624
            AK +  G AV QG +IG++G TG  TGPHLHYE+ +  +  D   V +P  ++     L
Sbjct: 357 FAKGLAKGQAVSQGDLIGYVGCTGWCTGPHLHYEVRLKDVPADPMTVALPMADSFNDREL 416

Query: 625 QRFAMEKKRINSLLN 639
             F      +     
Sbjct: 417 AAFKRNTAHLRQRFA 431


>gi|260771827|ref|ZP_05880745.1| membrane protein [Vibrio metschnikovii CIP 69.14]
 gi|260613119|gb|EEX38320.1| membrane protein [Vibrio metschnikovii CIP 69.14]
          Length = 430

 Score =  317 bits (811), Expect = 4e-84,   Method: Composition-based stats.
 Identities = 85/378 (22%), Positives = 152/378 (40%), Gaps = 20/378 (5%)

Query: 263 SPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKN-EVRVDQLTKDE 321
           +P   +        +   +    +        G S     ++  +      ++ +L   +
Sbjct: 59  APGSTVLPSALLRWETHNVNSGESAALLFQRLGLSARLLHELTSSDPQINQQLSRLRPGD 118

Query: 322 ILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSE 381
            L+ G  + +    + R            I   D+              + +  + + + 
Sbjct: 119 ELQFGFDENNQFIQLKR---RITPYETFDITRTDSG--------FSARFDKKEVFYQYNY 167

Query: 382 ESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQAS 441
               I    W A    G+ +N +  +       ++    ++  D     F       +  
Sbjct: 168 AQAEITSNFWNAARGAGLTANQIMELAGIFGWDIDFALDIRSGDHFRLLFEEKIVEGEVV 227

Query: 442 DDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGM 501
               ++        T           + + +Y++E G++ +   LR P+ F R++S F  
Sbjct: 228 GRGRIIATQFTNQGTTFTAIL----DEHTGQYYDETGRAMKKAFLRAPLDFRRVSSNFNP 283

Query: 502 RY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYN 560
           R  HP+ G  R H G D+ AP GTPI A GDG+VE++++    G    I H N Y++ Y 
Sbjct: 284 RRLHPVTGQLRAHRGTDYVAPVGTPIWAAGDGVVERSSYNQFNGNYVFIRHSNTYLTKYL 343

Query: 561 HQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLK 620
           H     + +K G  V+QGQ+IG +G TG  TGPHLHYE +VNG+  D   V +P+ ++L 
Sbjct: 344 HLTR--RTVKTGERVRQGQVIGTLGGTGRVTGPHLHYEFLVNGVHKDPRTVDLPQSKSLT 401

Query: 621 GDLLQRFAME-KKRINSL 637
           G     F    K R+++L
Sbjct: 402 GQAKATFLANAKIRLDTL 419


>gi|89889981|ref|ZP_01201492.1| putative metalloendopeptidase [Flavobacteria bacterium BBFL7]
 gi|89518254|gb|EAS20910.1| putative metalloendopeptidase [Flavobacteria bacterium BBFL7]
          Length = 412

 Score =  317 bits (811), Expect = 5e-84,   Method: Composition-based stats.
 Identities = 84/374 (22%), Positives = 156/374 (41%), Gaps = 16/374 (4%)

Query: 272 PEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKD 331
             +   +  ++   T  + +           K A+ L     V ++   +  +I + +KD
Sbjct: 44  NNYEVVIDTVKSGDTFGNIIDQHLVDGQSVFKAAEELDAVYSVRRIQAGKPYKI-LKRKD 102

Query: 332 DKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIW 391
              T   F     +   + +   D+ +      P+K               S  I   + 
Sbjct: 103 SLRTPEAFIYEPTKMDYVVLNFADSLKAYKDKHPLKFVRKTA---------SGVINSTLS 153

Query: 392 RATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHA 451
            A    G+    +  +      S++    L+  D  +  ++  + N+      E +    
Sbjct: 154 EAMEEEGLGMAAIYELSDIYRWSIDFFR-LQKGDRFKMIYTERYINDSIYAGIESIEAAV 212

Query: 452 RFGETR--TRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILG 508
              +      F    + ++   +Y++E GK+ R F L+ PV + R++S F  R  HP+  
Sbjct: 213 FETDETPFYAFDFRTDSINNISDYYDEKGKTLRSFFLKAPVNYSRISSRFTKRRFHPVQK 272

Query: 509 YSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKN 568
             + H G D+AA  GTPIV+  +G+V K+ +  G G    + H N Y + Y H     + 
Sbjct: 273 RWKAHKGTDYAAAYGTPIVSTANGVVIKSGYTRGNGNYVKVKHNNTYSTQYLHMTK--RK 330

Query: 569 IKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFA 628
           +K G  VKQGQ+IG +G+TGL+TGPH+ Y   VNG +VD  K  +P  + L  + ++ + 
Sbjct: 331 VKVGQRVKQGQVIGTVGSTGLATGPHVCYRFWVNGKQVDPYKQNLPSADPLPEEKMEEYL 390

Query: 629 MEKKRINSLLNNGE 642
              + +   ++   
Sbjct: 391 NFIQPLKDEIDLLP 404


>gi|294788166|ref|ZP_06753409.1| M23 peptidase domain protein [Simonsiella muelleri ATCC 29453]
 gi|294483597|gb|EFG31281.1| M23 peptidase domain protein [Simonsiella muelleri ATCC 29453]
          Length = 430

 Score =  316 bits (810), Expect = 6e-84,   Method: Composition-based stats.
 Identities = 96/406 (23%), Positives = 157/406 (38%), Gaps = 13/406 (3%)

Query: 236 QTLDQRHDHPITYSKKIKIIEENR--TITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVH 293
             L                  E    T+  P +              +Q    I D +  
Sbjct: 21  SGLAIATIAQPELPISALYKTEKVVQTLPMPTIPSTTNASSYWYDEEVQTGDPITDVLKR 80

Query: 294 AGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIAL 353
            G +        K    + +  QL   +I+   V    D   +  F+     +  +    
Sbjct: 81  IGATQTSINDFVKNSPFDWKNLQLRTGQIVSARVDSVHDLTDVQFFNDDDNGERNMVALQ 140

Query: 354 NDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLAS 413
             N ++       +++ ++       S  S  I      A S  G+   +   +    A 
Sbjct: 141 RINGKW-------QVNTSNIDTETMPSLRSVVISTSAAGALSRAGVPVEIRTSLKEMFAD 193

Query: 414 SVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEY 473
             NL   L   D +   +   ++  Q      +L               + +  D    Y
Sbjct: 194 KFNLD-ELVEGDTISLLYESLYSRGQEIATGNILAAEVHTKGKTY-HSYYFDQGDAGGNY 251

Query: 474 FNENGKSSRPFLL-RTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDG 532
           ++ENG+S +     +    F R++S +G+R HP+L   +MHTGVD+AAP GT I+A  DG
Sbjct: 252 YDENGESLKEGFAGQPIAHFTRISSPYGIRVHPVLHTIKMHTGVDYAAPTGTQILAPSDG 311

Query: 533 IVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTG 592
           +V    W GGYG   +I H  G  + Y H  A    +  G+AV+ G +IG +GTTG STG
Sbjct: 312 VVSFRGWKGGYGNTIMITHATGIETLYGHMSAFINGVNEGSAVRAGDVIGLVGTTGRSTG 371

Query: 593 PHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLL 638
           PHLHYE+ +NG  V+   V +P  + L    L      +++ +  +
Sbjct: 372 PHLHYEVRINGQHVNPATVALPTPK-LSATDLAALKKYQQKTDETM 416


>gi|260771188|ref|ZP_05880115.1| membrane protein [Vibrio furnissii CIP 102972]
 gi|260613785|gb|EEX38977.1| membrane protein [Vibrio furnissii CIP 102972]
          Length = 430

 Score =  316 bits (810), Expect = 6e-84,   Method: Composition-based stats.
 Identities = 84/372 (22%), Positives = 148/372 (39%), Gaps = 19/372 (5%)

Query: 258 NRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKN-EVRVDQ 316
           N    SP   I        +   +    +        G S      +  +      ++ +
Sbjct: 54  NSEALSPGSTILPSAILRWEKHTVHAGESAAVLFQRIGLSARQLYALTSSNSEINHQLSR 113

Query: 317 LTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDY 376
           L   + L+ G  + +D   + R            ++  +               + +  +
Sbjct: 114 LRPGDELQFGFDENNDLIQLKR-----------KLSAYETFSITKAESGYTSAFDKKEIF 162

Query: 377 MRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHA 436
            + +    +I    W A     + +N +  +       ++    ++  D  +  +     
Sbjct: 163 YQYNYAEADISSNFWNAAMGARLTANQIMELAGIFGWDIDFALDIRAGDNFKLLYQEKVV 222

Query: 437 NNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMT 496
             +      ++        T           D +  Y++ENG++ +   LR+P+ F R++
Sbjct: 223 EGEVIGRGNIIAAMFTNQGTTFTAIL----DDNTGNYYDENGRAMKKAFLRSPLDFRRVS 278

Query: 497 SGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGY 555
           S F     HP+ G  + H G D+ AP GTPI A GDGIVEK+++    G    I H N Y
Sbjct: 279 SNFNPNRLHPVTGQVKAHRGTDYVAPVGTPIWAAGDGIVEKSSYNQFNGNYVFIRHSNTY 338

Query: 556 VSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPE 615
           ++ Y H     + +K G  VKQGQ+IG +G TG  TGPHLHYE +VNG+  +   V +P+
Sbjct: 339 ITKYLHLTR--RTVKTGQRVKQGQVIGTLGGTGRVTGPHLHYEFLVNGVHKNPRTVALPQ 396

Query: 616 RENLKGDLLQRF 627
            ++L G     F
Sbjct: 397 SKSLNGKAKDTF 408


>gi|126173888|ref|YP_001050037.1| peptidase M23B [Shewanella baltica OS155]
 gi|125997093|gb|ABN61168.1| peptidase M23B [Shewanella baltica OS155]
          Length = 433

 Score =  316 bits (810), Expect = 6e-84,   Method: Composition-based stats.
 Identities = 87/401 (21%), Positives = 152/401 (37%), Gaps = 23/401 (5%)

Query: 245 PITYSKKIKIIEEN----RTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGD 300
           P      + +  EN     +    Q     I         I    T+      AG     
Sbjct: 48  PTAQRIPVVLDIENILPQVSEPEVQDQATLINNAPQFERIIVSGDTLSGLFSKAGVDQQT 107

Query: 301 SAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYV 360
             K+ +A  N + +D L     ++  +  +     + +  +Y      +     ++  + 
Sbjct: 108 MYKVLEADLNILALDTLLPGNRMQFWLDNEG---KLQKLELYFNAARQVVFTRYEDGSF- 163

Query: 361 LGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEH 420
                  ++  +     +    S +I    + +    G+ +  ++ I   L   +N    
Sbjct: 164 ------NVEEVNVEGVWQNRIISGDIKGSFYVSAQKMGLAAADIQRIEDLLKEKLNFARD 217

Query: 421 LKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKS 480
           L+  D      +  +   +A+  S++L +  + G +    +++ +       Y++  G+S
Sbjct: 218 LRVGDKFSVLVNDQYVEGEATGSSQILGVSIKTGRSEISAFQYTDGS-----YYDAKGQS 272

Query: 481 SRPFLLR-TPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKAN 538
                 R       RM+S F     HPI G    H G D++ P GT ++A GDG+V    
Sbjct: 273 LVRAFQRYPLAKQPRMSSRFNPYRKHPITGRISPHNGTDFSVPIGTKVIAPGDGVVSLVT 332

Query: 539 WAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYE 598
                GK  +I HG  Y + Y H       ++ G  V +GQ+I   G TG STGPHLHYE
Sbjct: 333 DHQFAGKYIVIDHGGKYRTRYLHLSKAL--VRKGQRVTRGQVIALSGNTGRSTGPHLHYE 390

Query: 599 LIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLN 639
             +NG  VD  K  IP    L    L+ F    K   +++N
Sbjct: 391 FHINGKPVDPLKADIPMSSKLANQDLRTFTNMVKSREAMMN 431


>gi|153000168|ref|YP_001365849.1| peptidase M23B [Shewanella baltica OS185]
 gi|160874795|ref|YP_001554111.1| peptidase M23B [Shewanella baltica OS195]
 gi|217973864|ref|YP_002358615.1| peptidase M23 [Shewanella baltica OS223]
 gi|304409759|ref|ZP_07391379.1| Peptidase M23 [Shewanella baltica OS183]
 gi|307304115|ref|ZP_07583868.1| Peptidase M23 [Shewanella baltica BA175]
 gi|151364786|gb|ABS07786.1| peptidase M23B [Shewanella baltica OS185]
 gi|160860317|gb|ABX48851.1| peptidase M23B [Shewanella baltica OS195]
 gi|217498999|gb|ACK47192.1| Peptidase M23 [Shewanella baltica OS223]
 gi|304352277|gb|EFM16675.1| Peptidase M23 [Shewanella baltica OS183]
 gi|306913013|gb|EFN43436.1| Peptidase M23 [Shewanella baltica BA175]
 gi|315267033|gb|ADT93886.1| Peptidase M23 [Shewanella baltica OS678]
          Length = 433

 Score =  316 bits (810), Expect = 6e-84,   Method: Composition-based stats.
 Identities = 87/401 (21%), Positives = 152/401 (37%), Gaps = 23/401 (5%)

Query: 245 PITYSKKIKIIEEN----RTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGD 300
           P      + +  EN     +    Q     I         I    T+      AG     
Sbjct: 48  PTAQRIPVVLDIENILPQVSEPEVQDQATLINNAPQFERIIVSGDTLSGLFSKAGVDQQT 107

Query: 301 SAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYV 360
             K+ +A  N + +D L     ++  +  +     + +  +Y      +     ++  + 
Sbjct: 108 MYKVLEADLNILALDTLLPGNRMQFWLDNEG---QLQKLELYFNAARQVVFTRYEDGSF- 163

Query: 361 LGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEH 420
                  ++  +     +    S +I    + +    G+ +  ++ I   L   +N    
Sbjct: 164 ------NVEEVNVEGVWQNRIISGDIKGSFYVSAQKMGLAAADIQRIEDLLKEKLNFARD 217

Query: 421 LKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKS 480
           L+  D      +  +   +A+  S++L +  + G +    +++ +       Y++  G+S
Sbjct: 218 LRVGDKFSVLVNDQYVEGEATGSSQILGVSIKTGRSEISAFQYTDGS-----YYDAKGQS 272

Query: 481 SRPFLLR-TPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKAN 538
                 R       RM+S F     HPI G    H G D++ P GT ++A GDG+V    
Sbjct: 273 LVRAFQRYPLAKQPRMSSRFNPYRKHPITGRISPHNGTDFSVPIGTKVIAPGDGVVSLVT 332

Query: 539 WAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYE 598
                GK  +I HG  Y + Y H       ++ G  V +GQ+I   G TG STGPHLHYE
Sbjct: 333 DHQFAGKYIVIDHGGKYRTRYLHLSKAL--VRKGQRVTRGQVIALSGNTGRSTGPHLHYE 390

Query: 599 LIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLN 639
             +NG  VD  K  IP    L    L+ F    K   +++N
Sbjct: 391 FHINGKPVDPLKADIPMSSKLANQDLRTFTNMVKSREAMMN 431


>gi|254505836|ref|ZP_05117981.1| membrane protein [Vibrio parahaemolyticus 16]
 gi|219551059|gb|EED28039.1| membrane protein [Vibrio parahaemolyticus 16]
          Length = 409

 Score =  316 bits (810), Expect = 7e-84,   Method: Composition-based stats.
 Identities = 88/391 (22%), Positives = 148/391 (37%), Gaps = 18/391 (4%)

Query: 255 IEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRV 314
           I E++ ++       +I +  D    +Q    +       G+       +     N + +
Sbjct: 23  IPESQIVSDILQTEQEIVDLPDYEYTVQPGDNLSTIFDQLGFGYSQLMNVMATDLNYLAL 82

Query: 315 DQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQM 374
           D L    +LR    + D     +                 D+  Y         +     
Sbjct: 83  DTLKPGNVLRFWKGEHDSILEKMELEF--SLVESAVYTRLDDGSY-------SFEDVKIP 133

Query: 375 DYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVN 434
               +     +I     ++    G++SN +  ++  L   +N    L+  D  E   S  
Sbjct: 134 GQWGSFALVGDIKGSFSQSAYALGLSSNEINQVVSLLKEKINFSRDLRAGDKFEVVQSKQ 193

Query: 435 HANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGR 494
             +   + + EL  +           Y   +       Y+++NG+S +    R PV    
Sbjct: 194 FVDGVFTGNRELQAVKIVNRGRELTAYLHTDGQ-----YYDKNGESLQRAFQRKPVNGRY 248

Query: 495 -MTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHG 552
            ++S F     HP+ G    H G DWA P GTPIV+ GDG+V         G   +I HG
Sbjct: 249 RLSSHFNPHRKHPVTGRVSPHNGTDWATPTGTPIVSTGDGVVIMTRKHPYAGNYVVIQHG 308

Query: 553 NGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVR 612
           + Y + Y H   I   ++ G  V +GQ IG  G TG  TGPH+HYEL+  G  V++ K  
Sbjct: 309 SRYKTRYLHLSKIL--VRKGQKVSRGQRIGLSGATGRVTGPHIHYELLDRGRAVNAMKAN 366

Query: 613 IPERENLKGDLLQRFAMEKKRINSLLNNGEN 643
           IP   ++    +  F   +  +N++L   E 
Sbjct: 367 IPMASSVPKKEMAAFNQRRDELNAMLKEQER 397


>gi|261251463|ref|ZP_05944037.1| cell wall endopeptidase family M23/M37 [Vibrio orientalis CIP
           102891]
 gi|260938336|gb|EEX94324.1| cell wall endopeptidase family M23/M37 [Vibrio orientalis CIP
           102891]
          Length = 417

 Score =  316 bits (810), Expect = 7e-84,   Method: Composition-based stats.
 Identities = 91/418 (21%), Positives = 161/418 (38%), Gaps = 18/418 (4%)

Query: 227 SFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTT 286
           + T+       +    DH  T         E++ + +  +  D I +  +    IQ    
Sbjct: 3   ALTVPVIAAIAVSTTSDHSGTQRTIELSFPESKIVNNILMEQDLIEDRPNYEYVIQAGDN 62

Query: 287 IFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQK 346
           +       G+   +  KI +   N + +D L     LR    +  +   + +  +     
Sbjct: 63  LSSIFEQLGFGYSELMKIMETDLNFLVLDTLKPGNTLRFWRDE--ETGALNKMELEFTLV 120

Query: 347 HLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKL 406
                +  D+  Y       +          ++      I      + +  G+  + ++ 
Sbjct: 121 ERAVYSRLDDGSY-------EFKDIKIPGVWKSFPLVGEINGSFSTSVNALGLGKSEIEQ 173

Query: 407 IMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNP 466
           ++  L   VN    L+  D  E   S    +++ + + E+  +           Y   + 
Sbjct: 174 VVALLKDKVNFARDLRAGDRFEVVQSRQFVDDKLTGNREIQAVKIFNQGRELAAYLHSDG 233

Query: 467 VDGSVEYFNENGKSSRPFLLRTPVPF-GRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGT 524
                 Y+++NG S +    R PV    R++S F     HP+ G    H G DWA P GT
Sbjct: 234 Q-----YYDQNGDSLQRAFQRKPVNGSYRLSSNFNPYRKHPVTGRVSPHNGTDWAVPTGT 288

Query: 525 PIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWI 584
           PIV+ GDG+V         G   +I HG+ Y + Y H   I   ++ G  + +GQ IG  
Sbjct: 289 PIVSTGDGVVIMTRKHPYAGNYVVIQHGSRYKTRYLHLSKIL--VRKGQKISRGQRIGLS 346

Query: 585 GTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGE 642
           G TG  TGPH+HYELI  G  V++ K  IP   ++    +  F   +  ++++L   E
Sbjct: 347 GATGRVTGPHIHYELIDRGRPVNAMKANIPMANSVPKSQMAAFEARRHEMDTMLRQKE 404


>gi|120599370|ref|YP_963944.1| peptidase M23B [Shewanella sp. W3-18-1]
 gi|146292633|ref|YP_001183057.1| peptidase M23B [Shewanella putrefaciens CN-32]
 gi|120559463|gb|ABM25390.1| peptidase M23B [Shewanella sp. W3-18-1]
 gi|145564323|gb|ABP75258.1| peptidase M23B [Shewanella putrefaciens CN-32]
 gi|319425937|gb|ADV54011.1| Peptidase M23 [Shewanella putrefaciens 200]
          Length = 431

 Score =  316 bits (809), Expect = 8e-84,   Method: Composition-based stats.
 Identities = 85/388 (21%), Positives = 154/388 (39%), Gaps = 22/388 (5%)

Query: 254 IIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVR 313
           I+ +         +ID  P+F   ++      T+      AG  +    ++ +A  N + 
Sbjct: 62  ILPQTSESIEQAAIIDNTPDFERIIV---SGDTLSGLFSKAGVDHQTMYRVLEADLNILA 118

Query: 314 VDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQ 373
           +D L     ++  +        + +  +Y      +     ++  +        ++  + 
Sbjct: 119 LDTLLPGNRIQFWLDNDG---QLQKLELYFNAARQVVFTRYEDGSF-------NVEEVNV 168

Query: 374 MDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSV 433
               +    + +I    + +    G+ +  ++ I   L   VN    L+  D      + 
Sbjct: 169 EGVWQNRILTGDIKGSFYVSAQKMGLAAADIQRIEDLLKEKVNFARDLRAGDKFSVLVND 228

Query: 434 NHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFG 493
            +   +A+  S++L +  + G +    ++  +       Y++  G+S      R P+   
Sbjct: 229 QYVEGEATGSSQILGVTIKTGRSEVSAFQHTDGS-----YYDAKGQSLVRAFQRIPLAKQ 283

Query: 494 R-MTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHH 551
             M+S F     HPI G    H G D++ P GT ++A GDG+V         GK  +I H
Sbjct: 284 PRMSSRFNAYRKHPITGRISPHNGTDFSVPIGTKVIAPGDGVVSLVTDHQFAGKYIVIEH 343

Query: 552 GNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKV 611
           G  Y + Y H       ++ G  V +GQ+I   G TG STGPHLHYE  +NG  VD  K 
Sbjct: 344 GGKYRTRYLHLSK--SLVRKGQRVTRGQVIALSGNTGRSTGPHLHYEFHINGKPVDPMKA 401

Query: 612 RIPERENLKGDLLQRFAMEKKRINSLLN 639
            IP    L    L+ F    K   +L++
Sbjct: 402 DIPMSSQLANQELRTFTNLVKSRQALMD 429


>gi|73540181|ref|YP_294701.1| peptidase M23B [Ralstonia eutropha JMP134]
 gi|72117594|gb|AAZ59857.1| Peptidase M23B [Ralstonia eutropha JMP134]
          Length = 464

 Score =  316 bits (809), Expect = 8e-84,   Method: Composition-based stats.
 Identities = 85/455 (18%), Positives = 172/455 (37%), Gaps = 11/455 (2%)

Query: 207 EEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYS---KKIKIIEENRTITS 263
           E +             +K  + ++       +          +        + E   +  
Sbjct: 12  ELVVLVDPTNPQHARRRKQLTASVGAIFTLGMAAAMGVAPRSAFNDPLAPRVNEPLRMPD 71

Query: 264 PQVLIDKIPEFADDLIPIQ-----HNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLT 318
            +  +++I +   D + ++        TI   +   G  + D+            +  + 
Sbjct: 72  VREQLEQISDIDTDAVYVRQERMQRGDTIGSLLRRLGVDDPDAQAFILKNPTARGLFNVN 131

Query: 319 KDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMR 378
             + ++  +   +   ++      +       +          G    K  + +  + +R
Sbjct: 132 PGQAVQAEIDDSNMLVSLQANLGGNAATSRELVIERVEPAKAGGTTTYKARVQNVDNDLR 191

Query: 379 TSEESPNIYDG-IWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHAN 437
               S +I  G  ++A     +  ++V+ ++   +  ++ Q  +   D     +     +
Sbjct: 192 YEMASGSISSGGFFKAMDAANVPDDIVQQMLSIFSGVIDFQHDIASGDRFRIIYEAGFQD 251

Query: 438 NQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTS 497
                +  ++ I         +   F    + +  Y+  +G+S +   LR+PV F R++S
Sbjct: 252 GAFIRNGRVVAIELINRNQLHQALWFAPEGESNGAYYTFDGRSMKRPFLRSPVEFSRVSS 311

Query: 498 GFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVS 557
           GFG R HP+      H GVD+AAP GT ++A G+G ++      GYG   ++ H NGY +
Sbjct: 312 GFGGREHPLHHAWAQHKGVDFAAPTGTKVLATGEGTIDFVGQQNGYGNIIILKHANGYST 371

Query: 558 SYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERE 617
            Y H    A  ++ G  V QGQ+IG++G TG +TGPHLHYE   N +  +   + + E  
Sbjct: 372 YYAHLSGFA-GVQQGQRVTQGQVIGYVGQTGWATGPHLHYEFRFNDVPQNPLSIALMEAP 430

Query: 618 NLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
            L G   Q F      +   +N        L  ++
Sbjct: 431 VLTGKARQEFLGYTSEMLGRINALRT-YNVLTAAN 464


>gi|303326102|ref|ZP_07356545.1| M23 peptidase domain protein [Desulfovibrio sp. 3_1_syn3]
 gi|302864018|gb|EFL86949.1| M23 peptidase domain protein [Desulfovibrio sp. 3_1_syn3]
          Length = 493

 Score =  316 bits (809), Expect = 9e-84,   Method: Composition-based stats.
 Identities = 104/470 (22%), Positives = 178/470 (37%), Gaps = 19/470 (4%)

Query: 176 IHNVDSFEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNK--KNQSFTLYYA 233
           + +V        + +     T +  +     E +            ++  + Q       
Sbjct: 1   MSSVPPARPGPPQADKNGTGTAVSEEAGRAPEAVAVQTSASDPADRSRLPEAQPDVSDSV 60

Query: 234 DPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVH 293
             +      D  +  ++         T    +   D  P        ++   TI   + +
Sbjct: 61  SGEETSLPPDTAVPGAESSAQAP--STGLIEEARPDGAPGEEVVKGTVEKGDTISKILEN 118

Query: 294 AGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIAL 353
            G  +    +   A +    +    + +   I          + RF      +  L +  
Sbjct: 119 TG--SEGIYQYISAARQVFSMRSFREGQPYVIVTDSASG--RVKRFEYEIDSRRRLVV-- 172

Query: 354 NDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLAS 413
                   GVE     +         S     I D +++A +  G +  +   +     +
Sbjct: 173 -------EGVEEPVARVEAIEYVTLLSTVEATISDNLFQAVADVGESPQMALQLADLFGA 225

Query: 414 SVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEY 473
            +N    L+  D         +   +      +L  H          Y F +      +Y
Sbjct: 226 EINFIRDLQEGDSFSVLVEKRYREGEYKGYGRVLAAHFTNKGKTFEAYLFRDGSG-RAQY 284

Query: 474 FNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDG 532
           +N  G++ R  LL+ P+ F R+TS F     HPILGYSR H GVD+ AP GTP+ AVG+G
Sbjct: 285 YNRKGENLRKTLLQAPLAFTRVTSRFTSSRKHPILGYSRPHMGVDYGAPTGTPVKAVGEG 344

Query: 533 IVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTG 592
           +V K +W GGYG Q ++ H  G  S Y+H    A+ ++ G  V+QGQ+IG++G+TGLSTG
Sbjct: 345 VVTKRSWGGGYGNQIIVKHVAGLESMYSHLSGYARGLRQGQRVRQGQVIGFVGSTGLSTG 404

Query: 593 PHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGE 642
           PHL + L  NG  ++ TK   P  E +    +  F        + L + +
Sbjct: 405 PHLDFRLRQNGKFINPTKAINPRGEPVSARHMAAFEKVVAEELAYLKDRK 454


>gi|94309361|ref|YP_582571.1| peptidase M23B [Cupriavidus metallidurans CH34]
 gi|93353213|gb|ABF07302.1| putative membrane associated metalloendopeptidase [Cupriavidus
           metallidurans CH34]
          Length = 464

 Score =  316 bits (809), Expect = 9e-84,   Method: Composition-based stats.
 Identities = 85/446 (19%), Positives = 158/446 (35%), Gaps = 15/446 (3%)

Query: 214 MNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKK-IKIIEENRTITSPQVLIDKIP 272
             +   +      +  +  A         D P+    +    + + R         D+  
Sbjct: 27  RRKQLTVAVGTVFTLGMAAAMGVAPRNAFDDPLAPRVEQALRMPDVRQQLELLTETDEQS 86

Query: 273 EFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDD 332
            +      +Q   TI   +   G  + D+            +  L   + ++  +   + 
Sbjct: 87  VYV-RQERMQRGDTIATLLRRLGVDDPDAQSFILKNPTARGLFGLNPGQTVQAEIDDSNL 145

Query: 333 KFTIVR-----FSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIY 387
              +        +   +          D  +Y        +D       +     S  I 
Sbjct: 146 LVALQANLGGDAASSRELVVERVAPQKDGGDYTYRARIASVDN-----DVHYEMASGAIE 200

Query: 388 DG-IWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSEL 446
           +   +++     +   +V  ++   +  ++    +   D     +     +     +  +
Sbjct: 201 NNGFFKSMDAANVPDEIVSQMISIFSGVIDFHHDITRGDRFRIVYEAGFRDGAFVRNGRV 260

Query: 447 LYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPI 506
           + I      T  +   +         Y+  +G+S +   LR+PV F R++SGFG R HP+
Sbjct: 261 VAIELINRNTLYQALWYSPTDGEPGAYYTFDGRSMKRPFLRSPVEFSRVSSGFGGRDHPL 320

Query: 507 LGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIA 566
                 H GVD+AAP GT + A G+G VE      GYG   ++ H  GY + Y H    A
Sbjct: 321 HHKWAQHKGVDFAAPTGTKVFASGEGTVEFVGQQNGYGNLIILRHAGGYSTYYAHLSGFA 380

Query: 567 KNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQR 626
             ++ G  V QG++IG++G+TG +TGPHLHYE   N +  +     + E   L G     
Sbjct: 381 -GLRDGQHVGQGEVIGYVGSTGWATGPHLHYEFRYNDVPQNPLTTTLMEAPTLTGKSRSE 439

Query: 627 FAMEKKRINSLLNNGENPKKPLFTSH 652
           F      + S +N        L  S+
Sbjct: 440 FLNYTSAMLSRINMLRT-YNVLTASN 464


>gi|95930637|ref|ZP_01313371.1| peptidase M23B [Desulfuromonas acetoxidans DSM 684]
 gi|95133289|gb|EAT14954.1| peptidase M23B [Desulfuromonas acetoxidans DSM 684]
          Length = 438

 Score =  316 bits (809), Expect = 9e-84,   Method: Composition-based stats.
 Identities = 85/401 (21%), Positives = 162/401 (40%), Gaps = 22/401 (5%)

Query: 249 SKKIKIIEENRTITSPQVLIDKIPE------FADDLIPIQHNTTIFDAMVHAGYSNGDSA 302
           S        + T+ +P    +  PE             +Q   TI   + H  +S  +  
Sbjct: 33  SPSAPTTATDSTLPAPAAFHEPAPEHVIQIQRETICQSVQPGDTITAILGHY-FSPQEIL 91

Query: 303 KIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLG 362
            IA+  +N   + QL      +I V  +           Y   +    I   ++ E+   
Sbjct: 92  VIARQSENVFPLSQLCAGHPYQIEVENESFVS-----FYYDINRDDQLIIRQEDGEFF-- 144

Query: 363 VEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLK 422
                ++       +   +    I   ++   +  G +S L   +M   A  ++    ++
Sbjct: 145 -----IERQPIPYVVDVEQVGGVINSSLFGTVAQLGESSELAAELMNIFAWDIDFIRDIR 199

Query: 423 PTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSR 482
             D+        + +   +   ++L             Y F         Y+N++GKS R
Sbjct: 200 EGDYFTALVEKRYRDGNLAGYGDILAAEFNNQGQSF--YAFHYTHGTDSGYYNQDGKSLR 257

Query: 483 PFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAG 541
              L+ P+ + R++SG+  R  HP+L   + H  +D+AAP GTPI AV DG + + ++  
Sbjct: 258 KAFLKAPLSYTRISSGYTKRRFHPVLNRWKPHLAIDYAAPTGTPIKAVADGTITQKSYDR 317

Query: 542 GYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIV 601
             G +  + H N Y ++Y H    A+ +K G  VKQG++IG++G+TG++TGPHL + +  
Sbjct: 318 NNGNKIRLRHPNDYETTYIHMVRFARGMKKGKRVKQGEVIGYVGSTGIATGPHLDFRVFH 377

Query: 602 NGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGE 642
           +G  ++  K++    + +       F      +   L   +
Sbjct: 378 HGRPINPLKIKSEPAKPISKANRAEFDQLTVELMQQLTQAK 418


>gi|167624620|ref|YP_001674914.1| peptidase M23B [Shewanella halifaxensis HAW-EB4]
 gi|167354642|gb|ABZ77255.1| peptidase M23B [Shewanella halifaxensis HAW-EB4]
          Length = 418

 Score =  316 bits (809), Expect = 9e-84,   Method: Composition-based stats.
 Identities = 91/387 (23%), Positives = 156/387 (40%), Gaps = 23/387 (5%)

Query: 254 IIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVR 313
           I+ ++ T+   Q+L        +    I    T+       G       ++ +A  N + 
Sbjct: 50  ILSQSVTLPRSQLLEPAPAFQKE----IVKGDTLSGLFEQGGVDQQTMYRVLEADLNVLA 105

Query: 314 VDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQ 373
           +D L     ++  +   +D   + + S+Y      +     D+  +        +D  + 
Sbjct: 106 LDTLKPGNKIQFWL---NDAGELQKLSLYFNAARQVIFTRFDDGSF-------NVDEINI 155

Query: 374 MDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSV 433
               R    S  I+   + +    G+N+  ++ +   L   +N    L+  D      + 
Sbjct: 156 EGIWRDRAISGQIHGSFYVSAKKMGLNAAEIQRVESLLKEKLNFARDLRAGDKFSVLMND 215

Query: 434 NHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTP-VPF 492
              + +A+ +S +L +    G +    Y+  +       +++E G+S      R P    
Sbjct: 216 QFIDGEATGNSHVLGVTIDRGSSSINAYQHTDGN-----FYDEKGQSLARAFQRIPLAKN 270

Query: 493 GRMTSGFGMRYH-PILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHH 551
            R++S F    H P+ G +  H G D+A P GT IVA GDGIV         GK  +I H
Sbjct: 271 YRISSRFNPNRHHPVTGRNSPHNGTDFAIPIGTKIVAPGDGIVSLVTDHRFAGKYIVIDH 330

Query: 552 GNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKV 611
           GN Y + Y H       +  G  V +GQ+I   G TG  TGPHLHYE  +NG  VD+ K 
Sbjct: 331 GNKYRTRYLHLSKAL--VHKGQRVSRGQVIALSGNTGRVTGPHLHYEFHINGRPVDAMKA 388

Query: 612 RIPERENLKGDLLQRFAMEKKRINSLL 638
           +IP    L    +  F+   K    ++
Sbjct: 389 KIPMASKLSSKEMSEFSQIVKVRKMMM 415


>gi|157374729|ref|YP_001473329.1| peptidase M23B [Shewanella sediminis HAW-EB3]
 gi|157317103|gb|ABV36201.1| peptidase M23B [Shewanella sediminis HAW-EB3]
          Length = 424

 Score =  315 bits (808), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 96/449 (21%), Positives = 161/449 (35%), Gaps = 31/449 (6%)

Query: 193 TDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYS-KK 251
                 Q+    Q+  I   ++    LL        T     PQ +    D     S   
Sbjct: 1   MSQINTQVLSFLQESSIHKKVLLGAGLLIGAAILWPTHQQVLPQRIPIDLDIDALVSQIS 60

Query: 252 IKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNE 311
             +  E  ++  P                I    T+    V AG       ++ +A  N 
Sbjct: 61  STVATEAVSVVKPDFDKS-----------IISGDTLSGLFVQAGVDQQTMYRVLEADLNI 109

Query: 312 VRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDIN 371
           + +D L     ++  +    DK  + +  +Y      +  +  D+  Y        +D  
Sbjct: 110 LALDTLKPGNEIKFWLD---DKGELEKLELYFSAARQVVFSRFDDGSY-------NVDEI 159

Query: 372 HQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFF 431
           +     +    +  I    + +    G++S  ++ I   L   +N    L+  D      
Sbjct: 160 NIEGIWQNRAVAGEIQGSFYLSAKRMGLDSGEIQRIESLLKEKLNFARDLRAGDSFSVLM 219

Query: 432 SVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTP-V 490
           S  + +   +  S++L +  +            +  +    +++E G+S      R P  
Sbjct: 220 SDQYIDGSMTGASDILGVSIQ-RGRSHINAYQNSDGN----FYDEKGQSLARAFQRIPLQ 274

Query: 491 PFGRMTSGFGMRYH-PILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLI 549
              R++S F    H P+ G +  H G D+A P GT ++A GDGIV         GK  +I
Sbjct: 275 RNYRISSSFNPHRHHPVTGRTSPHNGTDFATPIGTKVIAPGDGIVSLVTDHRFAGKYVVI 334

Query: 550 HHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDST 609
            HGN Y + Y H       +  G  V +GQ+I   G TG  TGPHLHYE  VNG  V+  
Sbjct: 335 EHGNKYRTRYLHLSKAL--VHKGQRVSRGQVIALSGNTGRITGPHLHYEFHVNGRPVNPM 392

Query: 610 KVRIPERENLKGDLLQRFAMEKKRINSLL 638
           K  IP    L    +  F    +    ++
Sbjct: 393 KANIPMASQLSRKQMNSFEQLVQVRQMMM 421


>gi|269959927|ref|ZP_06174304.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269835226|gb|EEZ89308.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 439

 Score =  315 bits (808), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 91/396 (22%), Positives = 149/396 (37%), Gaps = 23/396 (5%)

Query: 250 KKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALK 309
            + +++E     T+ +V+     E+      IQ    +       G+      K+ +   
Sbjct: 62  PESQVVENILDATTAEVVTPPNFEYQ-----IQAGDNLSTIFSQLGFGYSSLMKVMETDL 116

Query: 310 NEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMD 369
           N + +D L     LR    +   +   +        K  +    ND+  Y      +   
Sbjct: 117 NFLALDTLKPGNTLRFWRDESTGELQKMELQFSIADK--VVYHRNDDGSYDFSDISI--- 171

Query: 370 INHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLET 429
                           I      + +  G++S  +  ++  L   VN  + L+  D  E 
Sbjct: 172 ----PGVWNQEPLVGVIRGSFSSSANRLGLSSAEISQVVNLLKEQVNFGKDLRAGDRFEV 227

Query: 430 FFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTP 489
                  +   +  +E+  I           Y   +       ++N  G+S +    R P
Sbjct: 228 VRRSQSIDGVPTGKNEIEAIKIYNRGREVTAYLHTDGQ-----FYNAKGESLQRAFQRYP 282

Query: 490 VPFGR-MTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQT 547
           V     ++SGF  +  HP+ G    H G DWA P GTP+ A GDG V         G   
Sbjct: 283 VSRSWRISSGFNPKRLHPVTGRVAPHNGTDWAVPIGTPVEATGDGTVIMTRKHPYAGNYV 342

Query: 548 LIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVD 607
           +I HG+ Y + Y H   I   +K G  V +GQ IG  G TG  TGPHLHYELI  G  V+
Sbjct: 343 VIEHGSKYKTRYLHLSKIL--VKKGQKVSRGQRIGLSGKTGRVTGPHLHYELIEYGRPVN 400

Query: 608 STKVRIPERENLKGDLLQRFAMEKKRINSLLNNGEN 643
           + +  IP   ++    +  F   +  ++ LL + E 
Sbjct: 401 AMRANIPMASSVPKKEMASFVANRNEMDKLLKDKEK 436


>gi|262276595|ref|ZP_06054404.1| cell wall endopeptidase family M23/M37 [Grimontia hollisae CIP
           101886]
 gi|262220403|gb|EEY71719.1| cell wall endopeptidase family M23/M37 [Grimontia hollisae CIP
           101886]
          Length = 426

 Score =  315 bits (808), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 95/397 (23%), Positives = 155/397 (39%), Gaps = 26/397 (6%)

Query: 252 IKIIEENRTITSPQVLIDKIPEFAD--------DLIPIQHNTTIFDAMVHAGYSNGDSAK 303
           I+I+  N   +    LI K     +            IQ    + +  +  G    +  K
Sbjct: 40  IRIVPLNLPESVVPDLIQKEEVAKESGDLDLPAYEYAIQTGDNLSEIFMRLGLPYSELLK 99

Query: 304 IAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGV 363
           + +A  N +R+D L   +ILR  V         +        K        D+  Y    
Sbjct: 100 LMEADLNHLRIDTLRPGDILRFWVDPTGKHLKKLELEFNIASKVQYV--QLDDGSY---- 153

Query: 364 EPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKP 423
              + +          +  + +I      +    G++ N V++I   L   +N    L+ 
Sbjct: 154 ---EFNEIVIPGTWEETVATGDIQGSFSVSARRAGLSYNDVQMITNLLKDKMNFSRDLRA 210

Query: 424 TDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRP 483
            D  E   S    + QAS   E+  I           Y   +       Y++++G+S + 
Sbjct: 211 GDKFEVVRSEQFVDGQASGQREIKAIRIERRGEPITAYLHTDGN-----YYDKDGQSLQR 265

Query: 484 FLLRTPVPFG-RMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAG 541
              R P     R++S F  R  HP+ G    H GVD+A   GTP+++ GDG+V       
Sbjct: 266 AFQRYPTNGRERISSRFNPRRKHPVTGRVSPHNGVDFAVRTGTPVLSTGDGVVVMVRNHP 325

Query: 542 GYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIV 601
             GK  +I HGN Y + Y H   I   ++ G  V +GQ I   G +G  TGPH+HYEL++
Sbjct: 326 YAGKYVVIDHGNQYKTRYLHNSKIL--VRKGQRVTRGQRIALSGRSGRVTGPHIHYELLI 383

Query: 602 NGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLL 638
           +G  VD  K +IP   ++    +  F       +  +
Sbjct: 384 HGRAVDPMKAKIPMATSVPRGEMTAFKKSVSEYDKKM 420


>gi|113866518|ref|YP_725007.1| membrane associated metalloendopeptidase [Ralstonia eutropha H16]
 gi|113525294|emb|CAJ91639.1| membrane associated metalloendopeptidase [Ralstonia eutropha H16]
          Length = 463

 Score =  315 bits (808), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 88/457 (19%), Positives = 164/457 (35%), Gaps = 4/457 (0%)

Query: 198 IQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEE 257
              +     +        +   L       FTL  A    +  R       + + +    
Sbjct: 9   FARELVVLVDPTNPQHARRRKQLTASVGAIFTLGMAAAMGVAPRSAFDDPLAPRTQQALR 68

Query: 258 NRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQL 317
              +      +            +Q   TI   +   G  + D+            +  L
Sbjct: 69  MPDVREQLEQLTDSQAVYVREERMQRGDTIASLLKRLGVDDADAQAFIVKNPTARGLFNL 128

Query: 318 TKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYM 377
              + ++  + + +   ++              +               K  +    + +
Sbjct: 129 NPGQAVQAEIDESNTLVSLQANLGGDAAASRELVIERVRAASDNTAATYKAKVQRVDNDV 188

Query: 378 RTSEESPNIYDG-IWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHA 436
                S  I  G  ++A     +   +V+ ++   +  ++    +   D     +     
Sbjct: 189 HYEMASGAISAGGFFKAMDAANVPDEVVQQMLSIFSGVIDFHHDIASGDRFRIIYEAGFR 248

Query: 437 NNQASDDSELLYIHARFGETRTRF-YRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRM 495
           +     +  ++ +         +  +           Y+  +G+S +   LR+PV F R+
Sbjct: 249 DGTFVRNGRVVALELINRNQLHQALWFAPEDSKDGGAYYTFDGRSMKRPFLRSPVEFSRV 308

Query: 496 TSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGY 555
           +SGFG R HP+      H GVD+AAP GT ++A GDG+VE      GYG   +++H NGY
Sbjct: 309 SSGFGGREHPLHHDWAQHKGVDFAAPTGTKVLATGDGVVEFVGQQNGYGNIVILNHANGY 368

Query: 556 VSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPE 615
            + Y H    A  ++ G  V+QGQ+IG++G+TG +TGPHLHYE   N +  +   + + E
Sbjct: 369 STYYAHLSGFA-GMRQGQPVRQGQLIGYVGSTGWATGPHLHYEFRFNDVPQNPLTITLME 427

Query: 616 RENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
              L G   Q F      + S +N        L  S+
Sbjct: 428 SPTLTGKSRQEFLTYTSGLLSRINALRT-YNVLTASN 463


>gi|212635946|ref|YP_002312471.1| peptidase M23B [Shewanella piezotolerans WP3]
 gi|212557430|gb|ACJ29884.1| Peptidase M23B [Shewanella piezotolerans WP3]
          Length = 428

 Score =  315 bits (807), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 85/381 (22%), Positives = 153/381 (40%), Gaps = 22/381 (5%)

Query: 260 TITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTK 319
           +  +P +         + +I      T+       G       ++ +A  N + +D L  
Sbjct: 64  STPTPVINTLLDKPRFEKVIV--KGDTLSGLFEQGGVDQQTMYRVLEADLNVLALDTLQP 121

Query: 320 DEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRT 379
              ++  + + D    + + ++Y      +T +  D+  +        ++  +     R 
Sbjct: 122 GNEIQFWLDEAD---KLEKLTLYFSAARQVTYSRFDDGSF-------NVNEVNIEGIWRN 171

Query: 380 SEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQ 439
              +  I    + +    G+N+  ++ +   L   +N    L+  D      +  + +  
Sbjct: 172 RSVAGEINGSFYLSAQKMGLNAAQIQRVESLLKEKLNFARDLRAGDKFSVLINDQYIDGV 231

Query: 440 ASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTP-VPFGRMTSG 498
           A+  S++L +    G +    Y+F +       +++E G+S      R P     R++S 
Sbjct: 232 ATGSSDILGVTIDRGRSSINAYQFTDGN-----FYDEQGRSLARAFQRIPLQRNYRISSR 286

Query: 499 FGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVS 557
           F     HP+ G +  H G D+A P GT ++A GDGIV         GK  +I HGN Y +
Sbjct: 287 FNPHRHHPVTGRTSPHNGTDFATPIGTKVIAPGDGIVSLVTDHRFAGKYVVIEHGNKYRT 346

Query: 558 SYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERE 617
            Y H       +  G  V +GQ+I   G TG  TGPHLHYE  +NG  VD  K +IP   
Sbjct: 347 RYLHLSK--SLVHKGQRVSRGQVIALSGNTGRITGPHLHYEFHINGRAVDPMKAKIPMAN 404

Query: 618 NLKGDLLQRFAMEKKRINSLL 638
            L    +  F     R+  ++
Sbjct: 405 QLSKKQMGAFEQLV-RVRKMM 424


>gi|117921051|ref|YP_870243.1| peptidase M23B [Shewanella sp. ANA-3]
 gi|117613383|gb|ABK48837.1| peptidase M23B [Shewanella sp. ANA-3]
          Length = 431

 Score =  315 bits (807), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 86/399 (21%), Positives = 153/399 (38%), Gaps = 21/399 (5%)

Query: 245 PITYSKKIKIIEENRT--ITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSA 302
           P      + +  E     ++ P      +         I    T+      AG       
Sbjct: 48  PTAQRIPVALDLETILPQVSEPVETAPIVDNTPHFERVIASGDTLSALFSKAGVDQQTMY 107

Query: 303 KIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLG 362
           K+ +A  N + +D L     ++  +  +     + +  +Y      +     ++  +   
Sbjct: 108 KVLEADLNILALDTLLPGNRIQFWLDNEG---QLQKLELYFNAARQVVFTRYEDGSF--- 161

Query: 363 VEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLK 422
                ++  +     +    + +I    + +    G+ +  ++ I   L   VN    L+
Sbjct: 162 ----NVEEINVEGVWQNRIVTGDIKGSFYVSAQKMGLAAADIQRIEDLLKEKVNFARDLR 217

Query: 423 PTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSR 482
             D      +  +   +A+  S++L +  + G +    ++  +       Y++  G+S  
Sbjct: 218 VGDKFSVLVNDQYVEGEATGSSQILGVSIKTGRSEISAFQHTDGS-----YYDAKGQSLV 272

Query: 483 PFLLRTPVPFGR-MTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWA 540
               R P+     M+S F     HPI G    H G D++ P GT ++A GDG+V      
Sbjct: 273 RAFQRIPLAKQPRMSSRFNPTRKHPITGRISPHNGTDFSVPIGTKVIAPGDGVVSLVTDH 332

Query: 541 GGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELI 600
              GK  +I HG  Y + Y H       ++ G  V +GQ+I   G TG STGPHLHYE  
Sbjct: 333 QFAGKYIVIEHGGKYRTRYLHLSKAL--VRKGQRVTRGQVIALSGNTGRSTGPHLHYEFH 390

Query: 601 VNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLN 639
           VNG  VD  +  IP    L    L+ F+   K   +L+N
Sbjct: 391 VNGKPVDPMRADIPMASQLANQELRTFSNIVKSRQALMN 429


>gi|289666310|ref|ZP_06487891.1| membrane-bound metalloendopeptidase [Xanthomonas campestris pv.
           vasculorum NCPPB702]
 gi|289671117|ref|ZP_06492192.1| membrane-bound metalloendopeptidase [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 472

 Score =  315 bits (807), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 91/379 (24%), Positives = 155/379 (40%), Gaps = 14/379 (3%)

Query: 266 VLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRI 325
                 P    +++ ++   T+       G       ++      +  + +L     +  
Sbjct: 91  SRKQLAPSTDWEILQVKPGQTLSTLFGELGIPTTVMYQVLAHPGTKEALTKLRPGAEIAF 150

Query: 326 GVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPN 385
            +        +          H + + L          + V+ ++  +    RT   S  
Sbjct: 151 DMPTPG---QLRALRFDRDDSHRVELRL--------LGDSVRENVTERATTTRTVVASGE 199

Query: 386 IYDGIWRATSFNGMNSNLVKLIM-RTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDS 444
           I   ++ + + +G++   V ++        ++  + L+P D             +     
Sbjct: 200 ISSSLYASANKSGLSPAAVAIMTDEIFKYDIDFDKDLQPGDRFSVVMDETWREGERISTG 259

Query: 445 ELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYH 504
           ++L      G      +RF        EYF+ NG+  +   +R PV + R++S FG R H
Sbjct: 260 DILAATFTTGGKTYTGFRFE-RAGKPAEYFDINGRPLKKSFIRMPVAYSRISSTFGARMH 318

Query: 505 PILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDA 564
           P+LG  RMH GVD+AA  GTPI+A GD  V       GYG   ++ HG  Y + Y H   
Sbjct: 319 PVLGTMRMHKGVDYAAASGTPIMAAGDARVVFVGTQRGYGNVVILDHGKNYSTLYGHMSR 378

Query: 565 IAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLL 624
             K IKAG  + QG +IG++G TG++TGPHLHYE  V G + +   V +P  E L+G  L
Sbjct: 379 FGK-IKAGQHINQGTVIGYVGMTGMATGPHLHYEFRVAGQQRNPMSVTMPPPEPLQGAEL 437

Query: 625 QRFAMEKKRINSLLNNGEN 643
             F  +     + +   E 
Sbjct: 438 AAFRAQTAPAMARIEGMEK 456


>gi|121997668|ref|YP_001002455.1| peptidase M23B [Halorhodospira halophila SL1]
 gi|121589073|gb|ABM61653.1| peptidase M23B [Halorhodospira halophila SL1]
          Length = 503

 Score =  315 bits (807), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 98/464 (21%), Positives = 177/464 (38%), Gaps = 27/464 (5%)

Query: 187 QKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPI 246
                 +              E   +  +Q  L         T   A         D   
Sbjct: 58  TPRAELSLPAVAVASPEPPTAEADPSGTDQEPLGRPTTLPIPTPPGATDSAFQGEADADA 117

Query: 247 TYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAK 306
                ++ ++              +PE  +  I ++   +    +  AG++ GD  +I  
Sbjct: 118 AAEGAVQDVKA-------------LPELEEHEITVRSGDSFARILSRAGHTPGDVQRILN 164

Query: 307 ALKNEVR-VDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEP 365
           A ++    + +L   + L +   +      +    +   ++H L +   D+  +   + P
Sbjct: 165 AGESAQSALTRLRPGQALTLLRDKDG---ALAGVRVAVDREHKLLVRRGDDG-FEASMVP 220

Query: 366 VKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTD 425
            +++   +            +   ++ +    G++  ++  + R L   ++L   L+  D
Sbjct: 221 RELEREIRRVE-------GTVDGSLFLSARRAGLDDRMIMQLARVLDGDIDLGRDLRSGD 273

Query: 426 FLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFL 485
                +      + ++    L  +            RF +P    V ++  +G S     
Sbjct: 274 TFSVLYERTLGPDGSTLHKRLKAMRLDGARKTLEALRFEDPDG-RVSFYTPDGTSLARTF 332

Query: 486 LRTPVPFGRMTSGFG-MRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYG 544
            R PV F R++S F   R HPILG  R H GVD AAP GTP+ A  DG V +    GGYG
Sbjct: 333 TRYPVDFERISSHFDRNRRHPILGVRRPHLGVDLAAPTGTPVRAAADGRVVERRRNGGYG 392

Query: 545 KQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGI 604
           +   + H + Y + Y H    A+ +  G  VK+G++IG++G TG +TGPHLHYE I NG 
Sbjct: 393 RVITLRHSDRYQTLYAHLSRYARGLNVGDRVKRGEVIGYVGATGQATGPHLHYEFIDNGR 452

Query: 605 KVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPL 648
             +   V +P  E L  +  + F        + L    + +  L
Sbjct: 453 HRNPVTVDLPRAEPLPEEHRRAFREHVAPRLAALRGDSSAEIQL 496


>gi|188591233|ref|YP_001795833.1| metallopeptidase, m23b family [Cupriavidus taiwanensis LMG 19424]
 gi|170938127|emb|CAP63113.1| putative metallopeptidase, M23B family [Cupriavidus taiwanensis LMG
           19424]
          Length = 463

 Score =  315 bits (807), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 88/454 (19%), Positives = 166/454 (36%), Gaps = 10/454 (2%)

Query: 207 EEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQV 266
           E +             +K  + ++       +          +         + +     
Sbjct: 12  ELVVLVDPTNPQHARRRKQLTASVGAIFTLGMAAAMGVAPRSAYDDPRAPRTQQVLRMPD 71

Query: 267 LIDKIPEFADDLIP------IQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKD 320
           + +++ +  D          +Q   TI   +   G  + D+            +  L   
Sbjct: 72  VREQLEQLTDTEAVYVREERMQRGDTIASLLKRLGVDDADAQAFIVKNPTARGLFNLNPG 131

Query: 321 EILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTS 380
           + ++  + + +   ++              +               K  +    + +   
Sbjct: 132 QAVQAEIDESNTLVSLQANLGGDAAASRELVIERVRVASGDTAAAYKAKVQRVDNDVHYE 191

Query: 381 EESPNIYDG-IWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQ 439
             S  I  G  ++A     +   +V+ ++   +  ++    +   D     +     +  
Sbjct: 192 MASGAISSGGFFKAMDAANVPDEVVQQMLSIFSGVIDFHHDIAAGDRFRIIYEAGFRDGT 251

Query: 440 ASDDSELLYIHARFGETRTRFYRFLNP-VDGSVEYFNENGKSSRPFLLRTPVPFGRMTSG 498
              +  ++ +         +   F       S  Y+  +G+S +   LR+PV F R++SG
Sbjct: 252 FVRNGRVVAVELINRNQLHQALWFAPEGSKDSGAYYTFDGRSMKRPFLRSPVEFSRVSSG 311

Query: 499 FGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSS 558
           FG R HP+      H GVD+AAP GT ++A GDG+VE      GYG   ++ H NGY + 
Sbjct: 312 FGGREHPLHHDWAQHKGVDFAAPTGTKVLATGDGVVEFVGQQNGYGNIVILSHPNGYSTY 371

Query: 559 YNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPEREN 618
           Y H    A  ++ G AV+QGQ+IG++G TG +TGPHLHYE   N +  +   V + E   
Sbjct: 372 YAHLSGFA-GMRQGQAVRQGQLIGYVGATGWATGPHLHYEFRFNDVPQNPLTVTLMESPP 430

Query: 619 LKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH 652
           L G   Q F      + S +N        L  ++
Sbjct: 431 LTGKSRQEFLTYTSGLLSRINALRT-YNVLTAAN 463


>gi|113970783|ref|YP_734576.1| peptidase M23B [Shewanella sp. MR-4]
 gi|114048010|ref|YP_738560.1| peptidase M23B [Shewanella sp. MR-7]
 gi|113885467|gb|ABI39519.1| peptidase M23B [Shewanella sp. MR-4]
 gi|113889452|gb|ABI43503.1| peptidase M23B [Shewanella sp. MR-7]
          Length = 431

 Score =  315 bits (806), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 87/399 (21%), Positives = 152/399 (38%), Gaps = 21/399 (5%)

Query: 245 PITYSKKIKIIEENRT--ITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSA 302
           P      + +  E     I+ P      +         I    T+      AG       
Sbjct: 48  PTAQRIPVALDIETILPQISEPVETAPIVDNTPHFERVIASGDTLSALFSKAGVDQQTMY 107

Query: 303 KIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLG 362
           K+ +A  N + +D L     ++  +  +     + +  +Y      +     ++  +   
Sbjct: 108 KVLEADLNILALDTLLPGNRIQFWLDNEG---QLQKLELYFNAARQVVFTRYEDGSF--- 161

Query: 363 VEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLK 422
                ++  +     +    + +I    + +    G+ +  ++ I   L   VN    L+
Sbjct: 162 ----NVEEINVEGVWQNRILTGDIKGSFYVSAQKMGLAAADIQRIEDLLKEKVNFARDLR 217

Query: 423 PTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSR 482
             D      +  +   +A+  S++L +  + G +    ++  +       Y++  G+S  
Sbjct: 218 AGDKFSVLVNDQYVEGEATGSSQILGVSIKTGRSEISAFQHTDGS-----YYDAKGQSLV 272

Query: 483 PFLLRTPVPFGR-MTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWA 540
               R P+     M+S F     HPI G    H G D++ P GT ++A GDG+V      
Sbjct: 273 RAFQRIPLAKQPRMSSRFNPTRKHPITGRISPHNGTDFSVPIGTKVIAPGDGVVSLVTDH 332

Query: 541 GGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELI 600
              GK  +I HG  Y + Y H       ++ G  V +GQ+I   G TG STGPHLHYE  
Sbjct: 333 QFAGKYIVIEHGGKYRTRYLHLSKAL--VRKGQRVTRGQVIALSGNTGRSTGPHLHYEFH 390

Query: 601 VNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLN 639
           VNG  VD  +  IP    L    L+ F    K   +L+N
Sbjct: 391 VNGRPVDPMRADIPMASQLANQELRTFTNIVKSRQALMN 429


>gi|120601059|ref|YP_965459.1| peptidase M23B [Desulfovibrio vulgaris DP4]
 gi|120561288|gb|ABM27032.1| peptidase M23B [Desulfovibrio vulgaris DP4]
          Length = 417

 Score =  315 bits (806), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 91/432 (21%), Positives = 167/432 (38%), Gaps = 29/432 (6%)

Query: 214 MNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPE 273
           M    +L    +    L  AD  T+    +      +      ENR +            
Sbjct: 1   MAVSVMLLRSPSTPPELPQADNGTVSISSNATEAAPEATAEQPENRVV------------ 48

Query: 274 FADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDK 333
                  +    T    +     ++  +  +  A +    +  +   +   +     +  
Sbjct: 49  ----RGVVSQGDTAGKILQGW-VTSNRTQALLDACRKVYSLAMIRTGQPYTVVANATNG- 102

Query: 334 FTIVRFSIYHKQKHLLTIALNDNNE-YVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWR 392
            +I RF         L +  ++  E ++  VEP+  +                I   +++
Sbjct: 103 -SIERFEYEIDDDRKLVVNADEAGEGFIARVEPIHYEYELTRVD-------AVIDSNLFQ 154

Query: 393 ATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHAR 452
           A +  G +  L   +       V+    ++  D         + +        ++     
Sbjct: 155 AVADAGESPGLAITLADIFGWEVDFIRDIREGDSFSVLVEKRYRDGDFKGYGRVIAATFT 214

Query: 453 FGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSR 511
                   + F +       Y+N++G+S R   L+ P+ F R+TSGF     HPI    R
Sbjct: 215 NQGETYEAFYFTDDFG-GPAYYNKDGQSLRKSFLKAPLSFTRVTSGFSKNRLHPIFMERR 273

Query: 512 MHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKA 571
            H G+D+AAP GTP+ +V +G V++A W  GYG Q ++ HG    + Y+H    AK ++ 
Sbjct: 274 PHPGIDYAAPTGTPVKSVANGEVKQAGWVNGYGNQVIVRHGGRMETLYSHLSGFAKGVRK 333

Query: 572 GTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEK 631
           GT V+QGQ+IG++G TG +TGPHL + +   G  V+  K+  P  E +    ++ F    
Sbjct: 334 GTKVRQGQVIGYVGATGWATGPHLDFRIRQGGDFVNPAKMMNPRSEPVAKKRMKAFGDRV 393

Query: 632 KRINSLLNNGEN 643
             I + ++   N
Sbjct: 394 AFIRTFIDGTRN 405


>gi|91793856|ref|YP_563507.1| peptidase M23B [Shewanella denitrificans OS217]
 gi|91715858|gb|ABE55784.1| peptidase M23B [Shewanella denitrificans OS217]
          Length = 423

 Score =  314 bits (805), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 88/388 (22%), Positives = 149/388 (38%), Gaps = 22/388 (5%)

Query: 254 IIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVR 313
           ++ +  T    +V   + P F      I+   T+      AG       K+ +A  + + 
Sbjct: 54  LLPDLSTGPVTKVAAKRQPLFE---HVIETGDTLSKLFEQAGIDQKTMYKVLEADYSVLA 110

Query: 314 VDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQ 373
            D L     ++    +  D   + +  +Y    H +     D+  +         +   +
Sbjct: 111 FDTLLPGNRIQFWQDKNGD---LTKLELYFNPAHQVVFTRFDDGSF-------NAEEVIR 160

Query: 374 MDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSV 433
               +       I    + +    G+++  ++ +   L + +N    L+  D      + 
Sbjct: 161 EGVWQNRVVGGEINGSFYVSAKRAGLSATDIQKVESLLKNKLNFSRDLRAGDTFSILMND 220

Query: 434 NHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFG 493
                +A+  S L  I    G      ++ ++       Y++E G        R P+   
Sbjct: 221 QFVQGEATGSSRLEGIEIVNGRRNITAFQHIDGN-----YYDEEGSGLAKAFQRIPLNKK 275

Query: 494 -RMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHH 551
            R+TS F  +  +P+ G    H G D+A P GT +VA GDG+V         G   +I H
Sbjct: 276 VRLTSRFNPKRKNPVTGRVSPHNGTDFATPIGTSVVAPGDGVVTLVTKHRYAGNYIVIEH 335

Query: 552 GNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKV 611
            N   + Y H       ++ G  V +GQ+I   G TG STGPHLHYE  VNG  VD  KV
Sbjct: 336 DNKVRTRYLHLSKFL--VRKGQRVTRGQVIALSGNTGRSTGPHLHYEFHVNGRPVDVMKV 393

Query: 612 RIPERENLKGDLLQRFAMEKKRINSLLN 639
            IPE   L    L++F    K    ++ 
Sbjct: 394 DIPEASTLPNKSLEQFRALVKSRKMMMQ 421


>gi|156977518|ref|YP_001448424.1| peptidase [Vibrio harveyi ATCC BAA-1116]
 gi|156529112|gb|ABU74197.1| hypothetical protein VIBHAR_06306 [Vibrio harveyi ATCC BAA-1116]
          Length = 439

 Score =  314 bits (805), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 99/433 (22%), Positives = 156/433 (36%), Gaps = 27/433 (6%)

Query: 220 LHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRT-------ITSPQVLIDKIP 272
           L N  ++   L Y+ P  +     + +  S   K I  N         I          P
Sbjct: 22  LPNLTSRKALLLYSLPVLVAIGVSNSLKESSLTKTIALNLPETQVVENILDATTAEVVTP 81

Query: 273 EFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDD 332
              +    IQ    +       G       K+ +   N + +D L     LR    +   
Sbjct: 82  PNFEYQ--IQAGDNLSTIFSQLGLGYSSLMKVMETDLNFLALDTLKPGNTLRFWRNESTG 139

Query: 333 KFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWR 392
           +   +        K  +    ND+  Y      +                   I      
Sbjct: 140 ELEKMELQFSIADK--VVYHRNDDGSYDFSDISI-------PGVWTQEPLVGVIRGSFSS 190

Query: 393 ATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHAR 452
           + +  G++S  +  ++  L   VN  + L+  D  E        +   +  +E+  I   
Sbjct: 191 SANRLGLSSAEISQVVNLLKEQVNFGKDLRAGDRFEVVRRSQSIDGVPTGKNEIEAIKIY 250

Query: 453 FGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGR-MTSGFGMRY-HPILGYS 510
                   Y   +       ++N  G+S +    R PV  G  ++SGF  +  HP+ G  
Sbjct: 251 NRGREVTAYLHTDGQ-----FYNAKGESLQRAFQRYPVSRGWRISSGFNPKRLHPVTGRV 305

Query: 511 RMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIK 570
             H G DWA P GTP+ A GDG V         G   +I HG+ Y + Y H   I   +K
Sbjct: 306 APHNGTDWAVPTGTPVEATGDGTVIMTRKHPYAGNYVVIEHGSKYKTRYLHLSKIL--VK 363

Query: 571 AGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAME 630
            G  V +GQ IG  G TG  TGPHLHYELI  G  V++ + +IP   ++    +  F   
Sbjct: 364 KGQKVSRGQRIGLSGKTGRVTGPHLHYELIEYGRPVNAMRAKIPMASSVPKKEMASFITN 423

Query: 631 KKRINSLLNNGEN 643
           +  ++ LL + E 
Sbjct: 424 RNEMDKLLKDKEK 436


>gi|332703242|ref|ZP_08423330.1| Peptidase M23 [Desulfovibrio africanus str. Walvis Bay]
 gi|332553391|gb|EGJ50435.1| Peptidase M23 [Desulfovibrio africanus str. Walvis Bay]
          Length = 450

 Score =  314 bits (805), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 87/363 (23%), Positives = 149/363 (41%), Gaps = 15/363 (4%)

Query: 280 PIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRF 339
            +Q   T+   +    +S  +   +A+  +    + ++       I     D       F
Sbjct: 87  VVQKGDTVMTLLGDF-FSPAEIISLARECEEIFSLSRICAGHAFAITTQGDDFHG----F 141

Query: 340 SIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGM 399
                    L I   +           +++       +RT   S  I   ++ A    G 
Sbjct: 142 EYEISAAEKLRILKAEEG--------FQVERAPIEYDVRTERVSGVITSNLYAAVDATGE 193

Query: 400 NSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTR 459
           +  L   +    A  ++    ++  D           + Q +    +L           +
Sbjct: 194 SPELAVRLAEIFAWDIDFIRDIREGDTFTVLAEKRSRDGQPAGYGRILAAMFINQGQVYK 253

Query: 460 FYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDW 518
            + F         +++ENG+S R   L+TP+ F R+TSGF  +  HP+LG +R H G D+
Sbjct: 254 GFLFETAEGQ-AHFYDENGRSMRKAFLKTPLDFARITSGFSRKRFHPVLGVNRPHLGTDY 312

Query: 519 AAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQG 578
           AAP GTPI +VGDG++         G    I H N Y +SY H    A  +K G+ V+QG
Sbjct: 313 AAPTGTPIKSVGDGVITVRTRNNASGNYITIRHNNSYETSYLHMSRFASGLKRGSRVRQG 372

Query: 579 QIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLL 638
           Q+IG++G TG +TGPH+ + +  NG  ++  K++ P  E +  D  + FA     + + L
Sbjct: 373 QVIGYVGQTGWATGPHVCFRMKKNGQHINPVKLKTPPAEGVPQDRREAFAGLVSHLTTTL 432

Query: 639 NNG 641
              
Sbjct: 433 EQD 435


>gi|24374371|ref|NP_718414.1| M24/M37 family peptidase [Shewanella oneidensis MR-1]
 gi|24348931|gb|AAN55858.1|AE015722_8 peptidase, M23/M37 family [Shewanella oneidensis MR-1]
          Length = 434

 Score =  314 bits (804), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 87/399 (21%), Positives = 150/399 (37%), Gaps = 21/399 (5%)

Query: 245 PITYSKKIKIIEENRT--ITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSA 302
           P      + +  E     ++        +    D    I    T+      AG       
Sbjct: 51  PTAQRIPVALDIETILPQVSETVETAPIVDNTPDYERVIASGDTLSALFSKAGVDQQTMY 110

Query: 303 KIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLG 362
           K+ +A  N + +D L     ++  +        + +  +Y      +     D+  +   
Sbjct: 111 KVLEADLNILALDTLLPGNRIQFWLDNVG---QLQKLELYFNAARQVVFTRYDDGSF--- 164

Query: 363 VEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLK 422
                ++  +     +    + +I    + +    G+ +  ++ I   L   VN    L 
Sbjct: 165 ----NVEEINVEGVWQNRILTGDIKGSFYVSAQKMGLAAADIQRIEDLLKEKVNFARDLH 220

Query: 423 PTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSR 482
             D      +  +   +A+  S++L +  + G +    ++  +       Y++  G+S  
Sbjct: 221 AGDTFSVLVNDQYVEGEATGSSQILGVSIKTGRSEISAFQHTDGS-----YYDAKGRSLV 275

Query: 483 PFLLRTPVPFGR-MTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWA 540
               R P+     M+S F     HPI G    H G D++ P GT +VA GDG+V      
Sbjct: 276 RAFQRIPLAKQPRMSSRFNPARKHPITGRISPHNGTDFSVPIGTKVVAPGDGVVSLVTDH 335

Query: 541 GGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELI 600
              GK  ++ HG  Y + Y H       ++ G  V +GQ+I   G TG STGPHLHYE  
Sbjct: 336 QFAGKYIVVEHGGKYRTRYLHLSKAL--VRKGQRVTRGQVIALSGNTGRSTGPHLHYEFH 393

Query: 601 VNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLN 639
           VNG  VD  +  IP    L    L+ F    K   +L+N
Sbjct: 394 VNGKPVDPMRADIPMANQLANQELRSFTNMVKSRQALMN 432


>gi|225075981|ref|ZP_03719180.1| hypothetical protein NEIFLAOT_01006 [Neisseria flavescens
           NRL30031/H210]
 gi|224952696|gb|EEG33905.1| hypothetical protein NEIFLAOT_01006 [Neisseria flavescens
           NRL30031/H210]
          Length = 431

 Score =  314 bits (804), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 98/425 (23%), Positives = 164/425 (38%), Gaps = 17/425 (4%)

Query: 223 KKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQ 282
           K      L  A           P       K+   +  + +  V  +           +Q
Sbjct: 11  KATLLAFLLPASGIMTAYAITDPQPAHTDFKVERISEELPAVYVETNTYQSSYWAQEAVQ 70

Query: 283 HNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIY 342
              ++ D +   G +  D  +I       + +  L  ++ + I +        +     +
Sbjct: 71  AGDSLADVLTRMGVNQEDIKQIMAKNNANLDMKNLRTNQSVNIRIDSSG---QVTDVQFF 127

Query: 343 HKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSN 402
             ++        +           ++           +  S  I            + S 
Sbjct: 128 TDEELE-----RNLVALEKVKGKWRISNAEIDMKTMPTLRSVQIRTSAIGDMLRAEIPSE 182

Query: 403 LVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYR 462
           +   +    A S N+   L   D +   ++  +   Q    S++L           + Y 
Sbjct: 183 VYIQLKEIFADSFNMS-DLGEGDTVRLLYNSMYFRGQQMAVSDILAAEVVKDGKTYQAYY 241

Query: 463 FLNPVDG--SVEYFNENGKSSRP--FLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDW 518
           +        S  Y+++NGKS +        PV + R++S FG R HP+L    MHTG+D+
Sbjct: 242 YSQGKGDEESGSYYDQNGKSLQQKEGFNTEPVAYTRISSPFGYRVHPVLHTVHMHTGIDY 301

Query: 519 AAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQG 578
           AAP GTPI A  DG V    W GGYG   +I H NG  + Y H  A +     G  V+ G
Sbjct: 302 AAPTGTPIKAAADGEVIFKGWKGGYGNTVMIRHANGVETLYGHMSAFSP--ADG-RVRAG 358

Query: 579 QIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLL 638
           ++IG++GTTG STGPHLHYE  VNG  V+ T V +P  + L    +  F  ++K  +++L
Sbjct: 359 EVIGFVGTTGRSTGPHLHYEARVNGQPVNPTTVALPTPK-LTPTNMAAFRKQQKDASTML 417

Query: 639 NNGEN 643
           +   +
Sbjct: 418 STVRS 422


>gi|163787191|ref|ZP_02181638.1| peptidase, M23/M37 family protein [Flavobacteriales bacterium
           ALC-1]
 gi|159877079|gb|EDP71136.1| peptidase, M23/M37 family protein [Flavobacteriales bacterium
           ALC-1]
          Length = 439

 Score =  314 bits (803), Expect = 4e-83,   Method: Composition-based stats.
 Identities = 85/387 (21%), Positives = 159/387 (41%), Gaps = 25/387 (6%)

Query: 274 FADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRV-DQLTKDEILRIGVVQKDD 332
           +      I+   T    +        +  +IA+  K+   V   L       +   ++++
Sbjct: 52  YEFKRDTIKKGDTFGIILEQNNIGYPEIYQIAEQTKDTFNVARSLKVGNPYTLLFSKENE 111

Query: 333 ---KFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDG 389
                    F      +  + I   D+ +     +P+                +  I   
Sbjct: 112 NDSLQKPTTFIYQKSLEDYVVIDFKDSIQAYTSKKPITY---------VERTATGIIESS 162

Query: 390 IWRATSFNGMNSNLVKLIMR-TLASSVNLQEHLKPTDFLETFFSVNHANNQA-SDDSELL 447
           I +     G++  L   +     A +++    L+  D  +  ++  + ++   +   ++ 
Sbjct: 163 ISKTLDEKGLSQGLAYKMADDIYAWTIDF-RRLQKGDRFKVIYTDKYIDDSIYAGVHDVK 221

Query: 448 YIHARFGETRTRFYRFLNPV-DGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHP- 505
             +          +RF      G ++YFNE+ K+ R   L+ PV + R++S + +R    
Sbjct: 222 AAYFEHNGDSLYAFRFETDSVKGIIDYFNEDAKNLRRAFLKAPVQYSRISSRYNLRRRIA 281

Query: 506 ILGY-SRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDA 564
           + GY  R H G D+AA  GTPI+A  +G V ++   GG GK   I H + Y + Y H   
Sbjct: 282 VYGYKVRPHKGTDFAARIGTPIMATANGTVTESRRRGGNGKYVKIRHNDTYSTQYLHMSR 341

Query: 565 IAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLL 624
             + +K G  VKQG IIG++G TG + GPH+ Y    NG +VD  K ++PE + +   L 
Sbjct: 342 --RAVKKGDFVKQGDIIGYVGMTGNTGGPHVCYRFWKNGKQVDPFKQKLPEAKPISDSLK 399

Query: 625 QRFAM----EKKRINSLLNNGENPKKP 647
            ++       K+R++++      P  P
Sbjct: 400 VKYLDFIVPVKQRLDNIFFLEAEPINP 426


>gi|332876595|ref|ZP_08444355.1| peptidase, M23 family [Capnocytophaga sp. oral taxon 329 str.
           F0087]
 gi|332685428|gb|EGJ58265.1| peptidase, M23 family [Capnocytophaga sp. oral taxon 329 str.
           F0087]
          Length = 410

 Score =  314 bits (803), Expect = 4e-83,   Method: Composition-based stats.
 Identities = 81/401 (20%), Positives = 158/401 (39%), Gaps = 18/401 (4%)

Query: 248 YSKKIKIIEENRTITSPQVLIDKIPEFADDLI---PIQHNTTIFDAMVHAGYSNGDSAKI 304
           Y+           + +P  + +      D  I    ++   T    +   G + GD   I
Sbjct: 21  YTISTGTTSATTQVATPAPVYEFGFNLNDYNINKDTLRQGDTFGKLLEEKGVAVGDIYNI 80

Query: 305 AKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVE 364
               K  +        ++      +K    T   F         + + L D+        
Sbjct: 81  TTQTKELINPKNFHVGKMYAFLYDKK-KPNTPHSFVYQPNVVDYIVVHLTDS-------- 131

Query: 365 PVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPT 424
            +      +   +     + +I + +       G++ N    + +    +++    L+  
Sbjct: 132 -IYAYTAQRKVSVVEKAFAGSIENNLTVDAQAAGISQNATYQLGQIFDYTIDFFR-LQKG 189

Query: 425 DFLETFFSVNH-ANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSV-EYFNENGKSSR 482
           D  +  +   +  +   +   ++   +  +   +   + +          +++ENG   +
Sbjct: 190 DVFKIIYDERYVEDTIFAGVEKVKAAYFEWEGKKYYAFNYTTDTIKGTNGFYDENGNMMK 249

Query: 483 PFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGG 542
              L++P+   R+TS FGMR+HP+L   + H G D+AAP GTPI     G V +A    G
Sbjct: 250 RMFLKSPLDIFRITSKFGMRFHPVLHRMKGHFGTDYAAPTGTPIRVTAAGTVIEAGHTSG 309

Query: 543 YGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVN 602
            G    + H N Y + Y H   I    + G  V QG++IG +G+TGL+TGPH+ Y    N
Sbjct: 310 NGNYVKVRHNNTYTTQYLHMSRIIA--RKGQHVAQGEVIGLVGSTGLATGPHVCYRFWKN 367

Query: 603 GIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGEN 643
           G++VD  K ++P+   +   L   +    K + + L+N ++
Sbjct: 368 GVQVDPLKEKLPDAVPIDDKLKAPYLEYIKPLKAQLDNLQS 408


>gi|46581796|ref|YP_012604.1| M24/M37 family peptidase [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|46451219|gb|AAS97864.1| peptidase, M23/M37 family [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|311232349|gb|ADP85203.1| Peptidase M23 [Desulfovibrio vulgaris RCH1]
          Length = 436

 Score =  314 bits (803), Expect = 4e-83,   Method: Composition-based stats.
 Identities = 90/429 (20%), Positives = 166/429 (38%), Gaps = 29/429 (6%)

Query: 217 FFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFAD 276
             +L    +    L  AD  T+    +      +      ENR +               
Sbjct: 23  SVMLLRSPSTPPELPQADNGTVSISSNATEAAPEATAEQPENRVV--------------- 67

Query: 277 DLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTI 336
               +    T    +     ++  +  +  A +    +  +   +   +     +   +I
Sbjct: 68  -RGVVSQGDTAGKILQGW-VTSNRTQALLDACRKVYSLAMIRTGQPYTVVANATNG--SI 123

Query: 337 VRFSIYHKQKHLLTIALNDNNE-YVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATS 395
            RF         L +  ++  E ++  VEP+  +                I   +++A +
Sbjct: 124 ERFEYEIDDDRKLVVNADEAGEGFIARVEPIHYEYELTRVD-------AVIDSNLFQAVA 176

Query: 396 FNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGE 455
             G +  L   +       V+    ++  D         + +        ++        
Sbjct: 177 DAGESPGLAITLADIFGWEVDFIRDIREGDSFSVLVEKRYRDGDFKGYGRVIAATFTNQG 236

Query: 456 TRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHT 514
                + F +       Y+N++G+S R   L+ P+ F R+TSGF     HPI    R H 
Sbjct: 237 ETYEAFYFTDDFG-GPAYYNKDGQSLRKSFLKAPLSFTRVTSGFSKNRLHPIFMERRPHP 295

Query: 515 GVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTA 574
           G+D+AAP GTP+ +V +G V++A W  GYG Q ++ HG    + Y+H    AK ++ GT 
Sbjct: 296 GIDYAAPTGTPVKSVANGEVKQAGWVNGYGNQVIVRHGGRMETLYSHLSGFAKGVRKGTK 355

Query: 575 VKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRI 634
           V+QGQ+IG++G TG +TGPHL + +   G  V+  K+  P  E +    ++ F      I
Sbjct: 356 VRQGQVIGYVGATGWATGPHLDFRIRQGGDFVNPAKMMNPRSEPVAKKRMKAFGDRVAFI 415

Query: 635 NSLLNNGEN 643
            + ++   N
Sbjct: 416 RTFIDGTRN 424


>gi|298207110|ref|YP_003715289.1| peptidase, M23/M37 family protein [Croceibacter atlanticus
           HTCC2559]
 gi|83849744|gb|EAP87612.1| peptidase, M23/M37 family protein [Croceibacter atlanticus
           HTCC2559]
          Length = 417

 Score =  313 bits (802), Expect = 5e-83,   Method: Composition-based stats.
 Identities = 84/401 (20%), Positives = 154/401 (38%), Gaps = 20/401 (4%)

Query: 249 SKKIKIIEENRTITSPQVLID---KIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIA 305
             + K   E   I    ++ +      E+      ++   T    +   G        I 
Sbjct: 18  GNEPKPETEPMAIAPKPIVKEYGFNTEEYEFVRDTVKSGDTFGTILDAHGVPAQTVFNIT 77

Query: 306 KALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEP 365
            ++K      ++       I +  KD   T   F   + +     +  +D+         
Sbjct: 78  NSVKETFNPARIGIGRPYAI-LKSKDTSQTAQAFIYENDKVDYTVVNFSDSIG------- 129

Query: 366 VKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTD 425
                  +   +   E +  I   + +    +G++  L   +    A +++    L+  D
Sbjct: 130 --AYKGQKKLTVVEKEATGIINSSLSKTMEDSGLSVVLAYKMADVYAWTIDFLR-LQEGD 186

Query: 426 FLETFFSVNHANNQASDD-SELLYIHARFGETR-TRFYRFLNPVDGSVEYFNENGKSSRP 483
             +  +   + N+    +   +  ++          F    + + G  EY++E   + R 
Sbjct: 187 RFKVIYEEKYINDTIYAELGSVKAVYFEHRGEPFYAFNFKHDSIIGQREYYDEEANNLRR 246

Query: 484 FLLRTPVPFGRMTSGFGMRYHPILGYS--RMHTGVDWAAPRGTPIVAVGDGIVEKANWAG 541
             L+ PV F R++S F ++          R H G D+AA  GTPI+A  DG+V K+ + G
Sbjct: 247 AFLKAPVQFSRISSRFNLKRRIKYYGYKLRPHRGTDYAASVGTPILATADGVVTKSEYRG 306

Query: 542 GYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIV 601
           G G    + H + Y + Y H     + +  G  VKQG +IGW+G TG + GPH+ Y    
Sbjct: 307 GNGNYVKLRHNSTYETQYLHMKK--RKVNVGQYVKQGDVIGWVGMTGNTGGPHVCYRFWK 364

Query: 602 NGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGE 642
           NG++VD  K  +P  E L+  L   + M    +   L+  E
Sbjct: 365 NGVQVDPLKQDLPSAEPLEEALRTEYFMHIDDLKRRLDALE 405


>gi|323494326|ref|ZP_08099438.1| hypothetical protein VIBR0546_07212 [Vibrio brasiliensis LMG 20546]
 gi|323311489|gb|EGA64641.1| hypothetical protein VIBR0546_07212 [Vibrio brasiliensis LMG 20546]
          Length = 416

 Score =  313 bits (802), Expect = 5e-83,   Method: Composition-based stats.
 Identities = 89/418 (21%), Positives = 153/418 (36%), Gaps = 18/418 (4%)

Query: 227 SFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTT 286
             +L       +     H          + ++  +       D   +  D    IQ    
Sbjct: 2   VLSLPILAAIAVSSSPQHGQYQRTIDLSLPDSTLVDHLMTDTDVAQDVPDYEYVIQAGDN 61

Query: 287 IFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQK 346
           +       G+   +  KI +   N + +D L     LR    +  +  ++ +  +     
Sbjct: 62  LSSIFNQLGFGYSELMKIMETDLNYLALDTLKPGNTLRFWRDE--ETKSLAKMELEFSLV 119

Query: 347 HLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKL 406
                    + +Y       +          +       I     ++ +  G+  + ++ 
Sbjct: 120 ERAVYTRVGDGDY-------EFTDVKIPGVWKPFALVGEINGSFSQSVNALGLGKSEIEQ 172

Query: 407 IMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNP 466
           ++  L   VN    L+  D  E   S  + + Q + + E+  I           Y   + 
Sbjct: 173 VVSLLKDKVNFARDLRAGDKFEVVQSRQYVDEQLTGNREIQAIRIYNRGRVLSAYLHSDG 232

Query: 467 VDGSVEYFNENGKSSRPFLLR-TPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGT 524
                 Y++ NG S +    R       R++S F     HP+ G    H G DWA P GT
Sbjct: 233 Q-----YYDYNGDSLQRAFQREPITGRYRLSSNFNPNRKHPVTGRISPHNGTDWAVPTGT 287

Query: 525 PIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWI 584
           PIV+ GDG+V         G   +I HG+ Y + Y H   I   ++ G  V +GQ IG  
Sbjct: 288 PIVSTGDGVVVMTRKHPYAGNYVVIQHGSRYKTRYLHLSKIL--VRKGQKVSRGQRIGLS 345

Query: 585 GTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGE 642
           G TG  TGPH+HYELI  G  V++ K  IP   ++  + +  F + +   N++L   E
Sbjct: 346 GATGRVTGPHIHYELIDRGRPVNAMKANIPMANSVPNNQMASFKIRRDEWNAMLKQRE 403


>gi|86143743|ref|ZP_01062119.1| peptidase, M23/M37 family protein [Leeuwenhoekiella blandensis
           MED217]
 gi|85829786|gb|EAQ48248.1| peptidase, M23/M37 family protein [Leeuwenhoekiella blandensis
           MED217]
          Length = 399

 Score =  313 bits (802), Expect = 5e-83,   Method: Composition-based stats.
 Identities = 81/401 (20%), Positives = 158/401 (39%), Gaps = 17/401 (4%)

Query: 245 PITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKI 304
               +K+ + ++E       +     + ++      +Q   +    +   G   G   +I
Sbjct: 4   ADDETKEKEPVKEKVVKPVNKRFGYVLDDYEVVSDTVQSGDSFGQILFENGIDYGTIQQI 63

Query: 305 AKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVE 364
             ++KN     ++   +   + +  KD       F     +   + +   D        E
Sbjct: 64  TDSVKNTFDTRKIVVGKPYTL-LKSKDSTNQAQVFIYEQNKIDYVVLDFAD--------E 114

Query: 365 PVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPT 424
            VK     +   ++       I D +       G+N  +   +    A +++    L+P 
Sbjct: 115 VVKAAAKKRPVTIKERVAHGVINDNLSTTFDDLGVNILVAYGMADIYAWTIDFFR-LQPG 173

Query: 425 DFLETFFSVNHANNQ-ASDDSELLYIHARFGETRTRFYRFLNPV--DGSVEYFNENGKSS 481
           D  +  ++  + N+   +   E+              + F N     G  +Y++++  + 
Sbjct: 174 DKFKVVYTEKYINDTIPAGFGEIKASWFEHKGKPIYAFAFQNDSISGGQRDYYDQDADNL 233

Query: 482 RPFLLRTPVPFGRMTSGFGMRYHPIL--GYSRMHTGVDWAAPRGTPIVAVGDGIVEKANW 539
           R   L++P+ FGR++S + +R          R H G D+AAP GTPI+A  DG +  + +
Sbjct: 234 RRAFLKSPLKFGRISSRYNLRRRIAYYGNRIRPHKGTDFAAPVGTPIMATSDGTIIASEY 293

Query: 540 AGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYEL 599
            GG G    I H   Y + Y H     + +  G  V+QG +IG+IG TG ++GPH+ Y  
Sbjct: 294 RGGNGNYVKIRHNGTYDTQYLHMSK--RAVSRGDFVRQGDVIGYIGMTGNTSGPHVCYRF 351

Query: 600 IVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNN 640
             NG +VD   + +P    L+     ++      I + L+ 
Sbjct: 352 WKNGKQVDPFAIDLPTSAPLEEQYQPQYFEYIAPIKAQLDA 392


>gi|28900372|ref|NP_800027.1| hypothetical protein VPA0517 [Vibrio parahaemolyticus RIMD 2210633]
 gi|28808683|dbj|BAC61860.1| conserved hypothetical protein [Vibrio parahaemolyticus RIMD
           2210633]
          Length = 427

 Score =  313 bits (802), Expect = 5e-83,   Method: Composition-based stats.
 Identities = 101/433 (23%), Positives = 156/433 (36%), Gaps = 27/433 (6%)

Query: 220 LHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRT-------ITSPQVLIDKIP 272
           L N  ++   L Y+ P  +     H +  S   K I  N         I          P
Sbjct: 10  LPNLTSRRALLLYSLPVLVAIGVSHSLKESSLTKTIALNLPESQVVERILDATTAEVVTP 69

Query: 273 EFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDD 332
              +    IQ    +       G+      K+ +   N + +D L     LR    + D 
Sbjct: 70  PNFEYQ--IQAGDNLSTIFSQLGFGYSSLMKVMETDLNYLALDTLKPGNTLRFW--RNDA 125

Query: 333 KFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWR 392
              + +  +       +   LN +  Y                  R       I      
Sbjct: 126 TGELEKMELQFSIADKVVYQLNSDGGY-------DFTDISIPGVWRQEPLVGVIQGSFSS 178

Query: 393 ATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHAR 452
           + +  G++S  +  ++  L   VN    L+  D  E        N  ++  +E+  I   
Sbjct: 179 SANRLGLSSAEISQVVSLLKEQVNFGRDLRAGDRFEVVRRSQTINGVSTGKNEIEAIKIY 238

Query: 453 FGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGR-MTSGFGMRY-HPILGYS 510
                   Y   +       ++N  G+S +    R PV     ++SGF     HP+ G  
Sbjct: 239 NRGREITAYLHTDGQ-----FYNAKGESLQRAFQRYPVSRSWRISSGFNPNRLHPVTGRV 293

Query: 511 RMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIK 570
             H G D+A P GTP+V+ GDG V         G   ++ HGN Y + Y H   I   +K
Sbjct: 294 APHNGTDFAVPTGTPVVSTGDGTVIMTRKHPYAGNYVVVEHGNKYKTRYLHLSKIL--VK 351

Query: 571 AGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAME 630
            G  V +GQ IG  G TG  TGPHLHYELI  G  V++ +  IP   ++    +  F   
Sbjct: 352 KGQKVSRGQRIGLSGKTGRVTGPHLHYELIEYGRPVNAMRANIPMASSVPKKEMATFIAN 411

Query: 631 KKRINSLLNNGEN 643
           +  ++ LL N E 
Sbjct: 412 RDEMDKLLKNKEK 424


>gi|328470329|gb|EGF41240.1| hypothetical protein VP10329_06012 [Vibrio parahaemolyticus 10329]
          Length = 427

 Score =  313 bits (801), Expect = 6e-83,   Method: Composition-based stats.
 Identities = 101/433 (23%), Positives = 156/433 (36%), Gaps = 27/433 (6%)

Query: 220 LHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRT-------ITSPQVLIDKIP 272
           L N  ++   L Y+ P  +     H +  S   K I  N         I          P
Sbjct: 10  LPNLTSRRALLLYSLPVLVAIGVSHSLKESSLTKTIALNLPESQVVERILDATTAEVVTP 69

Query: 273 EFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDD 332
              +    IQ    +       G+      K+ +   N + +D L     LR    + D 
Sbjct: 70  PNFEYQ--IQAGDNLSTIFSQLGFGYSSLMKVMETDLNYLALDTLKPGNTLRFW--RNDA 125

Query: 333 KFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWR 392
              + +  +       +   LN +  Y                  R       I      
Sbjct: 126 TGELEKMELQFSIADKVVYQLNSDGGY-------DFTDISIPGVWRQEPLVGVIQGSFSS 178

Query: 393 ATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHAR 452
           + +  G++S  +  ++  L   VN    L+  D  E        N  ++  +E+  I   
Sbjct: 179 SANRLGLSSAEISQVVGLLKEQVNFGRDLRAGDRFEVVRRSQTINGVSTGKNEIEAIKIY 238

Query: 453 FGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGR-MTSGFGMRY-HPILGYS 510
                   Y   +       ++N  G+S +    R PV     ++SGF     HP+ G  
Sbjct: 239 NRGREITAYLHTDGQ-----FYNAKGESLQRAFQRYPVSRSWRISSGFNPNRLHPVTGRV 293

Query: 511 RMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIK 570
             H G D+A P GTP+V+ GDG V         G   ++ HGN Y + Y H   I   +K
Sbjct: 294 APHNGTDFAVPTGTPVVSTGDGTVIMTRKHPYAGNYVVVEHGNKYKTRYLHLSKIL--VK 351

Query: 571 AGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAME 630
            G  V +GQ IG  G TG  TGPHLHYELI  G  V++ +  IP   ++    +  F   
Sbjct: 352 KGQKVSRGQRIGLSGKTGRVTGPHLHYELIEYGRPVNAMRANIPMASSVPKKEMATFIAN 411

Query: 631 KKRINSLLNNGEN 643
           +  ++ LL N E 
Sbjct: 412 RDEMDKLLKNKEK 424


>gi|224824110|ref|ZP_03697218.1| Peptidase M23 [Lutiella nitroferrum 2002]
 gi|224603529|gb|EEG09704.1| Peptidase M23 [Lutiella nitroferrum 2002]
          Length = 445

 Score =  313 bits (801), Expect = 7e-83,   Method: Composition-based stats.
 Identities = 97/419 (23%), Positives = 162/419 (38%), Gaps = 11/419 (2%)

Query: 224 KNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQH 283
                         +    D P      ++ + +   +      +   P + D+   +Q 
Sbjct: 28  AASLPLFGVVTAFAVAGNGDQPEPPHIDVETVTQRLALPVYTSSVSTTPYWRDEQ--VQR 85

Query: 284 NTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYH 343
             T+   +   G  +G++ +   +      + +L   + L +      + F +   +   
Sbjct: 86  GDTLGRLLNRLGVGDGEAQRFLNSSPLSKNLLKLKDGQTLSVQTNDAGELFGLRFLNDDE 145

Query: 344 KQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNL 403
             + ++      N ++    +P  ++            ES  +   +       G+   +
Sbjct: 146 NGEQVMVAIEKANGQWRASADP--LETQTIQSMRSIDIESGGVGAALS----RAGVPPEI 199

Query: 404 VKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRF 463
              +         L   LK  D +   F     N     +  LL      G    R Y F
Sbjct: 200 RAQLNEIFTDRFELAS-LKQGDRINLVFESLLFNGSPIANGNLLAAEVEHGGQSYRAYYF 258

Query: 464 LNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRG 523
            +    S  Y++ENG   +      PV   R++SG+GMRYHP+L   RMH GVD+AA  G
Sbjct: 259 AHDS-ESGAYYDENGNPIKKGFNEQPVRGARISSGYGMRYHPVLHSLRMHKGVDYAAVTG 317

Query: 524 TPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGW 583
           TPIVA  DGIV  A    GYG   +I H     + Y H    A  + AG +VK G +IG+
Sbjct: 318 TPIVAPADGIVATAETENGYGNVVVIRHSAKMSTLYGHMSRFAPGMHAGKSVKAGDLIGY 377

Query: 584 IGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGE 642
           +G+TG STGPHLH+E+ +N   VD +   +P    L       F     ++++ L    
Sbjct: 378 VGSTGRSTGPHLHFEVRINNEAVDPSTAALPTP-GLSAQQRLAFRQSSVKLSANLKLLR 435


>gi|312883103|ref|ZP_07742834.1| cell wall endopeptidase family M23/M37 [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309369263|gb|EFP96784.1| cell wall endopeptidase family M23/M37 [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 416

 Score =  313 bits (801), Expect = 7e-83,   Method: Composition-based stats.
 Identities = 89/384 (23%), Positives = 149/384 (38%), Gaps = 20/384 (5%)

Query: 260 TITSPQVLIDKIPEFA--DDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQL 317
           +  + +        +   D    IQ   ++       G+   D  +I +   N + +D L
Sbjct: 33  SSLALESSPTNESSYHHPDYEYVIQRGDSLSKIFEQLGFGYSDLMRIMETDLNYLALDTL 92

Query: 318 TKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYM 377
                LR      D    + +  +             D+  Y       +          
Sbjct: 93  RPGNTLRFWRD--DKNTHLEKMELEFSLVDRAVYQRLDDGNY-------EFSDIKIPGEW 143

Query: 378 RTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHAN 437
           ++      I     ++ +  G+  + ++ ++  L   +N    L+  D  E   S     
Sbjct: 144 KSFPLVGQIKGSFSQSVNSMGLGKSEIEQVVGLLKDKINFGRDLRAGDKFEVVQSRQFVG 203

Query: 438 NQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGR-MT 496
           N ++ ++E+  I           Y   +       Y++ENG S +    R PV     M+
Sbjct: 204 NTSTGNTEIQAIKIFNRGQVYSAYLHSDGQ-----YYDENGDSLQRAFQREPVNGRYRMS 258

Query: 497 SGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGY 555
           SGF  R  HP+ G    H G DWA P GTPIV+ GDG+V         G   +I HG+ Y
Sbjct: 259 SGFNPRRKHPVTGRISPHNGTDWATPTGTPIVSTGDGVVIMTRKHPYAGNYVVIEHGSRY 318

Query: 556 VSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPE 615
            + Y H   I   ++ G  V +GQ IG  G TG  TGPH+HYELI  G  V++    IP 
Sbjct: 319 KTRYLHLSKIL--VRKGQKVSRGQRIGLSGATGRVTGPHIHYELIDRGRPVNALTANIPM 376

Query: 616 RENLKGDLLQRFAMEKKRINSLLN 639
            +++    +  F   + +++ +L 
Sbjct: 377 AQSVPKSQMVEFERNRYKMDKMLK 400


>gi|261250296|ref|ZP_05942872.1| membrane protein [Vibrio orientalis CIP 102891]
 gi|260939412|gb|EEX95398.1| membrane protein [Vibrio orientalis CIP 102891]
          Length = 347

 Score =  313 bits (801), Expect = 7e-83,   Method: Composition-based stats.
 Identities = 95/361 (26%), Positives = 156/361 (43%), Gaps = 20/361 (5%)

Query: 290 AMVHAGYSNGDSAKIAKALKNEVR-VDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHL 348
               AG S+    ++    K+  R + ++   +  + G    +    I R          
Sbjct: 4   LFQRAGLSSRLLYELTSTNKDIERQLTRVRPGDSFQFGFDADNQLIQIKR---QLSPYEA 60

Query: 349 LTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIM 408
             +  +DN             I+ +  + + +     I    W A +  G+ +N +  + 
Sbjct: 61  FLVTKSDNG--------YTSTIDKKDVHFQYNYAEAKITSNFWNAGTNAGLTANQIMELA 112

Query: 409 RTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVD 468
                 ++    ++  D     +       +     +++              R     D
Sbjct: 113 GIFGWDIDFALDIRNGDNFRILYQEKVVEGEVVGRGKIIAAIFTNQGDTFTAIR----DD 168

Query: 469 GSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGM-RYHPILGYSRMHTGVDWAAPRGTPIV 527
            S  Y++ENG++ +   LR+P+ F R+TS F   R HP+ G  R H G D+AAP GTPI 
Sbjct: 169 KSGNYYDENGRAMKKAFLRSPLDFRRVTSNFNPTRRHPVTGKVRAHRGTDYAAPVGTPIW 228

Query: 528 AVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTT 587
           A GDGIV+K+++    G    I H N Y++ Y H     + +K G  VKQGQ IG +G T
Sbjct: 229 AAGDGIVQKSSYNQFNGNYVFIKHSNTYITKYLHLTK--RMVKTGQRVKQGQTIGTLGGT 286

Query: 588 GLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAME-KKRINSLLNNGENPKK 646
           G  TGPHLHYE +VNG+  ++  V++P+ ++L G     F    K R++ L   GE    
Sbjct: 287 GRVTGPHLHYEFLVNGVHKNARTVKLPQSKSLTGKTKATFIANAKIRLDKLERYGELLAT 346

Query: 647 P 647
           P
Sbjct: 347 P 347


>gi|256829804|ref|YP_003158532.1| peptidase M23 [Desulfomicrobium baculatum DSM 4028]
 gi|256578980|gb|ACU90116.1| Peptidase M23 [Desulfomicrobium baculatum DSM 4028]
          Length = 470

 Score =  313 bits (801), Expect = 7e-83,   Method: Composition-based stats.
 Identities = 89/390 (22%), Positives = 148/390 (37%), Gaps = 17/390 (4%)

Query: 264 PQVLIDKIPEFADDLIPIQHNTTIFDAMV-HAGYSNGDSAKIAKALKNEVRVDQLTKDEI 322
           P+    + PE       I+   T    +  H G    +   +    K+   +D L   + 
Sbjct: 92  PEAYAPREPEITRMSDTIKSGDTPSTLLEGHLGLP--EIYSLCNESKDFYPLDNLRAGQP 149

Query: 323 LRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEE 382
             +    K     ++           L ++L D+          +           T   
Sbjct: 150 WTMIYSNKA----LIGLEYEIDSNERLVVSLTDSG--------YEFRREAIPYETETKTV 197

Query: 383 SPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASD 442
           S  +   ++ A +  G +  L   +    A  V+    L+  D  +          +   
Sbjct: 198 SGVVESSLFGAVTTAGESEELALRLGNVFAYDVDFTRDLRTGDTFKVIIEKKSREGKFVG 257

Query: 443 DSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMR 502
             +L             +        G+  Y++E G+  R   L++P+PF R++SG+ M 
Sbjct: 258 YGQLAAASFTNQGQTY-YAYQYTDKKGNTAYYDEKGRPLRKAFLKSPLPFTRISSGYSMS 316

Query: 503 Y-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNH 561
             HPIL Y R H G+D+AAP GTPI  V DGI+ +       G+   + H NGY + YNH
Sbjct: 317 RLHPILKYRRPHQGIDYAAPTGTPISTVADGIIAQVGSNKSQGRFVRVIHSNGYETIYNH 376

Query: 562 QDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKG 621
               AK  K G  VKQG  IG++G+TG +TGPHL + +  NG  ++  K++    + +  
Sbjct: 377 MSKFAKVSKKGAKVKQGATIGYVGSTGYATGPHLDFRMRQNGKLINPLKLKTMPADPIAS 436

Query: 622 DLLQRFAMEKKRINSLLNNGENPKKPLFTS 651
             +  F        + L       K     
Sbjct: 437 KEMPAFKAVVAAYKAQLEEPVQSAKLEQAP 466


>gi|126662628|ref|ZP_01733627.1| peptidase, M23/M37 family protein [Flavobacteria bacterium BAL38]
 gi|126626007|gb|EAZ96696.1| peptidase, M23/M37 family protein [Flavobacteria bacterium BAL38]
          Length = 412

 Score =  313 bits (801), Expect = 8e-83,   Method: Composition-based stats.
 Identities = 73/373 (19%), Positives = 148/373 (39%), Gaps = 17/373 (4%)

Query: 272 PEFADDLIPIQHNTTIFDAMVHAGYSNG-DSAKIAKALKNEVRVDQLTKDEILRIGVVQK 330
            ++      I+   T    +      +      + K +K+   V ++   +   + + +K
Sbjct: 45  NDYKVVRDTIRSGDTFGKILEKFPLKDSLRIYDVTKKVKDSFNVRRIKAGKPYILFLDKK 104

Query: 331 DDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGI 390
               T+        + +   I   D+       +P  +                 I   +
Sbjct: 105 -KPNTLKALIYIEDKINYTVIDFRDSIVVSNKQKPTTLKRRIVAAE---------IEGSL 154

Query: 391 WRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQA-SDDSELLYI 449
               S  G+++ L   +    A +V+    ++  D      +    ++        +   
Sbjct: 155 SETLSNAGVSAGLANKLANIYAYTVDF-FKIQKGDKFAVTINERFIDDTIYVGVESIEAS 213

Query: 450 HARFGETRTR-FYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPIL 507
           +      +   F   ++      ++++ENGK  +   L+ P+ + R++S F  +  HP+ 
Sbjct: 214 YFEHKGKKIFAFPYKISDNQKYADFYDENGKGLKSMFLKAPLDYFRISSRFSGKRFHPVQ 273

Query: 508 GYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAK 567
              + H G D+AAP GTPI     G+VE+  +  G G    + H + Y + Y H   I  
Sbjct: 274 MRFKAHNGTDYAAPHGTPIKTTASGVVERTGYTSGNGNFVKVRHSSTYATQYLHMSKIL- 332

Query: 568 NIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRF 627
            +K G  V QGQ+IG +G+TGL+TGPH+ Y    NG++VD  + ++P  E +     +++
Sbjct: 333 -VKNGQRVTQGQVIGKVGSTGLATGPHVCYRFWKNGVQVDPLRQQLPNAEPMNESHKKKY 391

Query: 628 AMEKKRINSLLNN 640
                 +   L++
Sbjct: 392 LSHIAPLKKELDS 404


>gi|258404310|ref|YP_003197052.1| Peptidase M23 [Desulfohalobium retbaense DSM 5692]
 gi|257796537|gb|ACV67474.1| Peptidase M23 [Desulfohalobium retbaense DSM 5692]
          Length = 465

 Score =  312 bits (800), Expect = 8e-83,   Method: Composition-based stats.
 Identities = 95/405 (23%), Positives = 162/405 (40%), Gaps = 15/405 (3%)

Query: 229 TLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIF 288
           T          Q      T SK +       +  +       +P        IQ   T  
Sbjct: 55  TSSPVQAGQPQQTSKAQQTASKPVAKEPSLGSQMAAPRAEAALPPLETTKGTIQPGQTAT 114

Query: 289 DAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHL 348
             + +  +       +++  +    + +L   +   I            + S    +   
Sbjct: 115 QLLANY-FEAPTIYALSRQCEEVYPLTRLKAGQPYTIASRN----GEFKQLSYEINETAK 169

Query: 349 LTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIM 408
           L I   D  E+ +  +P+           R +  S  I+  ++ A S  G       L+ 
Sbjct: 170 LLIEKQD-GEFCVAKQPIAY-------ETRKTLVSGTIHSSLYTAVSEAGEEPEFALLLA 221

Query: 409 RTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVD 468
              A  V+    L+  D         +   + S    +L           + + + +   
Sbjct: 222 EIFAWDVDFVRDLRQGDHFTALVEKRYRKGKHSGYGRILAASFTNKGKTFQAFWYEDTQG 281

Query: 469 GSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIV 527
               YF+  G+S R   L+ P+ F R++SG+     HP+L   R H G+D+AA  GTPI 
Sbjct: 282 -EGSYFDARGQSVRKAFLKAPLSFTRISSGYSNNRLHPVLKIRRPHHGIDYAARTGTPIK 340

Query: 528 AVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTT 587
            VGDG++   ++A G G+   + H NGYV+ YNH    A N++ G  V+QG++IG++G+T
Sbjct: 341 TVGDGVIMTRSYAKGAGRYVKVRHPNGYVTVYNHMSRFASNLRTGQKVRQGEVIGYVGST 400

Query: 588 GLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKK 632
           GLSTGPHL + +  +G  V+  KV  P  E +  +  +RF    +
Sbjct: 401 GLSTGPHLDFRMKKHGTYVNPLKVESPPCEPVPSEEKERFQAHIQ 445


>gi|120437492|ref|YP_863178.1| M23 family peptidase [Gramella forsetii KT0803]
 gi|117579642|emb|CAL68111.1| peptidase, family M23 [Gramella forsetii KT0803]
          Length = 410

 Score =  312 bits (800), Expect = 8e-83,   Method: Composition-based stats.
 Identities = 85/374 (22%), Positives = 163/374 (43%), Gaps = 16/374 (4%)

Query: 272 PEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKD 331
            +F      I+   +    M   G  +G   +I+  +K+     ++T  +   I +  KD
Sbjct: 46  NDFEVIKDTIESGDSFGFIMDQNGVGHGKVFEISNKVKDSFNPARITAGKKYMI-LKAKD 104

Query: 332 DKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIW 391
              T   F   + + +   +AL D+        PV +              S  I   + 
Sbjct: 105 SAKTAQYFIYENDKINYTVVALGDSIYAEKKKRPVTIKKREV---------SGVITSSLS 155

Query: 392 RATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIH- 450
            A    G+++ LV  +      S++    L+  D  +  +   + ++      E +    
Sbjct: 156 EAMQAQGLSNLLVYELSNIYQWSIDF-FKLQKGDQFKMVYQEKYIDDTIFAGIEKVDAAV 214

Query: 451 ARFGETRTRFYRFLNPVDGSVE-YFNENGKSSRPFLLRTPVPFGRMTSGFGMRY-HPILG 508
            +  +     +R+LN        +++E  K+ + F L+ P+ + R++S F  R  HP+  
Sbjct: 215 FKHSDEPFYAFRYLNDTITGKANFYDEEAKALQSFFLKAPLDYSRISSRFSKRRFHPVQK 274

Query: 509 YSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKN 568
             + H G D+AAP GTPIV+  +G V  +++  G G    + H   Y + Y H     +N
Sbjct: 275 RWKAHLGTDYAAPHGTPIVSTANGTVIASSYTSGNGNYVKVRHNGKYTTQYLHMTR--RN 332

Query: 569 IKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFA 628
           ++ G  VKQG +IG++G+TGL+TGPH+ Y   V+G +VD  +  +P  ++++ +L + + 
Sbjct: 333 VRNGQTVKQGDVIGYVGSTGLATGPHVCYRFWVHGRQVDPFRQNLPSAKHIEDELKEEYF 392

Query: 629 MEKKRINSLLNNGE 642
              + +   L    
Sbjct: 393 AYIEPLRDELEQIP 406


>gi|119774406|ref|YP_927146.1| M24/M37 family peptidase [Shewanella amazonensis SB2B]
 gi|119766906|gb|ABL99476.1| peptidase, M23/M37 family [Shewanella amazonensis SB2B]
          Length = 419

 Score =  312 bits (800), Expect = 9e-83,   Method: Composition-based stats.
 Identities = 90/404 (22%), Positives = 150/404 (37%), Gaps = 23/404 (5%)

Query: 242 HDHPITYSKKIKIIEENRTITSPQVLID----KIPEFADDLIPIQHNTTIFDAMVHAGYS 297
                    +I I  +  ++                 AD    I    T+      AG  
Sbjct: 31  PTAQQPVVGRIPIALDIESLLPQVSEAPLPLAASESVADFDHLIVSGDTLSGLFSRAGVD 90

Query: 298 NGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNN 357
                K+ +A  N + +D L  D  ++  + +K D   +    +Y      +  +  ++ 
Sbjct: 91  QQTMYKVLEADMNILALDTLMPDNRIKFWLDEKGDLQKL---ELYFSPARQVVFSRFEDG 147

Query: 358 EYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNL 417
            +        +D        +    S  I    + +    G+++  +  I   L   +N 
Sbjct: 148 SF-------NVDEIVVDGLWQNRIASGEIRGSFYVSAQRVGLSAAEITKIESLLKEKMNF 200

Query: 418 QEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNEN 477
              L+  D      +  +    A+  S++L I  + G+     ++  +       +++  
Sbjct: 201 ARDLRAGDTFSVLVNDQYVEGLATGTSQILGIQIKSGKREITAFQHTDGN-----FYDAK 255

Query: 478 GKSSRPFLLR-TPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVE 535
           G +      R       RM+S F     HP+ G    H G D+A P GT +VA GDG+V 
Sbjct: 256 GHNLARAFQRVPLDKSFRMSSRFNPVRKHPVTGRVSPHNGADFATPIGTKVVAPGDGVVT 315

Query: 536 KANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHL 595
                   GK  +I HGN + + Y H       ++ G  V +GQ+I   G TG STGPHL
Sbjct: 316 MVTDHKFAGKYIVIEHGNKFRTRYLHLSK--SLVRKGDRVSRGQVIALSGNTGRSTGPHL 373

Query: 596 HYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLN 639
           HYE  VNG  VD  KV +P    L    L  F    +    L++
Sbjct: 374 HYEFHVNGRPVDPMKVPLPTSTQLNSAELSEFISLVRSRQMLMD 417


>gi|291279976|ref|YP_003496811.1| peptidase M23/M37 family [Deferribacter desulfuricans SSM1]
 gi|290754678|dbj|BAI81055.1| peptidase, M23/M37 family [Deferribacter desulfuricans SSM1]
          Length = 371

 Score =  312 bits (800), Expect = 9e-83,   Method: Composition-based stats.
 Identities = 80/363 (22%), Positives = 145/363 (39%), Gaps = 26/363 (7%)

Query: 280 PIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRF 339
            ++   T++  +     +  +   ++K +K      +L   +       +          
Sbjct: 23  TVKPGDTVYQLLSPY-MNPQEILSVSKKIKKLGF--ELKIGQTYEFLKDE---------L 70

Query: 340 SIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGM 399
            ++      + I L + +          +       +   +  S  I D ++ A    G 
Sbjct: 71  VVHDGITRDIVINLINKD----------VKEVKYPIHRLVTVVSGEIDDSLFYAVKKAGE 120

Query: 400 NSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTR 459
           +  L   +       ++  + ++  D             +     ++L