RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780879|ref|YP_003065292.1| hypothetical protein CLIBASIA_03880 [Candidatus Liberibacter asiaticus str. psy62] (652 letters) >gnl|CDD|31082 COG0739, NlpD, Membrane proteins related to metalloendopeptidases [Cell envelope biogenesis, outer membrane]. Length = 277 Score = 144 bits (363), Expect = 6e-35 Identities = 76/212 (35%), Positives = 103/212 (48%), Gaps = 6/212 (2%) Query: 420 HLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGK 479 LK D + S A + L + A + + ++ GK Sbjct: 68 ALKLGDAIALLLSRIIAEKTRRIRLKGLKLEANALSLLVETFAAAEVAFLPGDAYDVGGK 127 Query: 480 SSRPFLLRTPVP--FGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKA 537 F LR P+P G+++SGFG R HP+ G H G+D AAP GTP+ A DG+V A Sbjct: 128 LLELFGLRWPLPNGKGKISSGFGRRIHPVTGRLEPHKGIDIAAPEGTPVYAAADGVVVFA 187 Query: 538 -NWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLH 596 N GYG +I HG+GYV+ Y H +I +K G VK GQ+IG++G+TG STGPHLH Sbjct: 188 GNGGWGYGNLVIIKHGDGYVTVYAHLSSI--LVKEGQKVKAGQVIGYVGSTGRSTGPHLH 245 Query: 597 YELIVNGIKVDS-TKVRIPERENLKGDLLQRF 627 +E+ NG V R + L G L Sbjct: 246 FEVRKNGKLVPPVNPARYLPKGGLLGKLESAL 277 >gnl|CDD|144954 pfam01551, Peptidase_M23, Peptidase family M23. Members of this family are zinc metallopeptidases with a range of specificities. The peptidase family M23 is included in this family, these are Gly-Gly endopeptidases. Peptidase family M23 are also endopeptidases. This family also includes some bacterial lipoproteins, for which no proteolytic activity has been demonstrated. This family also includes leukocyte cell-derived chemotaxin 2 (LECT2) proteins. LECT2 is a liver-specific protein which is thought to be linked to hepatocyte growth although the exact function of this protein is unknown. Length = 96 Score = 135 bits (342), Expect = 4e-32 Identities = 51/97 (52%), Positives = 63/97 (64%), Gaps = 2/97 (2%) Query: 511 RMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIK 570 R H G+D AAP GTP+ A DG+V A + GGYG +I HGNGY + Y H I +K Sbjct: 1 RFHKGIDIAAPTGTPVYAAADGVVVFAGYLGGYGNLVIIDHGNGYETLYAHLSKIL--VK 58 Query: 571 AGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVD 607 G VK GQ+IG +G+TG STGPHLH+E+ NG VD Sbjct: 59 VGQRVKAGQVIGTVGSTGRSTGPHLHFEIRKNGKPVD 95 >gnl|CDD|34550 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning]. Length = 420 Score = 78.9 bits (194), Expect = 4e-15 Identities = 39/129 (30%), Positives = 56/129 (43%), Gaps = 17/129 (13%) Query: 486 LRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDW-----AAPRGTPIVAVGDGIVEKANWA 540 L PV GR+ FG G+ W A G + A+ DG V A+W Sbjct: 299 LAWPVT-GRILRRFG---------QADGGGLRWKGMVIGASAGATVKAIADGRVVYADWL 348 Query: 541 GGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELI 600 GYG ++ HG GY S Y +I + G VK G+ I +G++G P L++E+ Sbjct: 349 RGYGLVVILDHGGGYHSLYGGNQSI--LVNPGQFVKAGEPIALVGSSGGQGRPALYFEIR 406 Query: 601 VNGIKVDST 609 G V+ Sbjct: 407 RQGQPVNPQ 415 >gnl|CDD|39095 KOG3892, KOG3892, KOG3892, N-acetyl-glucosamine-6-phosphate deacetylase [Carbohydrate transport and metabolism]. Length = 407 Score = 30.4 bits (68), Expect = 1.8 Identities = 22/102 (21%), Positives = 41/102 (40%), Gaps = 20/102 (19%) Query: 523 GTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIG 582 G + + G E A W+G T I H + ++H+D ++G Sbjct: 211 GHSVADLRAG--EDAVWSGA----TFITHLFNAMLPFHHRDP--------------GLVG 250 Query: 583 WIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLL 624 + + L G ++Y +I +G +RI R + +G +L Sbjct: 251 LLTSDRLPAGRCIYYGIISDGTHTHPAALRIAYRTHPQGLVL 292 >gnl|CDD|33342 COG3540, PhoD, Phosphodiesterase/alkaline phosphatase D [Inorganic ion transport and metabolism]. Length = 522 Score = 30.0 bits (67), Expect = 2.1 Identities = 8/50 (16%), Positives = 16/50 (32%) Query: 141 FATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVTTQKIN 190 F + L+ F E + S+ + + + + F V K Sbjct: 468 FNNAPGRGYVLCPVAGLQFFGEVMVVSAIRDMTVRLSDRAGFIVLPGKPG 517 >gnl|CDD|35625 KOG0404, KOG0404, KOG0404, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones]. Length = 322 Score = 29.2 bits (65), Expect = 3.3 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 5/59 (8%) Query: 517 DWAAP--RGTPIVAVG--DGIVEKANWAGGYGKQT-LIHHGNGYVSSYNHQDAIAKNIK 570 D AAP R P+ +G D +E+A + Y + +IH + + +S Q KN Sbjct: 149 DGAAPIFRNKPLAVIGGGDSAMEEALFLTKYASKVYIIHRRDHFRASKIMQQRAEKNPN 207 >gnl|CDD|37622 KOG2411, KOG2411, KOG2411, Aspartyl-tRNA synthetase, mitochondrial [Translation, ribosomal structure and biogenesis]. Length = 628 Score = 29.2 bits (65), Expect = 3.6 Identities = 11/36 (30%), Positives = 21/36 (58%), Gaps = 6/36 (16%) Query: 595 LHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAME 630 HY+L+VNG+++ +RI + +QR+ +E Sbjct: 513 QHYDLVVNGVELGGGSIRIHNPD------IQRYVLE 542 >gnl|CDD|36641 KOG1428, KOG1428, KOG1428, Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms]. Length = 3738 Score = 29.3 bits (65), Expect = 3.7 Identities = 11/36 (30%), Positives = 15/36 (41%) Query: 525 PIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYN 560 + G G A W G G ++IH +SS N Sbjct: 867 KVSGFGPGFNAFAGWIGADGDSSIIHSHTALLSSDN 902 >gnl|CDD|37588 KOG2377, KOG2377, KOG2377, Uncharacterized conserved protein [Function unknown]. Length = 657 Score = 28.9 bits (64), Expect = 4.6 Identities = 17/81 (20%), Positives = 30/81 (37%), Gaps = 8/81 (9%) Query: 161 SEGKIESSSQMLMDTIHNVDSFEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLL 220 +G+I+S L + I V T NF D ++++ + KNA + F Sbjct: 65 DKGEIKSIKFSLDNKILAVQRTSKTVDFCNFIPDNSQLEYTQECK---TKNANILGFCWT 121 Query: 221 HNK-----KNQSFTLYYADPQ 236 + +Q Y P+ Sbjct: 122 SSTEIAFITDQGIEFYQVLPE 142 >gnl|CDD|37480 KOG2269, KOG2269, KOG2269, Serine/threonine protein kinase [Signal transduction mechanisms]. Length = 531 Score = 28.9 bits (64), Expect = 4.8 Identities = 17/73 (23%), Positives = 30/73 (41%), Gaps = 1/73 (1%) Query: 492 FGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHH 551 G+ S MR H + T VD + R + G++E + GK++++ H Sbjct: 212 HGKSESKRSMRNHEKEEKATAETSVD-SDTRLLLYKWINQGVLESIDGIISTGKESVVLH 270 Query: 552 GNGYVSSYNHQDA 564 + + HQD Sbjct: 271 AYAGSNEHGHQDP 283 >gnl|CDD|173801 cd07475, Peptidases_S8_C5a_Peptidase, Peptidase S8 family domain in Streptococcal C5a peptidases. Streptococcal C5a peptidase (SCP), is a highly specific protease and adhesin/invasin. The subtilisin-like protease domain is located at the N-terminus and contains a protease-associated domain inserted into a loop. There are three fibronectin type III (Fn) domains at the C-terminus. SCP binds to integrins with the help of Arg-Gly-Asp motifs which are thought to stabilize conformational changes required for substrate binding. Peptidases S8 or Subtilases are a serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values. Length = 346 Score = 28.4 bits (64), Expect = 6.2 Identities = 11/37 (29%), Positives = 19/37 (51%) Query: 100 RLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKIPFAY 136 RL +K+K+ E+ + + K +K+PFAY Sbjct: 30 RLDDDSKAKYSEEFEAKKKKAGIGYGKYYNEKVPFAY 66 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.318 0.135 0.394 Gapped Lambda K H 0.267 0.0615 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 7,894,973 Number of extensions: 428686 Number of successful extensions: 999 Number of sequences better than 10.0: 1 Number of HSP's gapped: 996 Number of HSP's successfully gapped: 22 Length of query: 652 Length of database: 6,263,737 Length adjustment: 100 Effective length of query: 552 Effective length of database: 4,102,837 Effective search space: 2264766024 Effective search space used: 2264766024 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 61 (27.5 bits)