HHsearch alignment for GI: 254780881 and conserved domain: TIGR02159

>TIGR02159 PA_CoA_Oxy4 phenylacetate-CoA oxygenase, PaaJ subunit; InterPro: IPR011883 Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation , . Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA . .
Probab=98.87  E-value=6.1e-09  Score=71.26  Aligned_cols=73  Identities=11%  Similarity=0.132  Sum_probs=67.3

Q ss_pred             CCCCCCC-CCHHHCCCCCCCCCCCCEEEEE-EEECHHHCHHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCCC
Q ss_conf             4187999-7623238701013369879999-99672222068999999999985398534069999707898732
Q gi|254780881|r   16 LSIPGEK-NNIVEMQRLSEIFIVHNTVYLS-ITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTENKNPPQQ   88 (101)
Q Consensus        16 v~dP~~~-~~iv~~g~V~~i~i~~~~v~i~-l~l~~~~~~~~~~l~~~i~~~l~~i~gv~~v~V~lt~~~~~~~~   88 (101)
T Consensus         1 VPDPEiPv~s~~DLGmVR~V~v~g~G~~v~s~tPTySGCPA~~~i~~~i~~A~~~~GW~~~VeV~~~L~P~WTTd   75 (152)
T TIGR02159         1 VPDPEIPVVSVTDLGMVREVEVDGEGVVVKSFTPTYSGCPALEVIRQDIRDALRALGWVEEVEVKTSLDPAWTTD   75 (152)
T ss_pred             CCCCCCCEEEEECCCEEEEEEECCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCC
T ss_conf             988887702211065343578647947988874587772368999999999997478975115887718987840