Query         gi|254780881|ref|YP_003065294.1| Mrp protein [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 101
No_of_seqs    106 out of 1506
Neff          7.9 
Searched_HMMs 13730
Date          Wed Jun  1 10:23:16 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780881.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d1uwda_ d.52.8.2 (A:) Hypothet  99.8 1.5E-19 1.1E-23  128.4   8.6   91    2-92      3-94  (102)
  2 d2cu6a1 d.52.8.2 (A:6-96) Hypo  99.8 2.5E-19 1.8E-23  127.2   6.3   87    5-91      2-88  (91)
  3 d1xhja_ d.52.8.1 (A:) Nitrogen  92.4   0.068   5E-06   29.0   4.0   77    4-84      7-85  (88)
  4 d1th5a1 d.52.8.1 (A:154-226) N  90.8   0.082   6E-06   28.6   3.0   68    3-77      2-71  (73)
  5 d1veha_ d.52.8.1 (A:) HIRA-int  88.4   0.064 4.7E-06   29.2   1.0   69    5-76     14-84  (92)
  6 d1q8la_ d.58.17.1 (A:) Menkes   55.6     2.4 0.00018   20.3   1.7   42   37-81      5-46  (84)
  7 d1p6ta1 d.58.17.1 (A:1-72) Pot  51.5     4.2 0.00031   18.9   2.4   38   42-82      7-44  (72)
  8 d1qupa2 d.58.17.1 (A:2-73) Cop  51.0     2.6 0.00019   20.1   1.2   37   40-82      7-43  (72)
  9 d2qifa1 d.58.17.1 (A:1-69) Cop  49.4       6 0.00044   18.1   2.9   36   43-81      4-39  (69)
 10 d2aw0a_ d.58.17.1 (A:) Menkes   46.1       4 0.00029   19.1   1.5   35   44-81      6-40  (72)
 11 d1kvja_ d.58.17.1 (A:) Menkes   45.6     6.7 0.00049   17.8   2.6   40   39-81      6-45  (79)
 12 d1osda_ d.58.17.1 (A:) Mercuri  44.0     5.4 0.00039   18.4   1.9   37   42-81      4-40  (72)
 13 d1cpza_ d.58.17.1 (A:) Copper   44.0       4 0.00029   19.1   1.3   23   59-81     15-37  (68)
 14 d1mwza_ d.58.17.1 (A:) Metal i  42.8     4.4 0.00032   18.9   1.3   35   44-81      6-40  (73)
 15 d2ggpb1 d.58.17.1 (B:1-72) Cop  39.8     3.5 0.00025   19.4   0.4   36   43-81      4-39  (72)
 16 d1sb6a_ d.58.17.1 (A:) Copper   37.2       4 0.00029   19.1   0.4   37   43-82      3-39  (64)
 17 d1ysja2 d.58.19.1 (A:178-292)   30.8      17  0.0012   15.5   4.2   74    8-81     31-110 (115)
 18 d1p6ta2 d.58.17.1 (A:73-151) P  30.0       6 0.00044   18.1   0.3   36   43-81      4-39  (79)
 19 d1qcza_ c.23.8.1 (A:) N5-CAIR   27.1      13 0.00094   16.2   1.6   44   57-101    15-64  (163)
 20 d1cc8a_ d.58.17.1 (A:) ATX1 me  26.5      20  0.0015   15.1   2.8   35   40-80      5-40  (72)
 21 d1z2la2 d.58.19.1 (A:213-329)   26.4      20  0.0015   15.1   3.0   50   33-82     63-114 (117)
 22 d1u11a_ c.23.8.1 (A:) N5-CAIR   24.0      22  0.0016   14.9   2.3   44   57-101    16-65  (159)
 23 d1lfwa2 d.58.19.1 (A:187-382)   21.3      24  0.0017   14.7   2.0   46   22-69    140-185 (196)

No 1  
>d1uwda_ d.52.8.2 (A:) Hypothetical protein TM0487 {Thermotoga maritima [TaxId: 2336]}
Probab=99.79  E-value=1.5e-19  Score=128.41  Aligned_cols=91  Identities=21%  Similarity=0.217  Sum_probs=85.3

Q ss_pred             CCCCHHHHHHHHHHCCCCCCCCCHHHCCCCCCCCCCC-CEEEEEEEECHHHCHHHHHHHHHHHHHHHCCCCCCCEEEEEE
Q ss_conf             6035899999984141879997623238701013369-879999996722220689999999999853985340699997
Q gi|254780881|r    2 NQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVH-NTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLT   80 (101)
Q Consensus         2 s~~~~~~I~~~L~~v~dP~~~~~iv~~g~V~~i~i~~-~~v~i~l~l~~~~~~~~~~l~~~i~~~l~~i~gv~~v~V~lt   80 (101)
                      .++++++|+++|++|.||++++|||++|+|+++.+++ |.|.|.+++++++|+..+.|.+++++++.+++|+.+|.|.++
T Consensus         3 ~~vt~~~V~~aL~~V~DPe~~~dIV~LGlV~~i~I~~~g~V~v~~~lt~~~Cp~~~~i~~~i~~al~~~~gV~~v~V~i~   82 (102)
T d1uwda_           3 KKVTKEDVLNALKNVIDFELGLDVVSLGLVYDIQIDDQNNVKVLMTMTTPMCPLAGMILSDAEEAIKKIEGVNNVEVELT   82 (102)
T ss_dssp             SCCCHHHHHHHHTTCBCTTTSSBTTTTTCCCCEEECTTCEEEEEECCSSSCCSSHHHHHHHHHHHHHTSSSCCEEEEEEC
T ss_pred             CCCCHHHHHHHHHCCCCCCCCCCEEECCCEEEEEECCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEEE
T ss_conf             51599999999817889999926144362356775146642788864889996279999999999982899760899999


Q ss_pred             ECCCCCCCCCCC
Q ss_conf             078987321569
Q gi|254780881|r   81 ENKNPPQQRNNL   92 (101)
Q Consensus        81 ~~~~~~~~~~~~   92 (101)
                      ++++|...+..+
T Consensus        83 ~~p~W~~~~~s~   94 (102)
T d1uwda_          83 FDPPWTPERMSP   94 (102)
T ss_dssp             CSSCCCGGGSCH
T ss_pred             ECCCCCHHHCCH
T ss_conf             629999377789


No 2  
>d2cu6a1 d.52.8.2 (A:6-96) Hypothetical protein TTHB138 {Thermus thermophilus [TaxId: 274]}
Probab=99.76  E-value=2.5e-19  Score=127.18  Aligned_cols=87  Identities=17%  Similarity=0.194  Sum_probs=82.8

Q ss_pred             CHHHHHHHHHHCCCCCCCCCHHHCCCCCCCCCCCCEEEEEEEECHHHCHHHHHHHHHHHHHHHCCCCCCCEEEEEEECCC
Q ss_conf             58999999841418799976232387010133698799999967222206899999999998539853406999970789
Q gi|254780881|r    5 LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTENKN   84 (101)
Q Consensus         5 ~~~~I~~~L~~v~dP~~~~~iv~~g~V~~i~i~~~~v~i~l~l~~~~~~~~~~l~~~i~~~l~~i~gv~~v~V~lt~~~~   84 (101)
                      ++++|+++|++|.||++++||+++|||+++.+++|++.|.+++++++|+..+.|.++++++|++++|+.+|.|.+|++++
T Consensus         2 le~~v~eaL~~V~DPe~~~dIv~LGlV~~i~i~~~~v~v~l~lt~~~cp~~~~i~~~i~~al~~l~gv~~V~V~~~~~p~   81 (91)
T d2cu6a1           2 LEAQAWALLEAVYDPELGLDVVNLGLIYDLVVEPPRAYVRMTLTTPGCPLHDSLGEAVRQALSRLPGVEEVEVEVTFEPP   81 (91)
T ss_dssp             HHHHHHHHHTTCEETTTTEETTTTTCEEEEEEETTEEEEEECCSSSSCCSSCHHHHHHHHHHHTSTTCCEEEEEECCSSC
T ss_pred             HHHHHHHHHHCCCCCCCCCCHHHCCCEEEEEEECCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEEEECCC
T ss_conf             69999999836889999968421455037899426418999748889747999999999999808997328999996599


Q ss_pred             CCCCCCC
Q ss_conf             8732156
Q gi|254780881|r   85 PPQQRNN   91 (101)
Q Consensus        85 ~~~~~~~   91 (101)
                      |......
T Consensus        82 W~~~~is   88 (91)
T d2cu6a1          82 WTLARLS   88 (91)
T ss_dssp             CCGGGCC
T ss_pred             CCHHHCC
T ss_conf             8821267


No 3  
>d1xhja_ d.52.8.1 (A:) Nitrogen fixation protein NifU homolog SE0630 {Staphylococcus epidermidis [TaxId: 1282]}
Probab=92.36  E-value=0.068  Score=29.03  Aligned_cols=77  Identities=10%  Similarity=0.132  Sum_probs=59.9

Q ss_pred             CCHHHHHHHHHHCCCCCCCCCHHHCCCCCCCCCCCCEEEEEEEECHHHCHHHH-HHHHHHHHHHH-CCCCCCCEEEEEEE
Q ss_conf             35899999984141879997623238701013369879999996722220689-99999999985-39853406999970
Q gi|254780881|r    4 ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQ-SLRSNAQQIIQ-NIPTVKNAVVTLTE   81 (101)
Q Consensus         4 ~~~~~I~~~L~~v~dP~~~~~iv~~g~V~~i~i~~~~v~i~l~l~~~~~~~~~-~l~~~i~~~l~-~i~gv~~v~V~lt~   81 (101)
                      .+.++|.++|.. .-|.+..+   -|-|+=+.+++|.|.+.+.=....|+... .++..+++.|+ .+|++..|.-..+.
T Consensus         7 ~l~~~I~~vLe~-IRP~l~~d---GGdvelv~v~~g~V~v~l~GaC~gC~~s~~Tlk~~Ie~~L~~~vpev~~V~~V~~~   82 (88)
T d1xhja_           7 TMFDQVAEVIER-LRPFLLRD---GGDCTLVDVEDGIVKLQLHGACGTCPSSTITLKAGIERALHEEVPGVIEVEQVFLE   82 (88)
T ss_dssp             CHHHHHHHHHHH-HHHHHHHH---SCEEEEEECCSSEEEEEEESSCCSSCHHHHHHHHHHHHHHHHHSTTCCEEEEEECC
T ss_pred             HHHHHHHHHHHH-HHHHHHHC---CCCEEEEECCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEECCC
T ss_conf             899999999998-63799857---98379986359989999657878992089999999999999878997569986487


Q ss_pred             CCC
Q ss_conf             789
Q gi|254780881|r   82 NKN   84 (101)
Q Consensus        82 ~~~   84 (101)
                      |..
T Consensus        83 ~~~   85 (88)
T d1xhja_          83 HHH   85 (88)
T ss_dssp             CCC
T ss_pred             CCC
T ss_conf             777


No 4  
>d1th5a1 d.52.8.1 (A:154-226) NifU-like protein 1, NIFUL1 {Rice (Oryza sativa) [TaxId: 4530]}
Probab=90.75  E-value=0.082  Score=28.57  Aligned_cols=68  Identities=15%  Similarity=0.259  Sum_probs=50.6

Q ss_pred             CCCHHHHHHHHHHCCCCCCC-CCHHHCCCCCCCCCCCCEEEEEEEECHHHCHHHHHHHHHHHHHHH-CCCCCCCEEE
Q ss_conf             03589999998414187999-762323870101336987999999672222068999999999985-3985340699
Q gi|254780881|r    3 QILKNQIVDSLKVLSIPGEK-NNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQ-NIPTVKNAVV   77 (101)
Q Consensus         3 ~~~~~~I~~~L~~v~dP~~~-~~iv~~g~V~~i~i~~~~v~i~l~l~~~~~~~~~~l~~~i~~~l~-~i~gv~~v~V   77 (101)
                      +++++.|..+|..++ |.+. .|   -|-|+=+.++++.+.+.+.=....|+   .++..+++.|+ .+|++..|++
T Consensus         2 el~ee~V~~vL~eir-P~l~a~d---GGdvelv~i~~~~v~v~l~GaC~gC~---Tl~~gIe~~L~~~iPei~~V~~   71 (73)
T d1th5a1           2 ELNEENVEKVLNEIR-PYLAGTG---GGGLQFLMIKGPIVKVRLTGPAAVVR---TVRIAVSKKLREKIPSIQIVQL   71 (73)
T ss_dssp             CCSHHHHHHHHTTTH-HHHTTTT---CCCCCCCEEETTEEEECCCSSSSSSS---SHHHHHHHHHHHHCTTCSEEEE
T ss_pred             CCCHHHHHHHHHHHC-CCCCCCC---CCEEEEEEECCCEEEEEECCCCCCCC---HHHHHHHHHHHHHCCCCCEEEE
T ss_conf             988999999999855-2032068---93399999509999999569876510---3999999999997898658994


No 5  
>d1veha_ d.52.8.1 (A:) HIRA-interacting protein 5, HIRIP5 {Mouse (Mus musculus) [TaxId: 10090]}
Probab=88.37  E-value=0.064  Score=29.18  Aligned_cols=69  Identities=19%  Similarity=0.132  Sum_probs=56.5

Q ss_pred             CHHHHHHHHHHCCCCCCCCCHHHCCCCCCCCCCCCEEEEEEEECHHHCHHH-HHHHHHHHHHHHC-CCCCCCEE
Q ss_conf             589999998414187999762323870101336987999999672222068-9999999999853-98534069
Q gi|254780881|r    5 LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQL-QSLRSNAQQIIQN-IPTVKNAV   76 (101)
Q Consensus         5 ~~~~I~~~L~~v~dP~~~~~iv~~g~V~~i~i~~~~v~i~l~l~~~~~~~~-~~l~~~i~~~l~~-i~gv~~v~   76 (101)
                      ..+.|.++|.....|.+..+   -|-|.=+.+++|.|.+.|.=....|+.. ..++..+++.|+. +|++..|.
T Consensus        14 ~~~~I~~vL~~~IrP~l~~d---GGdv~lv~v~~g~V~v~l~GaC~gCp~s~~Tlk~~Ie~~L~~~vpev~~V~   84 (92)
T d1veha_          14 VVAMIKELLDTRIRPTVQED---GGDVIYRGFEDGIVRLKLQGSCTSCPSSIITLKSGIQNMLQFYIPEVEGVE   84 (92)
T ss_dssp             HHHHHHHHHHHTTHHHHHHH---SCCCCEEEEETTEEEECCCCCCCCCHHHHHHTHHHHHHHHHHHCSSCCCEE
T ss_pred             HHHHHHHHHHHHCCHHHHHC---CCCEEEEEEECCEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             99999999997407589975---994699985088689997667789751899999999999998789855698


No 6  
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]}
Probab=55.56  E-value=2.4  Score=20.28  Aligned_cols=42  Identities=21%  Similarity=0.245  Sum_probs=31.2

Q ss_pred             CCCEEEEEEEECHHHCHHHHHHHHHHHHHHHCCCCCCCEEEEEEE
Q ss_conf             698799999967222206899999999998539853406999970
Q gi|254780881|r   37 VHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTE   81 (101)
Q Consensus        37 ~~~~v~i~l~l~~~~~~~~~~l~~~i~~~l~~i~gv~~v~V~lt~   81 (101)
                      ..+...+.|.++.-.|..   =...++.+|..+|||.++.|.+..
T Consensus         5 ~~~~~~v~l~V~GMtC~~---C~~~Ie~~l~~~~GV~~v~vn~~~   46 (84)
T d1q8la_           5 QAGEVVLKMKVEGMTCHS---CTSTIEGKIGKLQGVQRIKVSLDN   46 (84)
T ss_dssp             SSSCEEEEEEECCTTTCS---SCHHHHHHHHTCTTEEEEEECSTT
T ss_pred             CCCCEEEEEEECCEECHH---HHHHHHHHHHCCCCCEEEEEECCC
T ss_conf             788779999979918689---999999998628995699998999


No 7  
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]}
Probab=51.49  E-value=4.2  Score=18.94  Aligned_cols=38  Identities=16%  Similarity=0.268  Sum_probs=26.6

Q ss_pred             EEEEEECHHHCHHHHHHHHHHHHHHHCCCCCCCEEEEEEEC
Q ss_conf             99999672222068999999999985398534069999707
Q gi|254780881|r   42 YLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTEN   82 (101)
Q Consensus        42 ~i~l~l~~~~~~~~~~l~~~i~~~l~~i~gv~~v~V~lt~~   82 (101)
                      .+.|.++.-.|..   =...++++|.++||+.++.|.+...
T Consensus         7 ~~~l~V~Gm~C~~---C~~~Ie~~l~~~~gV~~v~v~~~~~   44 (72)
T d1p6ta1           7 EIAMQVSGMTCAA---CAARIEKGLKRMPGVTDANVNLATE   44 (72)
T ss_dssp             EEEEEEESCCSSH---HHHHHHHHHTTSSSEEEEEEEGGGT
T ss_pred             EEEEEECCEECHH---HHHHHHHHHHCCCCCEEEEEECCCC
T ss_conf             9999999924189---9999999997499957999986799


No 8  
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
Probab=51.00  E-value=2.6  Score=20.12  Aligned_cols=37  Identities=8%  Similarity=0.226  Sum_probs=24.7

Q ss_pred             EEEEEEEECHHHCHHHHHHHHHHHHHHHCCCCCCCEEEEEEEC
Q ss_conf             7999999672222068999999999985398534069999707
Q gi|254780881|r   40 TVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTEN   82 (101)
Q Consensus        40 ~v~i~l~l~~~~~~~~~~l~~~i~~~l~~i~gv~~v~V~lt~~   82 (101)
                      ...|.+.+.-..|      ...++++|++++||.++.|.+..+
T Consensus         7 ~~~f~V~M~C~~C------~~~Iek~l~~~~gV~~v~vdl~~~   43 (72)
T d1qupa2           7 EATYAIPMHCENC------VNDIKACLKNVPGINSLNFDIEQQ   43 (72)
T ss_dssp             EEEEECCCCSTTH------HHHHHHHHTTCTTEEEEEEETTTT
T ss_pred             EEEEEECCCCHHH------HHHHHHHHHCCCCEEEEEEECCCC
T ss_conf             9999995498899------999999986699804999988899


No 9  
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]}
Probab=49.43  E-value=6  Score=18.09  Aligned_cols=36  Identities=11%  Similarity=0.115  Sum_probs=24.7

Q ss_pred             EEEEECHHHCHHHHHHHHHHHHHHHCCCCCCCEEEEEEE
Q ss_conf             999967222206899999999998539853406999970
Q gi|254780881|r   43 LSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTE   81 (101)
Q Consensus        43 i~l~l~~~~~~~~~~l~~~i~~~l~~i~gv~~v~V~lt~   81 (101)
                      ..|.++.-.|+   .=...++++|+.+|||.++.|.+..
T Consensus         4 ~tl~V~Gm~C~---~C~~~Ie~~l~~~~GV~~v~v~~~~   39 (69)
T d2qifa1           4 KTLQVEGMSCQ---HCVKAVETSVGELDGVSAVHVNLEA   39 (69)
T ss_dssp             EEEEEECCCSH---HHHHHHHHHHHTSTTEEEEEEETTT
T ss_pred             EEEEECCCCCH---HHHHHHHHHHHCCCCCEEEEEECCC
T ss_conf             99999991478---9999999998438995699998879


No 10 
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]}
Probab=46.12  E-value=4  Score=19.11  Aligned_cols=35  Identities=23%  Similarity=0.309  Sum_probs=24.2

Q ss_pred             EEEECHHHCHHHHHHHHHHHHHHHCCCCCCCEEEEEEE
Q ss_conf             99967222206899999999998539853406999970
Q gi|254780881|r   44 SITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTE   81 (101)
Q Consensus        44 ~l~l~~~~~~~~~~l~~~i~~~l~~i~gv~~v~V~lt~   81 (101)
                      .|.++.-.|.   .=...++++|+.++||.+++|.+..
T Consensus         6 ~l~V~GM~C~---~C~~~Ie~~l~~~~GV~~v~v~~~~   40 (72)
T d2aw0a_           6 VINIDGMTCN---SCVQSIEGVISKKPGVKSIRVSLAN   40 (72)
T ss_dssp             EEEEECCCSH---HHHHHHHHHHHTSTTCCCEEEETTT
T ss_pred             EEEECCCCCH---HHHHHHHHHHHCCCCCEEEEEECCC
T ss_conf             9999990168---8999999987268996799998889


No 11 
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]}
Probab=45.58  E-value=6.7  Score=17.81  Aligned_cols=40  Identities=20%  Similarity=0.191  Sum_probs=28.1

Q ss_pred             CEEEEEEEECHHHCHHHHHHHHHHHHHHHCCCCCCCEEEEEEE
Q ss_conf             8799999967222206899999999998539853406999970
Q gi|254780881|r   39 NTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTE   81 (101)
Q Consensus        39 ~~v~i~l~l~~~~~~~~~~l~~~i~~~l~~i~gv~~v~V~lt~   81 (101)
                      +.-.+.|.++.-.|..   =...++++|+.+||+.+++|.+..
T Consensus         6 ~~~~~~l~V~gm~C~~---C~~~ie~~l~~~~gv~~v~v~~~~   45 (79)
T d1kvja_           6 GVNSVTISVEGMTCNS---CVWTIEQQIGKVNGVHHIKVSLEE   45 (79)
T ss_dssp             TCEEEEEEEESCCSTH---HHHHHHHHHHTTTTCSEEEEETTT
T ss_pred             CCEEEEEEECCEECHH---HHHHHHHHHHCCCCCEEEEEECCC
T ss_conf             8259999989945489---999999998637994699998889


No 12 
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]}
Probab=44.03  E-value=5.4  Score=18.36  Aligned_cols=37  Identities=16%  Similarity=0.258  Sum_probs=26.7

Q ss_pred             EEEEEECHHHCHHHHHHHHHHHHHHHCCCCCCCEEEEEEE
Q ss_conf             9999967222206899999999998539853406999970
Q gi|254780881|r   42 YLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTE   81 (101)
Q Consensus        42 ~i~l~l~~~~~~~~~~l~~~i~~~l~~i~gv~~v~V~lt~   81 (101)
                      ++.|.++.-.|..   =...++++|+.+|||.++.|.+..
T Consensus         4 t~~l~V~Gm~C~~---C~~~Ie~~l~~~~gV~~v~v~~~~   40 (72)
T d1osda_           4 TVTLSVPGMTCSA---CPITVKKAISKVEGVSKVDVTFET   40 (72)
T ss_dssp             EEEEECTTCCSTT---HHHHHHHHHHTSTTEEEEEEETTT
T ss_pred             EEEEEECCCCCHH---HHHHHHHHHHCCCCCEEEEEECCC
T ss_conf             8999989920189---999999999749996799998679


No 13 
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]}
Probab=43.98  E-value=4  Score=19.08  Aligned_cols=23  Identities=22%  Similarity=0.312  Sum_probs=18.8

Q ss_pred             HHHHHHHHHCCCCCCCEEEEEEE
Q ss_conf             99999998539853406999970
Q gi|254780881|r   59 RSNAQQIIQNIPTVKNAVVTLTE   81 (101)
Q Consensus        59 ~~~i~~~l~~i~gv~~v~V~lt~   81 (101)
                      ...++++|+.++|+.+++|.+..
T Consensus        15 ~~~Ie~~l~~~~GV~~v~V~~~~   37 (68)
T d1cpza_          15 VARIEEAVGRISGVKKVKVQLKK   37 (68)
T ss_dssp             HHHHHHHHHTSTTEEEEEEETTT
T ss_pred             HHHHHHHHHCCCCCEEEEEECCC
T ss_conf             99999997569993799998779


No 14 
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]}
Probab=42.79  E-value=4.4  Score=18.87  Aligned_cols=35  Identities=11%  Similarity=0.144  Sum_probs=24.6

Q ss_pred             EEEECHHHCHHHHHHHHHHHHHHHCCCCCCCEEEEEEE
Q ss_conf             99967222206899999999998539853406999970
Q gi|254780881|r   44 SITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTE   81 (101)
Q Consensus        44 ~l~l~~~~~~~~~~l~~~i~~~l~~i~gv~~v~V~lt~   81 (101)
                      .+.++.-.|+   .=...++++|..++||.++.|.+..
T Consensus         6 ~~~V~Gm~C~---~C~~~Ie~~l~~~~gV~~v~v~~~~   40 (73)
T d1mwza_           6 SWKVSGMDCA---ACARKVENAVRQLAGVNQVQVLFAT   40 (73)
T ss_dssp             EEECTTCCSH---HHHHHHHHHHHTSSSEEEEEEETTT
T ss_pred             EEEECCCCCH---HHHHHHHHHHHCCCCCEEEEEECCC
T ss_conf             9998995778---9999999999648994599998899


No 15 
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
Probab=39.77  E-value=3.5  Score=19.42  Aligned_cols=36  Identities=8%  Similarity=0.154  Sum_probs=22.6

Q ss_pred             EEEEECHHHCHHHHHHHHHHHHHHHCCCCCCCEEEEEEE
Q ss_conf             999967222206899999999998539853406999970
Q gi|254780881|r   43 LSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTE   81 (101)
Q Consensus        43 i~l~l~~~~~~~~~~l~~~i~~~l~~i~gv~~v~V~lt~   81 (101)
                      +.|.++.-.|..   =...++++|++++||.+++|.+..
T Consensus         4 v~l~V~GM~C~~---C~~~Ie~~l~~~~gV~~v~V~~~~   39 (72)
T d2ggpb1           4 VILAVHGMTCSA---CTNTINTQLRALKGVTKCDISLVT   39 (72)
T ss_dssp             EEEECTTCCSST---TTHHHHHHHTTSTTEEEEEECTTT
T ss_pred             EEEEECCCCCHH---HHHHHHHHHHCCCCCEEEEEECCC
T ss_conf             999989916589---999999998358995599998889


No 16 
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]}
Probab=37.23  E-value=4  Score=19.07  Aligned_cols=37  Identities=22%  Similarity=0.288  Sum_probs=23.0

Q ss_pred             EEEEECHHHCHHHHHHHHHHHHHHHCCCCCCCEEEEEEEC
Q ss_conf             9999672222068999999999985398534069999707
Q gi|254780881|r   43 LSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTEN   82 (101)
Q Consensus        43 i~l~l~~~~~~~~~~l~~~i~~~l~~i~gv~~v~V~lt~~   82 (101)
                      +.|.++.-.|..   =...++++|++++|+.++.+.+...
T Consensus         3 ~~l~V~gM~C~~---C~~~Ie~~l~~~~gv~~v~v~~~~~   39 (64)
T d1sb6a_           3 IQLTVPTIACEA---CAEAVTKAVQNEDAQATVQVDLTSK   39 (64)
T ss_dssp             EEEECTTTTSSS---CTHHHHHHHHHHCTTCEEEEETTTT
T ss_pred             EEEEECCCCCHH---HHHHHHHHHHCCCCEEEEECCCCCC
T ss_conf             999979904630---7899999985599906987147887


No 17 
>d1ysja2 d.58.19.1 (A:178-292) Protein YxeP {Bacillus subtilis [TaxId: 1423]}
Probab=30.78  E-value=17  Score=15.54  Aligned_cols=74  Identities=15%  Similarity=0.182  Sum_probs=46.4

Q ss_pred             HHHHHHHHCCCCC---CCCCHHHCCCCC---CCCCCCCEEEEEEEECHHHCHHHHHHHHHHHHHHHCCCCCCCEEEEEEE
Q ss_conf             9999984141879---997623238701---0133698799999967222206899999999998539853406999970
Q gi|254780881|r    8 QIVDSLKVLSIPG---EKNNIVEMQRLS---EIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTE   81 (101)
Q Consensus         8 ~I~~~L~~v~dP~---~~~~iv~~g~V~---~i~i~~~~v~i~l~l~~~~~~~~~~l~~~i~~~l~~i~gv~~v~V~lt~   81 (101)
                      +++..|.++....   .....+..|.+.   ...+-.+.+.+.+.+-+......+.+.+.+++.++.+..-..+++.+.+
T Consensus        31 ~~i~~l~~~~~~~~~~~~~~~~~~~~i~~G~~~NvIP~~~~~~~~iR~~~~~~~~~i~~~i~~~~~~~a~~~g~~~ei~~  110 (115)
T d1ysja2          31 QIISGLQSVVSRNISSLQNAVVSITRVQAGTSWNVIPDQAEMEGTVRTFQKEARQAVPEHMRRVAEGIAAGYGAQAEFKW  110 (115)
T ss_dssp             HHHHHHC-----------CCEEEEEEEEECSCSSSCCSEEEEEEEEECSSHHHHHHHHHHHHHHHHHHHHHTTCEEEEEE
T ss_pred             HHHHHHCCCCHHCCCCCCCCCCEEEEEECCCCCCCCCCCEEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHCCEEEEEE
T ss_conf             99987410110013433211210369963865420686169999951498778999999999999999998499899999


No 18 
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]}
Probab=30.03  E-value=6  Score=18.09  Aligned_cols=36  Identities=14%  Similarity=0.154  Sum_probs=24.3

Q ss_pred             EEEEECHHHCHHHHHHHHHHHHHHHCCCCCCCEEEEEEE
Q ss_conf             999967222206899999999998539853406999970
Q gi|254780881|r   43 LSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTE   81 (101)
Q Consensus        43 i~l~l~~~~~~~~~~l~~~i~~~l~~i~gv~~v~V~lt~   81 (101)
                      +.+.++.-.|..   =...++++|..++||.+++|.+..
T Consensus         4 ~~~~V~Gm~C~~---C~~~Ie~~l~~~~gV~~v~v~~~~   39 (79)
T d1p6ta2           4 AEFDIEGMTCAA---CANRIEKRLNKIEGVANAPVNFAL   39 (79)
T ss_dssp             EEEEESSCCSSS---HHHHHHHHHTTSSSEEECCEETTT
T ss_pred             EEEEECCCCCHH---HHHHHHHHHHCCCCCEEEEEEECC
T ss_conf             999989953689---999999997557990799999689


No 19 
>d1qcza_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli [TaxId: 562]}
Probab=27.10  E-value=13  Score=16.21  Aligned_cols=44  Identities=16%  Similarity=0.197  Sum_probs=31.0

Q ss_pred             HHHHHHHHHHHCCCCCCCEEEEEEECCCCCCCC------CCCCCCEEEEEC
Q ss_conf             999999999853985340699997078987321------569985588859
Q gi|254780881|r   57 SLRSNAQQIIQNIPTVKNAVVTLTENKNPPQQR------NNLNVKKFVAVA  101 (101)
Q Consensus        57 ~l~~~i~~~l~~i~gv~~v~V~lt~~~~~~~~~------~~~gvKnIIAVA  101 (101)
                      .+.+.+.+.|..+ ||..-.-...+|+.+..-.      ...|+|=|||+|
T Consensus        15 ~~~~~a~~~L~~~-gI~~e~~v~SAHRtp~~l~~~~~~~~~~~~~ViIa~A   64 (163)
T d1qcza_          15 ATMQFAAEIFEIL-NVPHHVEVVSAHRTPDKLFSFAESAEENGYQVIIAGA   64 (163)
T ss_dssp             HHHHHHHHHHHHH-TCCEEEEECCTTTCHHHHHHHHHHTTTTTCSEEEEEE
T ss_pred             HHHHHHHHHHHHC-CCCEEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEEC
T ss_conf             9999999999983-9976999842204889999999999974976999852


No 20 
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
Probab=26.46  E-value=20  Score=15.10  Aligned_cols=35  Identities=9%  Similarity=0.280  Sum_probs=22.3

Q ss_pred             EEEEEEEECHHHCHHHHHHHHHHHHHHHCC-CCCCCEEEEEE
Q ss_conf             799999967222206899999999998539-85340699997
Q gi|254780881|r   40 TVYLSITVPHTIAHQLQSLRSNAQQIIQNI-PTVKNAVVTLT   80 (101)
Q Consensus        40 ~v~i~l~l~~~~~~~~~~l~~~i~~~l~~i-~gv~~v~V~lt   80 (101)
                      +..|.+.++-..|      ...++++|.++ ||+.++.+.+.
T Consensus         5 t~~f~V~MtC~~C------~~~Ie~~L~~l~~gV~~v~v~~~   40 (72)
T d1cc8a_           5 HYQFNVVMTCSGC------SGAVNKVLTKLEPDVSKIDISLE   40 (72)
T ss_dssp             EEEEEECCCSHHH------HHHHHHHHHTTTTSEEEEEEETT
T ss_pred             EEEEEECCCCHHH------HHHHHHHHHCCCCCEEEEEEECC
T ss_conf             9999987393888------99999999737674389999889


No 21 
>d1z2la2 d.58.19.1 (A:213-329) Allantoate amidohydrolase AllC {Escherichia coli [TaxId: 562]}
Probab=26.40  E-value=20  Score=15.09  Aligned_cols=50  Identities=16%  Similarity=0.169  Sum_probs=36.5

Q ss_pred             CCCCCCCEEEEEEEECHHHCHHHHHHHHHHHHHHHCCCCCCC--EEEEEEEC
Q ss_conf             013369879999996722220689999999999853985340--69999707
Q gi|254780881|r   33 EIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKN--AVVTLTEN   82 (101)
Q Consensus        33 ~i~i~~~~v~i~l~l~~~~~~~~~~l~~~i~~~l~~i~gv~~--v~V~lt~~   82 (101)
                      ...+-.+++.|.+.+-.......+.+.+.+++.+..+..-..  +++.+.+.
T Consensus        63 ~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~~~~~a~~~g~~~~ie~~~~  114 (117)
T d1z2la2          63 TVNVVPGKTTFTIDCRHTDAAVLRDFTQQLENDMRAICDEMDIGIDIDLWMD  114 (117)
T ss_dssp             CTTEECCEEEEEEEEEESSHHHHHHHHHHHHHHHHHHHHHHTCEEEEEEEEE
T ss_pred             CCCEECCEEEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEEC
T ss_conf             4432387699999981499999999999999999999998399799999955


No 22 
>d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]}
Probab=24.04  E-value=22  Score=14.93  Aligned_cols=44  Identities=9%  Similarity=0.264  Sum_probs=30.3

Q ss_pred             HHHHHHHHHHHCCCCCCCEEEEEEECCCCCCCC------CCCCCCEEEEEC
Q ss_conf             999999999853985340699997078987321------569985588859
Q gi|254780881|r   57 SLRSNAQQIIQNIPTVKNAVVTLTENKNPPQQR------NNLNVKKFVAVA  101 (101)
Q Consensus        57 ~l~~~i~~~l~~i~gv~~v~V~lt~~~~~~~~~------~~~gvKnIIAVA  101 (101)
                      .+.+.+...|+.+ ||.--.....+|+.+..-.      ...|+|=|||+|
T Consensus        16 ~v~~~a~~~L~~~-gI~~e~~v~SAHR~p~~l~~~~~~~e~~~~~viIa~A   65 (159)
T d1u11a_          16 ETMRHADALLTEL-EIPHETLIVSAHRTPDRLADYARTAAERGLNVIIAGA   65 (159)
T ss_dssp             HHHHHHHHHHHHT-TCCEEEEECCTTTCHHHHHHHHHHTTTTTCCEEEEEE
T ss_pred             HHHHHHHHHHHHH-CCCEEEEEEHHHHCHHHHHHHHHHHHHCCCEEEEEEE
T ss_conf             9999999999990-9955998746864868899999999865974899871


No 23 
>d1lfwa2 d.58.19.1 (A:187-382) Aminopeptidase PepV {Lactobacillus delbrueckii [TaxId: 1584]}
Probab=21.28  E-value=24  Score=14.74  Aligned_cols=46  Identities=7%  Similarity=-0.077  Sum_probs=29.6

Q ss_pred             CCCHHHCCCCCCCCCCCCEEEEEEEECHHHCHHHHHHHHHHHHHHHCC
Q ss_conf             976232387010133698799999967222206899999999998539
Q gi|254780881|r   22 KNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNI   69 (101)
Q Consensus        22 ~~~iv~~g~V~~i~i~~~~v~i~l~l~~~~~~~~~~l~~~i~~~l~~i   69 (101)
                      +.-.++.|.+.++  ..+.+.+.+.+-++.....+.+...+++.+...
T Consensus       140 g~~t~~~G~~~n~--~p~~~~~~~diR~p~~~~~e~i~~~i~~~~~~~  185 (196)
T d1lfwa2         140 GDLASSPSMFDYE--HAGKASLLNNVRYPQGTDPDTMIKQVLDKFSGI  185 (196)
T ss_dssp             EECEEEEEEEEEE--TTSCEEEEEEEEECTTCCHHHHHHHHHHHHTTT
T ss_pred             CCEEEEEEEEEEC--CCCEEEEEEEECCCCCCCHHHHHHHHHHHHCCC
T ss_conf             6738961257530--598489999971499999999999999985472


Done!