PSIBLAST alignment of GI: 254780881 and protein with PDB id: 2cu6

>gi|83754864|pdb|2CU6|A Chain A, Crystal Structure Of The Dtdp-4-Keto-L-Rhamnose Reductase- Related Protein From Thermus Thermophilus Hb8 Length = 103
>gi|83754865|pdb|2CU6|B Chain B, Crystal Structure Of The Dtdp-4-Keto-L-Rhamnose Reductase- Related Protein From Thermus Thermophilus Hb8 Length = 103
 Score = 60.4 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 15/95 (15%), Positives = 36/95 (37%)

Query: 5   LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQ 64
           L+ Q    L+ +  P    ++V +  + ++ +     Y+  T+         SL    +Q
Sbjct: 7   LEAQAWALLEAVYDPELGLDVVNLGLIYDLVVEPPRAYVRXTLTTPGCPLHDSLGEAVRQ 66

Query: 65  IIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVA 99
            +  +P V+   V +T        R +   ++ + 
Sbjct: 67  ALSRLPGVEEVEVEVTFEPPWTLARLSEKARRLLG 101