HHsearch alignment for GI: 254780883 and conserved domain: pfam01809

>pfam01809 DUF37 Domain of unknown function DUF37. This domain is found in short (70 amino acid) hypothetical proteins from various bacteria. The domain contains three conserved cysteine residues. A member from Aeromonas hydrophila has been found to have hemolytic activity (unpublished).
Probab=99.97  E-value=1.2e-30  Score=201.22  Aligned_cols=67  Identities=49%  Similarity=1.025  Sum_probs=65.7

Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             9999999999998507787888898678289999999950888999999987406889878986899
Q gi|254780883|r   56 RLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV  122 (139)
Q Consensus        56 r~i~i~LI~lYQ~~iSP~lg~~CRf~PSCS~Ya~eAi~~~G~~kG~~Lt~~RLlRCnP~~~gG~DPV  122 (139)
T Consensus         2 ~~~~i~lI~~Yq~~iSp~~~~~Crf~PtCS~Ya~~ai~~~G~~kG~~l~~~Ri~rC~P~~~gG~DpV   68 (68)
T pfam01809         2 KRLLIGLIRFYQRFISPLLGPSCRFYPTCSEYAIEAIERHGALKGGWLALKRILRCHPFHPGGYDPV   68 (68)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHCHHHHHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             7999999999996808878999988867899999999981939999999999984789998899989