Query         gi|254780883|ref|YP_003065296.1| hypothetical protein CLIBASIA_03900 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 139
No_of_seqs    116 out of 1800
Neff          3.5 
Searched_HMMs 33803
Date          Wed Jun  1 18:18:25 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780883.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >1as5_A Conotoxin Y-PIIIE; neu  29.8      20 0.00059   16.7   1.0   13   74-86      6-18  (26)
  2 >1jmu_B Protein MU-1; protein-  12.7      79  0.0023   13.2   1.0   34   61-98     27-60  (159)
  3 >3gyg_A NTD biosynthesis opero  12.6      53  0.0016   14.2   0.1   25   89-116    50-74  (88)
  4 >2nx6_A Nematocyst outer WALL    9.5      95  0.0028   12.7   0.5   11   76-86      3-13  (27)
  5 >1ld4_M Spike glycoprotein E1;   9.4      77  0.0023   13.3   0.0   27   41-67    114-140 (149)
  6 >1v90_A Delta-paluit1, delta-p   9.1 1.1E+02  0.0033   12.3   0.8   10   75-84     22-31  (38)
  7 >2w8t_A SPT, serine palmitoylt   8.0 1.3E+02  0.0039   11.9   0.7   14   83-96      7-20  (74)
  8 >1rpb_A Tricyclic peptide RP 7   7.6 1.5E+02  0.0043   11.6   1.2   17  107-123     3-19  (26)
  9 >2h6o_A Major outer envelope g   6.7      64  0.0019   13.7  -1.4   19   69-87     58-76  (152)
 10 >1zld_A PTR TOXA, PTR necrosis   6.7 1.4E+02  0.0042   11.7   0.4   23   27-50     93-116 (118)

No 1  
>>1as5_A Conotoxin Y-PIIIE; neurotoxin, acetylcholine; HET: HYP; NMR {Conus purpurascens} (A:)
Probab=29.80  E-value=20  Score=16.74  Aligned_cols=13  Identities=38%  Similarity=0.853  Sum_probs=10.8

Q ss_pred             CCCCCCCCCCHHH
Q ss_conf             7888898678289
Q gi|254780883|r   74 FGNSCRYLPTCSE   86 (139)
Q Consensus        74 lg~~CRf~PSCS~   86 (139)
                      +..+||-||-||.
T Consensus         6 ~yg~crrypgcss   18 (26)
T 1as5_A            6 LYGKCRRYPGCSS   18 (26)
T ss_dssp             STTCCCCCTTCTT
T ss_pred             CCCCCCCCCCCCC
T ss_conf             4162315899760


No 2  
>>1jmu_B Protein MU-1; protein-protein complex, jelly roll, zinc finger, viral protein; HET: BOG; 2.80A {Reovirus SP} (B:146-236,B:599-666)
Probab=12.72  E-value=79  Score=13.19  Aligned_cols=34  Identities=12%  Similarity=0.155  Sum_probs=24.1

Q ss_pred             HHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHCCHH
Q ss_conf             99999998507787888898678289999999950888
Q gi|254780883|r   61 GIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLW   98 (139)
Q Consensus        61 ~LI~lYQ~~iSP~lg~~CRf~PSCS~Ya~eAi~~~G~~   98 (139)
                      .+++|-|--+|+  -+-||.||-|  .+.-+.++||.+
T Consensus        27 SVv~F~ddqLpd--dnLcR~YPee--aa~avA~RnggI   60 (159)
T 1jmu_B           27 SVVKLLDDQLPD--DSLIRRYPKE--AAVALAKRNGGI   60 (159)
T ss_dssp             HHHHHHHHHSCT--TCGGGTCHHH--HHHHHHHHCTTE
T ss_pred             HHHHHHHHHCCC--HHHHHHCHHH--HHHHHHHHCCCC
T ss_conf             999998740896--1677768089--999999766888


No 3  
>>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like hydrolase; 2.45A {Bacillus subtilis subsp} (A:122-209)
Probab=12.56  E-value=53  Score=14.24  Aligned_cols=25  Identities=28%  Similarity=0.440  Sum_probs=14.5

Q ss_pred             HHHHHHCCHHHHHHHHHHHHCCCCCCCC
Q ss_conf             9999950888999999987406889878
Q gi|254780883|r   89 YEAIARYGLWIGSWLTLLRLIKCNPLGS  116 (139)
Q Consensus        89 ~eAi~~~G~~kG~~Lt~~RLlRCnP~~~  116 (139)
                      +++|++..--.+   ....|-||||+..
T Consensus        50 le~I~~~a~~~~---~~v~inrcNPlAG   74 (88)
T 3gyg_A           50 LLAIEKICEEYG---VSVNINRCNPLAG   74 (88)
T ss_dssp             HHHHHHHHHHHT---EEEEEEECCGGGT
T ss_pred             HHHHHHHHHHHH---HHHHHHHCCCCEE
T ss_conf             999999999866---5677774477258


No 4  
>>2nx6_A Nematocyst outer WALL antigen; disulfide rich, turns, structural protein; NMR {Hydra vulgaris} (A:)
Probab=9.51  E-value=95  Score=12.71  Aligned_cols=11  Identities=45%  Similarity=1.099  Sum_probs=6.7

Q ss_pred             CCCCCCCCHHH
Q ss_conf             88898678289
Q gi|254780883|r   76 NSCRYLPTCSE   86 (139)
Q Consensus        76 ~~CRf~PSCS~   86 (139)
                      .+|.-.||||-
T Consensus         3 sscpqfpscsp   13 (27)
T 2nx6_A            3 SSCPQFPSCSP   13 (27)
T ss_dssp             CSSTTCTTCCG
T ss_pred             CCCCCCCCCCC
T ss_conf             76888887787


No 5  
>>1ld4_M Spike glycoprotein E1; alphavirus structure, cryo-electron microscopy, glycoprotein organization, nucleocapsid structure; 11.40A {Sindbis virus} (M:291-439)
Probab=9.35  E-value=77  Score=13.27  Aligned_cols=27  Identities=19%  Similarity=0.172  Sum_probs=22.1

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             743322471455489999999999999
Q gi|254780883|r   41 PKSRNWNGKFPKTLGRLIGIGIIRIYQ   67 (139)
Q Consensus        41 ~~s~n~~~~~~~~l~r~i~i~LI~lYQ   67 (139)
                      .+++||-..+.--.+-+|.|+||-++=
T Consensus       114 ~TAwsWl~~l~GG~~~~i~igl~i~~~  140 (149)
T 1ld4_M          114 KTSWSWLFALFGGASSLLIIGLMIFAC  140 (149)
T ss_dssp             ---------------------------
T ss_pred             HHHHHHHHHHHCCCHHHHHHHHHHHHH
T ss_conf             558999999847832899999999999


No 6  
>>1v90_A Delta-paluit1, delta-palutoxin IT1; insecticidal toxin, spider toxin, ICK fold, structure; NMR {Paracoelotes luctuosus} PDB: 1v91_A (A:)
Probab=9.10  E-value=1.1e+02  Score=12.29  Aligned_cols=10  Identities=50%  Similarity=1.022  Sum_probs=6.1

Q ss_pred             CCCCCCCCCH
Q ss_conf             8888986782
Q gi|254780883|r   75 GNSCRYLPTC   84 (139)
Q Consensus        75 g~~CRf~PSC   84 (139)
                      .-+||++|-|
T Consensus        22 YCsCR~~P~C   31 (38)
T 1v90_A           22 YCSCRSMPYC   31 (38)
T ss_dssp             CCCCSSSSCC
T ss_pred             EEECCCCCCC
T ss_conf             5732569854


No 7  
>>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A (A:76-123,A:288-313)
Probab=7.98  E-value=1.3e+02  Score=11.90  Aligned_cols=14  Identities=29%  Similarity=0.565  Sum_probs=5.4

Q ss_pred             CHHHHHHHHHHHCC
Q ss_conf             82899999999508
Q gi|254780883|r   83 TCSEYGYEAIARYG   96 (139)
Q Consensus        83 SCS~Ya~eAi~~~G   96 (139)
                      .+-+-+++|+++||
T Consensus         7 ~V~eAa~eal~~yG   20 (74)
T 2w8t_A            7 DVIAAGKEALEKFG   20 (74)
T ss_dssp             HHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHC
T ss_conf             99999999999838


No 8  
>>1rpb_A Tricyclic peptide RP 71955; HIV replication inhibitor; NMR {Actinomycete SP9440} (A:)
Probab=7.57  E-value=1.5e+02  Score=11.61  Aligned_cols=17  Identities=24%  Similarity=0.425  Sum_probs=12.8

Q ss_pred             HHCCCCCCCCCCCCCCC
Q ss_conf             74068898789868999
Q gi|254780883|r  107 RLIKCNPLGSDGFDPVP  123 (139)
Q Consensus       107 RLlRCnP~~~gG~DPVP  123 (139)
                      .|..||.|...||.-|-
T Consensus         3 gigscndfagcgyavvc   19 (26)
T 1rpb_A            3 GIGSCNDFAGCGYAVVC   19 (26)
T ss_dssp             SCSSBCSSSSSCBBSSC
T ss_pred             CEECCCCCCCCCEEEEE
T ss_conf             22222455788659999


No 9  
>>2h6o_A Major outer envelope glycoprotein GP350; viral protein; HET: NAG MAN BMA NDG GAL FUC; 3.50A {Human herpesvirus 4} (A:160-311)
Probab=6.74  E-value=64  Score=13.73  Aligned_cols=19  Identities=32%  Similarity=0.518  Sum_probs=16.5

Q ss_pred             HCCCCCCCCCCCCCCHHHH
Q ss_conf             5077878888986782899
Q gi|254780883|r   69 IFSNVFGNSCRYLPTCSEY   87 (139)
Q Consensus        69 ~iSP~lg~~CRf~PSCS~Y   87 (139)
                      .|||.++.+=.|.-+||-|
T Consensus        58 ~iSpvlPG~N~F~ItCsGd   76 (152)
T 2h6o_A           58 EISQVLPGDNKFNITCSGY   76 (152)
T ss_dssp             CBSSCCSSCEEEEBCCSBS
T ss_pred             CCCCCCCCCCEEEEEECCC
T ss_conf             5331057886157881688


No 10 
>>1zld_A PTR TOXA, PTR necrosis toxin; beta-sandwich, RGD-motif; 1.65A {Pyrenophora tritici-repentis} PDB: 1zle_A (A:)
Probab=6.73  E-value=1.4e+02  Score=11.67  Aligned_cols=23  Identities=35%  Similarity=0.641  Sum_probs=14.2

Q ss_pred             HHHCCCEEEEEECCCCCC-CCCCCH
Q ss_conf             121187046771687433-224714
Q gi|254780883|r   27 IQKKGSPLLLKNNTPKSR-NWNGKF   50 (139)
Q Consensus        27 ~~~~~~~~~~~~~~~~s~-n~~~~~   50 (139)
                      ++-+|+ +||--..++++ ||.|++
T Consensus        93 iqgrgs-fclnirsdtgrenwrmql  116 (118)
T 1zld_A           93 IQGRGS-FCLNIRSDTGRENWRMQL  116 (118)
T ss_dssp             CSEEEE-EEEECCTTCSCCCEEEEE
T ss_pred             EECCCE-EEEEEECCCCHHHHHHCC
T ss_conf             723661-799850666602030211


Done!