Query         gi|254780883|ref|YP_003065296.1| hypothetical protein CLIBASIA_03900 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 139
No_of_seqs    116 out of 1800
Neff          3.5 
Searched_HMMs 23785
Date          Tue May 31 22:20:01 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780883.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 1as5_A Conotoxin Y-PIIIE; neur  25.5      18 0.00078   16.0   1.0   13   74-86      6-18  (26)
  2 1bgv_A Glutamate dehydrogenase  15.8      51  0.0022   13.4   1.5   46   71-124    86-133 (449)
  3 2zu6_B Programmed cell death p  14.4      54  0.0023   13.3   1.3   53   67-122   109-162 (307)
  4 1xiy_A Peroxiredoxin, pfaop; a  13.8      42  0.0018   13.9   0.6   20   73-92     48-67  (182)
  5 2p0g_A Selenoprotein W-related  11.6      72   0.003   12.5   1.4   21   76-96     12-32  (105)
  6 3eiq_C Programmed cell death p  10.7      77  0.0032   12.4   1.5   52   68-122   161-213 (358)
  7 2oka_A Hypothetical protein; P  10.4      79  0.0033   12.3   1.3   21   76-96     14-34  (104)
  8 2nx6_A Nematocyst outer WALL a   9.5      67  0.0028   12.7   0.5   11   76-86      3-13  (27)
  9 1r57_A Conserved hypothetical    9.0      42  0.0018   13.9  -0.7   49   44-103    45-93  (102)
 10 1rpb_A Tricyclic peptide RP 71   7.4 1.1E+02  0.0044   11.6   1.2   15  108-122     4-18  (26)

No 1  
>1as5_A Conotoxin Y-PIIIE; neurotoxin, acetylcholine; HET: HYP; NMR {Conus purpurascens} SCOP: j.30.1.4 PDB: 1jlo_A*
Probab=25.53  E-value=18  Score=16.02  Aligned_cols=13  Identities=38%  Similarity=0.853  Sum_probs=10.7

Q ss_pred             CCCCCCCCCCHHH
Q ss_conf             7888898678289
Q gi|254780883|r   74 FGNSCRYLPTCSE   86 (139)
Q Consensus        74 lg~~CRf~PSCS~   86 (139)
                      +...||-||.||.
T Consensus         6 lygkcrrypgcss   18 (26)
T 1as5_A            6 LYGKCRRYPGCSS   18 (26)
T ss_dssp             STTCCCCCTTCTT
T ss_pred             CCCCCCCCCCCCC
T ss_conf             5161125899770


No 2  
>1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A
Probab=15.80  E-value=51  Score=13.41  Aligned_cols=46  Identities=20%  Similarity=0.303  Sum_probs=29.6

Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHHCCCCCCC--CCCCCCCCC
Q ss_conf             778788889867828999999995088899999998740688987--898689998
Q gi|254780883|r   71 SNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLG--SDGFDPVPD  124 (139)
Q Consensus        71 SP~lg~~CRf~PSCS~Ya~eAi~~~G~~kG~~Lt~~RLlRCnP~~--~gG~DPVP~  124 (139)
                      -|..|. |||.|+.+.=-..       ..+.+||.+=-+---|++  +||++-=|.
T Consensus        86 GP~kGG-iR~~p~v~~~ev~-------~LA~~MT~K~Al~glp~GGgKggI~~dP~  133 (449)
T 1bgv_A           86 GPYKGG-LRFAPSVNLSIMK-------FLGFEQAFKDSLTTLPMGGAKGGSDFDPN  133 (449)
T ss_dssp             SSEEEE-EEECTTCCHHHHH-------HHHHHHHHHHHHTSSSCCEEEEEESCCCT
T ss_pred             CCCCCC-EECCCCCCHHHHH-------HHHHHHHHHHHHCCCCCCCCCEEECCCCC
T ss_conf             887673-5515999999999-------99999999999717997774448816998


No 3  
>2zu6_B Programmed cell death protein 4; protein-protein complex, ATP-binding, helicase, hydrolase, initiation factor, nucleotide-binding; 2.80A {Homo sapiens} PDB: 3eij_A
Probab=14.36  E-value=54  Score=13.29  Aligned_cols=53  Identities=19%  Similarity=0.153  Sum_probs=36.2

Q ss_pred             HHHCCCCCCCCCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHHCCCCCCCC-CCCCCC
Q ss_conf             98507787888898678289999999950888999999987406889878-986899
Q gi|254780883|r   67 QLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS-DGFDPV  122 (139)
Q Consensus        67 Q~~iSP~lg~~CRf~PSCS~Ya~eAi~~~G~~kG~~Lt~~RLlRCnP~~~-gG~DPV  122 (139)
                      --.++|-+=.+......|+ .+.+++++-..+...-.+..|+.+|  ||. ||.-||
T Consensus       109 D~~l~p~fl~~~~~~~~~~-~~~~~~~~a~~ll~~~~~~~r~~~~--Wg~~~~~~~~  162 (307)
T 2zu6_B          109 DGILCNTYIDSYKGTVDCV-QARAALDKATVLLSMSKGGKRKDSV--WGSGGGQQSV  162 (307)
T ss_dssp             TTSSCTTTTGGGTTTCCCH-HHHHHHHHHHHHHHTCC----CCCS--SCCCSTTSCH
T ss_pred             HCCCCHHHHHHHHCCCCCH-HHHHHHHHHHHHHHCCCHHHHHHHH--HCCCCCCCCH
T ss_conf             5579889998753257752-7999999999998565229999877--3789997709


No 4  
>1xiy_A Peroxiredoxin, pfaop; alpha-aneurysm, thioredoxin fold, peroxiredoxin fold, oxidoreductase; 1.80A {Plasmodium falciparum} SCOP: c.47.1.10
Probab=13.78  E-value=42  Score=13.94  Aligned_cols=20  Identities=20%  Similarity=0.310  Sum_probs=12.6

Q ss_pred             CCCCCCCCCCCHHHHHHHHH
Q ss_conf             87888898678289999999
Q gi|254780883|r   73 VFGNSCRYLPTCSEYGYEAI   92 (139)
Q Consensus        73 ~lg~~CRf~PSCS~Ya~eAi   92 (139)
                      +++--=-|.|+||+.-+..+
T Consensus        48 l~~vPGAFTptCs~~hlP~y   67 (182)
T 1xiy_A           48 LISLPGAFTPTCSTKMIPGY   67 (182)
T ss_dssp             EEECSCTTCHHHHHTHHHHH
T ss_pred             EEECCCCCCCCCCHHHCCCH
T ss_conf             99737776986783037568


No 5  
>2p0g_A Selenoprotein W-related protein; VCR75, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Vibrio cholerae}
Probab=11.57  E-value=72  Score=12.55  Aligned_cols=21  Identities=10%  Similarity=0.351  Sum_probs=11.2

Q ss_pred             CCCCCCCCHHHHHHHHHHHCC
Q ss_conf             888986782899999999508
Q gi|254780883|r   76 NSCRYLPTCSEYGYEAIARYG   96 (139)
Q Consensus        76 ~~CRf~PSCS~Ya~eAi~~~G   96 (139)
                      ..|+|.|-++.||-+.+.+++
T Consensus        12 ~~C~wllRa~wlaqELL~tF~   32 (105)
T 2p0g_A           12 RQCNWMLRSAWLSQELLHTFS   32 (105)
T ss_dssp             TTTTCHHHHHHHHHHHHHHTT
T ss_pred             CCCCCCHHHHHHHHHHHHHCC
T ss_conf             888980899999999998646


No 6  
>3eiq_C Programmed cell death protein 4; PDCD4, anti-oncogene, apoptosis, cell cycle, cytoplasm, nucleus, phosphoprotein, RNA-binding, ATP-binding; 3.50A {Mus musculus}
Probab=10.74  E-value=77  Score=12.38  Aligned_cols=52  Identities=21%  Similarity=0.196  Sum_probs=33.4

Q ss_pred             HHCCCCCCCCCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHHCCCCCCCC-CCCCCC
Q ss_conf             8507787888898678289999999950888999999987406889878-986899
Q gi|254780883|r   68 LIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS-DGFDPV  122 (139)
Q Consensus        68 ~~iSP~lg~~CRf~PSCS~Ya~eAi~~~G~~kG~~Lt~~RLlRCnP~~~-gG~DPV  122 (139)
                      -.++|-+=.+..-...|+ ++.+++++-..+...-.+..||.||  |+. ||.-||
T Consensus       161 ~ilpp~fl~~~~~~~~~~-~~~~~l~~a~~lL~~~~~~~r~~~~--WG~g~~~~~v  213 (358)
T 3eiq_C          161 GILCNTYIDSYKGTVDCV-QARAALDKATVLLSMSKGGKRKDSV--WGSGGGQQPV  213 (358)
T ss_dssp             TCSCSSTTGGGC---CCH-HHHHHHHHHHHHHTC---------C--CCCCCSSSCH
T ss_pred             CCCCHHHHHHHHHCCCCC-HHHHHHHHHHHHHHCCCHHHHHHHC--CCCCCCCCCH
T ss_conf             568889999865035651-4999999999998455215765412--5799997859


No 7  
>2oka_A Hypothetical protein; PAR82, NESG, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.50A {Pseudomonas aeruginosa} PDB: 2obk_A
Probab=10.38  E-value=79  Score=12.30  Aligned_cols=21  Identities=14%  Similarity=0.431  Sum_probs=11.9

Q ss_pred             CCCCCCCCHHHHHHHHHHHCC
Q ss_conf             888986782899999999508
Q gi|254780883|r   76 NSCRYLPTCSEYGYEAIARYG   96 (139)
Q Consensus        76 ~~CRf~PSCS~Ya~eAi~~~G   96 (139)
                      ..|+|.|-++.||.+.+.+++
T Consensus        14 ~~C~w~~Ra~w~aqELL~tF~   34 (104)
T 2oka_A           14 TQCQWLLRAAWLAQELLSTFA   34 (104)
T ss_dssp             TTTTCHHHHHHHHHHHHHHST
T ss_pred             CCCCCCHHHHHHHHHHHHHCC
T ss_conf             888980899999999998556


No 8  
>2nx6_A Nematocyst outer WALL antigen; disulfide rich, turns, structural protein; NMR {Hydra vulgaris}
Probab=9.51  E-value=67  Score=12.71  Aligned_cols=11  Identities=45%  Similarity=1.099  Sum_probs=6.7

Q ss_pred             CCCCCCCCHHH
Q ss_conf             88898678289
Q gi|254780883|r   76 NSCRYLPTCSE   86 (139)
Q Consensus        76 ~~CRf~PSCS~   86 (139)
                      .+|.-.||||-
T Consensus         3 sscpqfpscsp   13 (27)
T 2nx6_A            3 SSCPQFPSCSP   13 (27)
T ss_dssp             CSSTTCTTCCG
T ss_pred             CCCCCCCCCCC
T ss_conf             76888887787


No 9  
>1r57_A Conserved hypothetical protein; GCN5, N-acetyltransferase, structural genomics, PSI, protein structure initiative; NMR {Staphylococcus aureus} SCOP: d.108.1.1 PDB: 2h5m_A*
Probab=8.98  E-value=42  Score=13.89  Aligned_cols=49  Identities=12%  Similarity=0.348  Sum_probs=26.2

Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHCCHHHHHHH
Q ss_conf             322471455489999999999999850778788889867828999999995088899999
Q gi|254780883|r   44 RNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWL  103 (139)
Q Consensus        44 ~n~~~~~~~~l~r~i~i~LI~lYQ~~iSP~lg~~CRf~PSCS~Ya~eAi~~~G~~kG~~L  103 (139)
                      -++.|+   -+++.+.-.++..=+.       ..-+-.|+|| |+..-+++|-=++-+|+
T Consensus        45 p~~rG~---Gig~~L~~~~~~~Ar~-------~g~kiv~~c~-ya~~~~~khpey~dv~~   93 (102)
T 1r57_A           45 DELGGQ---GVGKKLLKAVVEHARE-------NNLKIIASCS-FAKHMLEKEDSYQDVYL   93 (102)
T ss_dssp             CSSSTT---CTHHHHHHHHHHHHHH-------HTCEEEESSH-HHHHHHHHCGGGTTTBC
T ss_pred             HHHCCC---HHHHHHHHHHHHHHHH-------CCCEEEEECH-HHHHHHHHCCCHHHHHC
T ss_conf             799498---4999999999999998-------7999999888-79999987905999848


No 10 
>1rpb_A Tricyclic peptide RP 71955; HIV replication inhibitor; NMR {Actinomycete SP9440} SCOP: j.24.1.1 PDB: 1rpc_A
Probab=7.40  E-value=1.1e+02  Score=11.57  Aligned_cols=15  Identities=27%  Similarity=0.572  Sum_probs=0.0

Q ss_pred             HCCCCCCCCCCCCCC
Q ss_conf             406889878986899
Q gi|254780883|r  108 LIKCNPLGSDGFDPV  122 (139)
Q Consensus       108 LlRCnP~~~gG~DPV  122 (139)
                      |..||.|...||.-|
T Consensus         4 igscndfagcgyavv   18 (26)
T 1rpb_A            4 IGSCNDFAGCGYAVV   18 (26)
T ss_dssp             CSSBCSSSSSCBBSS
T ss_pred             EECCCCCCCCCEEEE
T ss_conf             222245578865999


Done!