BLAST/PSIBLAST alignment of GI: 254780883 and GI: 110633360 at iteration 1
>gi|110633360|ref|YP_673568.1| hypothetical protein Meso_1006 [Mesorhizobium sp. BNC1] Length = 108
>gi|116256128|sp|Q11JM2|Y1006_MESSB RecName: Full=UPF0161 protein Meso_1006 Length = 108
>gi|110284344|gb|ABG62403.1| protein of unknown function DUF37 [Chelativorans sp. BNC1] Length = 108
 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 50/88 (56%), Positives = 64/88 (72%)

Query: 43  SRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSW 102
           SRNW+G +PKT GR++G   +R+YQL  S   GNSCR+ PTCSEY YEAIAR+GLW G W
Sbjct: 8   SRNWSGPWPKTPGRVLGTAFVRLYQLTLSGFIGNSCRHFPTCSEYAYEAIARHGLWAGGW 67

Query: 103 LTLLRLIKCNPLGSDGFDPVPDDLPPKK 130
           + L R++ C P G+ G DPVP+ L P+ 
Sbjct: 68  MGLFRVMHCGPGGTHGIDPVPEILQPRH 95