BLAST/PSIBLAST alignment of GI: 254780883 and GI: 315122697 at iteration 1
>gi|315122697|ref|YP_004063186.1| hypothetical protein CKC_04745 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 104
>gi|313496099|gb|ADR52698.1| hypothetical protein CKC_04745 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 104
 Score =  143 bits (360), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 77/95 (81%), Positives = 85/95 (89%)

Query: 35  LLKNNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIAR 94
           + + N PKSRNW GKFPKT GRLIGIGIIRIYQL+FSN+FG+SCRYLPTCSEY YEAIAR
Sbjct: 1   MSQKNIPKSRNWTGKFPKTPGRLIGIGIIRIYQLVFSNIFGHSCRYLPTCSEYAYEAIAR 60

Query: 95  YGLWIGSWLTLLRLIKCNPLGSDGFDPVPDDLPPK 129
           YGLWIG WLTL R+IKCNPLGS GF+PVPD+LP K
Sbjct: 61  YGLWIGGWLTLFRVIKCNPLGSHGFNPVPDNLPKK 95