BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780883|ref|YP_003065296.1| hypothetical protein
CLIBASIA_03900 [Candidatus Liberibacter asiaticus str. psy62]
         (139 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780883|ref|YP_003065296.1| hypothetical protein CLIBASIA_03900 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040560|gb|ACT57356.1| hypothetical protein CLIBASIA_03900 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 139

 Score =  210 bits (535), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 139/139 (100%), Positives = 139/139 (100%)

Query: 1   MYYECKDSTSSDRYLTTFSQSSYALPIQKKGSPLLLKNNTPKSRNWNGKFPKTLGRLIGI 60
           MYYECKDSTSSDRYLTTFSQSSYALPIQKKGSPLLLKNNTPKSRNWNGKFPKTLGRLIGI
Sbjct: 1   MYYECKDSTSSDRYLTTFSQSSYALPIQKKGSPLLLKNNTPKSRNWNGKFPKTLGRLIGI 60

Query: 61  GIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFD 120
           GIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFD
Sbjct: 61  GIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFD 120

Query: 121 PVPDDLPPKKNNPKLLSKK 139
           PVPDDLPPKKNNPKLLSKK
Sbjct: 121 PVPDDLPPKKNNPKLLSKK 139


>gi|114706247|ref|ZP_01439149.1| hypothetical protein FP2506_00645 [Fulvimarina pelagi HTCC2506]
 gi|114538108|gb|EAU41230.1| hypothetical protein FP2506_00645 [Fulvimarina pelagi HTCC2506]
          Length = 83

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 48/82 (58%), Positives = 59/82 (71%)

Query: 43  SRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSW 102
           SRN+ G + +T GRL+G G+IR YQL  S + G  CR+LPTCSEYGYEA+AR+GL  GSW
Sbjct: 2   SRNYAGPWRRTPGRLVGTGLIRAYQLTLSPLIGGHCRHLPTCSEYGYEAVARHGLLRGSW 61

Query: 103 LTLLRLIKCNPLGSDGFDPVPD 124
           LT  R+ +C P G  G D VPD
Sbjct: 62  LTAKRVSRCGPFGKGGIDNVPD 83


>gi|315634812|ref|ZP_07890094.1| alpha-hemolysin [Aggregatibacter segnis ATCC 33393]
 gi|315476364|gb|EFU67114.1| alpha-hemolysin [Aggregatibacter segnis ATCC 33393]
          Length = 87

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 40/88 (45%), Positives = 57/88 (64%), Gaps = 4/88 (4%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
             + G  I IG+IR YQ++ S + G  CR+ PTCS YG +A+  +G+  G WLT+ R++K
Sbjct: 4   THSFGAKILIGLIRFYQIVISPLIGPRCRFTPTCSCYGIDAVKTHGVVKGGWLTVKRILK 63

Query: 111 CNPLGSDGFDPVPDDLPPKKNNPKLLSK 138
           C+PL + G+DPVP    PK NN K  +K
Sbjct: 64  CHPLNAGGYDPVP----PKINNNKTENK 87


>gi|163760292|ref|ZP_02167375.1| hypothetical protein HPDFL43_08519 [Hoeflea phototrophica DFL-43]
 gi|162282691|gb|EDQ32979.1| hypothetical protein HPDFL43_08519 [Hoeflea phototrophica DFL-43]
          Length = 112

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 51/90 (56%), Positives = 63/90 (70%)

Query: 40  TPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWI 99
           T K RNW G + KT GRL+G G++R+YQL  S   GNSCR+LPTCSEY YEAIAR+GLW 
Sbjct: 5   TAKGRNWRGPWRKTPGRLLGTGLVRLYQLTLSGFIGNSCRHLPTCSEYAYEAIARHGLWK 64

Query: 100 GSWLTLLRLIKCNPLGSDGFDPVPDDLPPK 129
           G WL   R+ +C P G+ G D VP+ L  +
Sbjct: 65  GGWLAFFRVGRCGPGGTHGIDNVPEALDAR 94


>gi|288942815|ref|YP_003445055.1| hypothetical protein Alvin_3124 [Allochromatium vinosum DSM 180]
 gi|288898187|gb|ADC64023.1| protein of unknown function DUF37 [Allochromatium vinosum DSM 180]
          Length = 78

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 46/71 (64%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R I IG+IR+YQ + S + G  CR+ PTCS Y  EAI  +G+  GS+L L R+++C+P 
Sbjct: 1   MRRILIGLIRVYQYLISPLLGPRCRFYPTCSHYAVEAIEVHGVARGSYLALRRVLRCHPW 60

Query: 115 GSDGFDPVPDD 125
              G DPVP+ 
Sbjct: 61  HPGGIDPVPEK 71


>gi|325577778|ref|ZP_08148053.1| alpha-hemolysin [Haemophilus parainfluenzae ATCC 33392]
 gi|301154700|emb|CBW14163.1| predicted protein [Haemophilus parainfluenzae T3T1]
 gi|325160523|gb|EGC72649.1| alpha-hemolysin [Haemophilus parainfluenzae ATCC 33392]
          Length = 87

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 41/85 (48%), Positives = 54/85 (63%), Gaps = 3/85 (3%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
                + G  I I +I+ YQ+  S + G  CR++PTCS YG EA+  +GL  GSWLTL R
Sbjct: 1   MGTSHSFGTKILIALIKFYQVAISPLIGPRCRFVPTCSCYGIEALKTHGLLKGSWLTLKR 60

Query: 108 LIKCNPLGSDGFDPVPDDLPPKKNN 132
           ++KC+PL + GFDPVP   P K NN
Sbjct: 61  VLKCHPLSAGGFDPVP---PKKINN 82


>gi|150396272|ref|YP_001326739.1| hypothetical protein Smed_1051 [Sinorhizobium medicae WSM419]
 gi|150027787|gb|ABR59904.1| protein of unknown function DUF37 [Sinorhizobium medicae WSM419]
          Length = 109

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 57/92 (61%), Positives = 73/92 (79%)

Query: 40  TPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWI 99
           T +SRNW+G F KT GRL+G+ +IR YQL  S++ GNSCR+LPTCSEYG+EAIARYGLW 
Sbjct: 3   TAQSRNWSGPFRKTPGRLVGMALIRAYQLTLSSLIGNSCRHLPTCSEYGFEAIARYGLWA 62

Query: 100 GSWLTLLRLIKCNPLGSDGFDPVPDDLPPKKN 131
           G WLTL R ++C P G+ GFDPVP+ L  +++
Sbjct: 63  GGWLTLFRAVRCGPGGTHGFDPVPETLAARQH 94


>gi|261868619|ref|YP_003256541.1| hypothetical protein D11S_1968 [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261413951|gb|ACX83322.1| hypothetical protein D11S_1968 [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 87

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 41/91 (45%), Positives = 55/91 (60%), Gaps = 4/91 (4%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
                +    I IG+IR YQ++ S + G  CR+ PTCS YG EA+  +G   G WLTL R
Sbjct: 1   MATTHSFSAKILIGLIRFYQIVISPLIGPRCRFTPTCSCYGIEAVKTHGTLKGGWLTLKR 60

Query: 108 LIKCNPLGSDGFDPVPDDLPPKKNNPKLLSK 138
           ++KC+PL + G+DPVP    PK NN K  +K
Sbjct: 61  ILKCHPLNTGGYDPVP----PKINNNKTENK 87


>gi|15603029|ref|NP_246101.1| hypothetical protein PM1164 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|14286067|sp|Q9CLQ3|Y1164_PASMU RecName: Full=UPF0161 protein PM1164
 gi|12721512|gb|AAK03248.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 86

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 39/83 (46%), Positives = 54/83 (65%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
             +L   I IG+IR+YQ++ S + G  CR+ PTCS YG EA+  +G   GSWLTL R++K
Sbjct: 4   THSLSSKILIGLIRVYQVVISPLIGPRCRFTPTCSCYGIEAVKTHGAIKGSWLTLKRILK 63

Query: 111 CNPLGSDGFDPVPDDLPPKKNNP 133
           C+PL + G+DPVP  +  KK   
Sbjct: 64  CHPLNAGGYDPVPPKINNKKEKK 86


>gi|148658015|ref|YP_001278220.1| hypothetical protein RoseRS_3917 [Roseiflexus sp. RS-1]
 gi|148570125|gb|ABQ92270.1| protein of unknown function DUF37 [Roseiflexus sp. RS-1]
          Length = 214

 Score =  120 bits (301), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 49/73 (67%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + R I + +IR YQL  S     SC Y P+CS+Y Y+AIA++G   G++L + R+++C+P
Sbjct: 1   MIRWILLKLIRFYQLFISPALPPSCIYEPSCSKYTYQAIAKHGALKGTYLGIRRILRCHP 60

Query: 114 LGSDGFDPVPDDL 126
               G+DPVPD++
Sbjct: 61  WAQGGYDPVPDEV 73


>gi|113460280|ref|YP_718338.1| hypothetical protein HS_0134 [Haemophilus somnus 129PT]
 gi|170718321|ref|YP_001785333.1| hypothetical protein HSM_2019 [Haemophilus somnus 2336]
 gi|122945113|sp|Q0I0Z0|Y134_HAES1 RecName: Full=UPF0161 protein HS_0134
 gi|226701129|sp|B0URU4|Y2019_HAES2 RecName: Full=UPF0161 protein HSM_2019
 gi|112822323|gb|ABI24412.1| conserved hypothetical protein [Haemophilus somnus 129PT]
 gi|168826450|gb|ACA31821.1| protein of unknown function DUF37 [Haemophilus somnus 2336]
          Length = 86

 Score =  120 bits (301), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 37/85 (43%), Positives = 54/85 (63%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
            +   + G  + IG IRIYQL+ S + G  CR++PTCS YG +A+  +G+  GSWLT+ R
Sbjct: 1   METSHSFGAKVLIGAIRIYQLMISPLIGPRCRFVPTCSCYGIQAVKTHGVVKGSWLTVKR 60

Query: 108 LIKCNPLGSDGFDPVPDDLPPKKNN 132
           ++KC+P    G+DPVP  +   K N
Sbjct: 61  ILKCHPFNVGGYDPVPPKINNNKEN 85


>gi|86357815|ref|YP_469707.1| hypothetical protein RHE_CH02199 [Rhizobium etli CFN 42]
 gi|116256198|sp|Q2K856|Y2199_RHIEC RecName: Full=UPF0161 protein RHE_CH02199
 gi|86281917|gb|ABC90980.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 134

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 52/90 (57%), Positives = 65/90 (72%)

Query: 38  NNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGL 97
                SRN+ G F KT  RL+G+G+IR+YQL  S   GNSCR++PTCSEYGYEAIAR+GL
Sbjct: 26  RTARYSRNYAGPFRKTPDRLLGMGLIRLYQLTLSGFVGNSCRHIPTCSEYGYEAIARHGL 85

Query: 98  WIGSWLTLLRLIKCNPLGSDGFDPVPDDLP 127
           W G W+TL R+ +C P G+ G DPVP+ L 
Sbjct: 86  WAGGWMTLFRVARCGPGGTSGLDPVPEILS 115


>gi|15889051|ref|NP_354732.1| hypothetical protein Atu1747 [Agrobacterium tumefaciens str. C58]
 gi|29428226|sp|Q8UEL0|Y1747_AGRT5 RecName: Full=UPF0161 protein Atu1747
 gi|15156848|gb|AAK87517.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 119

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 57/105 (54%), Positives = 69/105 (65%), Gaps = 4/105 (3%)

Query: 31  GSPLLLKNNTP----KSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSE 86
           G P      T     +SRNW G F KT GRL G+G IR+YQL  S   GNSCR++PTCSE
Sbjct: 3   GEPGCRHEQTAVKAGRSRNWAGSFAKTPGRLFGVGFIRLYQLTLSGFVGNSCRHIPTCSE 62

Query: 87  YGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVPDDLPPKKN 131
           YGYEAIAR+GLW G W+ L R+ +C P G+ G DPVP++L   K 
Sbjct: 63  YGYEAIARHGLWAGGWMALFRVARCGPGGTSGLDPVPEELDGSKR 107


>gi|152979765|ref|YP_001345394.1| hypothetical protein Asuc_2115 [Actinobacillus succinogenes 130Z]
 gi|171704506|sp|A6VR62|Y2115_ACTSZ RecName: Full=UPF0161 protein Asuc_2115
 gi|150841488|gb|ABR75459.1| protein of unknown function DUF37 [Actinobacillus succinogenes
           130Z]
          Length = 88

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 42/92 (45%), Positives = 58/92 (63%), Gaps = 4/92 (4%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
                +LG  I I +IR YQ++ S + G  CR++PTCS YG EAI  +G   G+WLTL R
Sbjct: 1   MAASHSLGEKILIKLIRFYQIVISPLIGPRCRFVPTCSCYGLEAIKTHGAVRGAWLTLKR 60

Query: 108 LIKCNPLGSDGFDPVPDDLPPKKNNPKLLSKK 139
           ++KC+PL + G+DPVP    PK +N    +KK
Sbjct: 61  ILKCHPLNAGGYDPVP----PKSDNHSKENKK 88


>gi|145640675|ref|ZP_01796258.1| hypothetical protein CGSHiR3021_06400 [Haemophilus influenzae
           R3021]
 gi|145274601|gb|EDK14464.1| hypothetical protein CGSHiR3021_06400 [Haemophilus influenzae
           22.4-21]
          Length = 91

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 43/82 (52%), Positives = 55/82 (67%), Gaps = 4/82 (4%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
             +LG  I I IIR+YQ++ S   G  CR++PTCS YG EA+  +GL  G WLTL R++K
Sbjct: 4   THSLGTKILIKIIRLYQIMISPFIGARCRFVPTCSCYGIEALKTHGLLKGGWLTLKRVLK 63

Query: 111 CNPLGSDGFDPVPDDLPPKKNN 132
           C+PL + GFDPVP    PK NN
Sbjct: 64  CHPLNAGGFDPVP----PKTNN 81


>gi|325981603|ref|YP_004294005.1| hypothetical protein NAL212_0920 [Nitrosomonas sp. AL212]
 gi|325531122|gb|ADZ25843.1| protein of unknown function DUF37 [Nitrosomonas sp. AL212]
          Length = 83

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 49/82 (59%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
                R I IG+I+ YQ++ S + G SCR+ PTCS Y  EA+  +G+  G WL + R+ +
Sbjct: 1   MAIFLRRILIGVIKGYQIVISALLGQSCRFYPTCSNYTIEALELHGILRGGWLAIKRISR 60

Query: 111 CNPLGSDGFDPVPDDLPPKKNN 132
           C+P    GFDPVP +    +++
Sbjct: 61  CHPWNPGGFDPVPLNKTEHRDS 82


>gi|156743171|ref|YP_001433300.1| hypothetical protein Rcas_3228 [Roseiflexus castenholzii DSM 13941]
 gi|156234499|gb|ABU59282.1| protein of unknown function DUF37 [Roseiflexus castenholzii DSM
           13941]
          Length = 206

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 30/72 (41%), Positives = 47/72 (65%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + R I + +IR YQ+  S     SC Y P+CS Y Y+AIAR+G   G++L + R+++C+P
Sbjct: 1   MIRWILLKLIRFYQMFISPALPPSCIYEPSCSTYTYQAIARHGALKGTYLGIRRILRCHP 60

Query: 114 LGSDGFDPVPDD 125
               G+DPVP++
Sbjct: 61  WAQGGYDPVPEE 72


>gi|306843945|ref|ZP_07476540.1| conserved hypothetical protein [Brucella sp. BO1]
 gi|306275700|gb|EFM57424.1| conserved hypothetical protein [Brucella sp. BO1]
          Length = 123

 Score =  119 bits (298), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 50/88 (56%), Positives = 64/88 (72%)

Query: 41  PKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIG 100
           P SRN+   + KT GRL G  +IR YQ+  S++ GNSCR+LPTCSEY YEAIAR+GLW G
Sbjct: 16  PYSRNFTDPWRKTPGRLFGTALIRFYQITLSSLIGNSCRHLPTCSEYAYEAIARHGLWRG 75

Query: 101 SWLTLLRLIKCNPLGSDGFDPVPDDLPP 128
            W+   R+++C P G+ GFDPVP +L P
Sbjct: 76  GWMGFFRVVRCGPFGTHGFDPVPRELSP 103


>gi|254719145|ref|ZP_05180956.1| hypothetical protein Bru83_06330 [Brucella sp. 83/13]
 gi|265984139|ref|ZP_06096874.1| alpha-hemolysin [Brucella sp. 83/13]
 gi|306838137|ref|ZP_07470993.1| conserved hypothetical protein [Brucella sp. NF 2653]
 gi|264662731|gb|EEZ32992.1| alpha-hemolysin [Brucella sp. 83/13]
 gi|306406727|gb|EFM62950.1| conserved hypothetical protein [Brucella sp. NF 2653]
          Length = 123

 Score =  119 bits (298), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 50/88 (56%), Positives = 64/88 (72%)

Query: 41  PKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIG 100
           P SRN+   + KT GRL G  +IR YQ+  S++ GNSCR+LPTCSEY YEAIAR+GLW G
Sbjct: 16  PYSRNFTDPWRKTPGRLFGTALIRFYQITLSSLIGNSCRHLPTCSEYAYEAIARHGLWRG 75

Query: 101 SWLTLLRLIKCNPLGSDGFDPVPDDLPP 128
            W+   R+++C P G+ GFDPVP +L P
Sbjct: 76  GWMGFFRVVRCGPFGTHGFDPVPRELSP 103


>gi|30264862|ref|NP_847239.1| hypothetical protein BA_5048 [Bacillus anthracis str. Ames]
 gi|47530347|ref|YP_021696.1| hypothetical protein GBAA_5048 [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49187679|ref|YP_030932.1| hypothetical protein BAS4688 [Bacillus anthracis str. Sterne]
 gi|52140709|ref|YP_086120.1| hypothetical protein BCZK4545 [Bacillus cereus E33L]
 gi|65322161|ref|ZP_00395120.1| COG0759: Uncharacterized conserved protein [Bacillus anthracis str.
           A2012]
 gi|165869619|ref|ZP_02214277.1| conserved hypothetical protein TIGR00278 [Bacillus anthracis str.
           A0488]
 gi|167633941|ref|ZP_02392264.1| conserved hypothetical protein TIGR00278 [Bacillus anthracis str.
           A0442]
 gi|167638194|ref|ZP_02396472.1| conserved hypothetical protein TIGR00278 [Bacillus anthracis str.
           A0193]
 gi|170685882|ref|ZP_02877105.1| conserved hypothetical protein TIGR00278 [Bacillus anthracis str.
           A0465]
 gi|170705378|ref|ZP_02895842.1| conserved hypothetical protein TIGR00278 [Bacillus anthracis str.
           A0389]
 gi|177651316|ref|ZP_02934147.1| conserved hypothetical protein TIGR00278 [Bacillus anthracis str.
           A0174]
 gi|190568374|ref|ZP_03021282.1| conserved hypothetical protein TIGR00278 [Bacillus anthracis
           Tsiankovskii-I]
 gi|196032926|ref|ZP_03100339.1| conserved hypothetical protein TIGR00278 [Bacillus cereus W]
 gi|196041493|ref|ZP_03108786.1| conserved hypothetical protein TIGR00278 [Bacillus cereus
           NVH0597-99]
 gi|196043998|ref|ZP_03111235.1| conserved hypothetical protein TIGR00278 [Bacillus cereus 03BB108]
 gi|218231021|ref|YP_002369603.1| hypothetical protein BCB4264_A4918 [Bacillus cereus B4264]
 gi|218906024|ref|YP_002453858.1| conserved hypothetical protein TIGR00278 [Bacillus cereus AH820]
 gi|225866788|ref|YP_002752166.1| conserved hypothetical protein TIGR00278 [Bacillus cereus 03BB102]
 gi|227817589|ref|YP_002817598.1| conserved hypothetical protein TIGR00278 [Bacillus anthracis str.
           CDC 684]
 gi|229602184|ref|YP_002869067.1| conserved hypothetical protein TIGR00278 [Bacillus anthracis str.
           A0248]
 gi|254687602|ref|ZP_05151458.1| hypothetical protein BantC_27660 [Bacillus anthracis str.
           CNEVA-9066]
 gi|254725168|ref|ZP_05186951.1| hypothetical protein BantA1_22314 [Bacillus anthracis str. A1055]
 gi|254736906|ref|ZP_05194612.1| hypothetical protein BantWNA_17196 [Bacillus anthracis str. Western
           North America USA6153]
 gi|254741941|ref|ZP_05199628.1| hypothetical protein BantKB_13123 [Bacillus anthracis str. Kruger
           B]
 gi|254754461|ref|ZP_05206496.1| hypothetical protein BantV_18422 [Bacillus anthracis str. Vollum]
 gi|254757294|ref|ZP_05209321.1| hypothetical protein BantA9_03216 [Bacillus anthracis str.
           Australia 94]
 gi|301056301|ref|YP_003794512.1| hypothetical protein BACI_c47920 [Bacillus anthracis CI]
 gi|47606270|sp|Q81KF2|Y5048_BACAN RecName: Full=UPF0161 protein BA_5048/GBAA_5048/BAS4688
 gi|81685758|sp|Q632P7|Y4545_BACCZ RecName: Full=UPF0161 protein BCE33L4545
 gi|226707631|sp|B7JT58|Y4913_BACC0 RecName: Full=UPF0161 protein BCAH820_4913
 gi|226707633|sp|B7H9G7|Y4918_BACC4 RecName: Full=UPF0161 protein BCB4264_A4918
 gi|254803970|sp|C1EW67|Y4924_BACC3 RecName: Full=UPF0161 protein BCA_4924
 gi|254806442|sp|C3PCE8|Y5060_BACAA RecName: Full=UPF0161 protein BAA_5060
 gi|254806449|sp|C3LB28|Y5083_BACAC RecName: Full=UPF0161 protein BAMEG_5083
 gi|30259537|gb|AAP28725.1| conserved hypothetical protein TIGR00278 [Bacillus anthracis str.
           Ames]
 gi|47505495|gb|AAT34171.1| conserved hypothetical protein TIGR00278 [Bacillus anthracis str.
           'Ames Ancestor']
 gi|49181606|gb|AAT56982.1| conserved hypothetical protein TIGR00278 [Bacillus anthracis str.
           Sterne]
 gi|51974178|gb|AAU15728.1| conserved hypothetical protein; possible alpha-hemolysin [Bacillus
           cereus E33L]
 gi|164714448|gb|EDR19967.1| conserved hypothetical protein TIGR00278 [Bacillus anthracis str.
           A0488]
 gi|167514011|gb|EDR89379.1| conserved hypothetical protein TIGR00278 [Bacillus anthracis str.
           A0193]
 gi|167530742|gb|EDR93444.1| conserved hypothetical protein TIGR00278 [Bacillus anthracis str.
           A0442]
 gi|170129503|gb|EDS98366.1| conserved hypothetical protein TIGR00278 [Bacillus anthracis str.
           A0389]
 gi|170670346|gb|EDT21086.1| conserved hypothetical protein TIGR00278 [Bacillus anthracis str.
           A0465]
 gi|172083142|gb|EDT68204.1| conserved hypothetical protein TIGR00278 [Bacillus anthracis str.
           A0174]
 gi|190560630|gb|EDV14607.1| conserved hypothetical protein TIGR00278 [Bacillus anthracis
           Tsiankovskii-I]
 gi|195994355|gb|EDX58310.1| conserved hypothetical protein TIGR00278 [Bacillus cereus W]
 gi|196025334|gb|EDX64004.1| conserved hypothetical protein TIGR00278 [Bacillus cereus 03BB108]
 gi|196027741|gb|EDX66355.1| conserved hypothetical protein TIGR00278 [Bacillus cereus
           NVH0597-99]
 gi|218158978|gb|ACK58970.1| conserved hypothetical protein TIGR00278 [Bacillus cereus B4264]
 gi|218539498|gb|ACK91896.1| conserved hypothetical protein TIGR00278 [Bacillus cereus AH820]
 gi|225790629|gb|ACO30846.1| conserved hypothetical protein TIGR00278 [Bacillus cereus 03BB102]
 gi|227002342|gb|ACP12085.1| conserved hypothetical protein TIGR00278 [Bacillus anthracis str.
           CDC 684]
 gi|229266592|gb|ACQ48229.1| conserved hypothetical protein TIGR00278 [Bacillus anthracis str.
           A0248]
 gi|300378470|gb|ADK07374.1| conserved hypothetical protein [Bacillus cereus biovar anthracis
           str. CI]
          Length = 78

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 37/78 (47%), Positives = 48/78 (61%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I IGIIR YQ   S +   +CR+ PTCS YG EA  ++G + G WLT  R++KC+P 
Sbjct: 1   MKQIFIGIIRFYQKFISPMTPPTCRFYPTCSHYGLEAFQKHGAFKGFWLTCKRILKCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              GFDPVPD    K N+
Sbjct: 61  HPGGFDPVPDKKDDKVNS 78


>gi|116256248|sp|Q65VC1|Y482_MANSM RecName: Full=UPF0161 protein MS0482
          Length = 86

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 41/87 (47%), Positives = 52/87 (59%), Gaps = 3/87 (3%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
                +LG  I + +IR YQL  S + G  CR+ PTCS YG EAI  +G   GSWLTL R
Sbjct: 1   MATSHSLGEKILVKLIRFYQLAISPMIGPRCRFTPTCSCYGIEAIKTHGALKGSWLTLKR 60

Query: 108 LIKCNPLGSDGFDPVPDDLPPKKNNPK 134
           ++KC+PL   G+DPVP   P   NN +
Sbjct: 61  ILKCHPLSKGGYDPVP---PKINNNVE 84


>gi|227538312|ref|ZP_03968361.1| possible alpha-hemolysin [Sphingobacterium spiritivorum ATCC 33300]
 gi|227241827|gb|EEI91842.1| possible alpha-hemolysin [Sphingobacterium spiritivorum ATCC 33300]
          Length = 84

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 38/75 (50%), Positives = 49/75 (65%)

Query: 49  KFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRL 108
           K  K   R + I +IR YQL  S + G +CRY PTCS+YG EAI +YG + G WL + R+
Sbjct: 10  KIIKGAFRFLFILLIRFYQLFISPLLGANCRYTPTCSQYGMEAIKKYGPFKGGWLAIKRI 69

Query: 109 IKCNPLGSDGFDPVP 123
           ++CNP G  G DPVP
Sbjct: 70  LRCNPWGGHGHDPVP 84


>gi|148826354|ref|YP_001291107.1| ribonuclease P [Haemophilus influenzae PittEE]
 gi|148716514|gb|ABQ98724.1| ribonuclease P [Haemophilus influenzae PittEE]
          Length = 194

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 41/81 (50%), Positives = 54/81 (66%), Gaps = 3/81 (3%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           L + I I IIR+YQ++ S   G  CR++PTCS YG EA+  +GL  G WLTL R++KC+P
Sbjct: 115 LAQKILIKIIRLYQIMISPFIGARCRFVPTCSCYGIEALKTHGLLKGGWLTLKRVLKCHP 174

Query: 114 LGSDGFDPVPDDLPPKKNNPK 134
           L + GFDPVP   P   NN +
Sbjct: 175 LNAGGFDPVP---PKTNNNDE 192


>gi|30022861|ref|NP_834492.1| hypothetical protein BC4790 [Bacillus cereus ATCC 14579]
 gi|75758876|ref|ZP_00738988.1| Hypothetical cytosolic protein [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|206969924|ref|ZP_03230878.1| conserved hypothetical protein TIGR00278 [Bacillus cereus AH1134]
 gi|218899959|ref|YP_002448370.1| hypothetical protein TIGR00278 [Bacillus cereus G9842]
 gi|47606268|sp|Q812M8|Y4790_BACCR RecName: Full=UPF0161 protein BC_4790
 gi|226703755|sp|B7ILV5|Y320_BACC2 RecName: Full=UPF0161 protein BCG9842_B0320
 gi|29898420|gb|AAP11693.1| hypothetical Cytosolic Protein [Bacillus cereus ATCC 14579]
 gi|74493642|gb|EAO56746.1| Hypothetical cytosolic protein [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|206735612|gb|EDZ52780.1| conserved hypothetical protein TIGR00278 [Bacillus cereus AH1134]
 gi|218543879|gb|ACK96273.1| conserved hypothetical protein TIGR00278 [Bacillus cereus G9842]
          Length = 78

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 37/78 (47%), Positives = 47/78 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I IGIIR YQ   S +   +CR+ PTCS YG EA  ++G   G WLT  R++KC+P 
Sbjct: 1   MKQIFIGIIRFYQKFISPMTPPTCRFYPTCSHYGLEAFQKHGALKGFWLTCKRILKCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              GFDPVPD    K N+
Sbjct: 61  HPGGFDPVPDKKDDKVNS 78


>gi|17987195|ref|NP_539829.1| hypothetical protein BMEI0912 [Brucella melitensis bv. 1 str. 16M]
 gi|62289989|ref|YP_221782.1| hypothetical protein BruAb1_1078 [Brucella abortus bv. 1 str.
           9-941]
 gi|82699917|ref|YP_414491.1| hypothetical protein BAB1_1095 [Brucella melitensis biovar Abortus
           2308]
 gi|189024231|ref|YP_001934999.1| hypothetical protein BAbS19_I10160 [Brucella abortus S19]
 gi|237815493|ref|ZP_04594491.1| conserved hypothetical protein [Brucella abortus str. 2308 A]
 gi|254689297|ref|ZP_05152551.1| hypothetical protein Babob68_03821 [Brucella abortus bv. 6 str.
           870]
 gi|254693781|ref|ZP_05155609.1| hypothetical protein Babob3T_03814 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254697433|ref|ZP_05159261.1| hypothetical protein Babob28_06952 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254730331|ref|ZP_05188909.1| hypothetical protein Babob42_03861 [Brucella abortus bv. 4 str.
           292]
 gi|256044732|ref|ZP_05447636.1| hypothetical protein Bmelb1R_09578 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256113622|ref|ZP_05454442.1| hypothetical protein Bmelb3E_12747 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256257547|ref|ZP_05463083.1| hypothetical protein Babob9C_09408 [Brucella abortus bv. 9 str.
           C68]
 gi|256263935|ref|ZP_05466467.1| alpha-hemolysin [Brucella melitensis bv. 2 str. 63/9]
 gi|260545261|ref|ZP_05821002.1| alpha-hemolysin [Brucella abortus NCTC 8038]
 gi|260564075|ref|ZP_05834561.1| alpha-hemolysin [Brucella melitensis bv. 1 str. 16M]
 gi|260754809|ref|ZP_05867157.1| alpha-hemolysin [Brucella abortus bv. 6 str. 870]
 gi|260758031|ref|ZP_05870379.1| alpha-hemolysin [Brucella abortus bv. 4 str. 292]
 gi|260761854|ref|ZP_05874197.1| alpha-hemolysin [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883827|ref|ZP_05895441.1| alpha-hemolysin [Brucella abortus bv. 9 str. C68]
 gi|261214060|ref|ZP_05928341.1| alpha-hemolysin [Brucella abortus bv. 3 str. Tulya]
 gi|265991154|ref|ZP_06103711.1| alpha-hemolysin [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994990|ref|ZP_06107547.1| alpha-hemolysin [Brucella melitensis bv. 3 str. Ether]
 gi|29428231|sp|Q8YH92|Y912_BRUME RecName: Full=UPF0161 protein BMEI0912
 gi|75496790|sp|Q57D63|Y1078_BRUAB RecName: Full=UPF0161 protein BruAb1_1078
 gi|116256130|sp|Q2YQ05|Y1095_BRUA2 RecName: Full=UPF0161 protein BAB1_1095
 gi|17982865|gb|AAL52093.1| hypothetical cytosolic protein [Brucella melitensis bv. 1 str. 16M]
 gi|62196121|gb|AAX74421.1| conserved hypothetical protein TIGR00278 [Brucella abortus bv. 1
           str. 9-941]
 gi|82616018|emb|CAJ11051.1| Protein of unknown function DUF37 [Brucella melitensis biovar
           Abortus 2308]
 gi|189019803|gb|ACD72525.1| Protein of unknown function DUF37 [Brucella abortus S19]
 gi|237790330|gb|EEP64540.1| conserved hypothetical protein [Brucella abortus str. 2308 A]
 gi|260096668|gb|EEW80543.1| alpha-hemolysin [Brucella abortus NCTC 8038]
 gi|260154091|gb|EEW89183.1| alpha-hemolysin [Brucella melitensis bv. 1 str. 16M]
 gi|260668349|gb|EEX55289.1| alpha-hemolysin [Brucella abortus bv. 4 str. 292]
 gi|260672286|gb|EEX59107.1| alpha-hemolysin [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674917|gb|EEX61738.1| alpha-hemolysin [Brucella abortus bv. 6 str. 870]
 gi|260873355|gb|EEX80424.1| alpha-hemolysin [Brucella abortus bv. 9 str. C68]
 gi|260915667|gb|EEX82528.1| alpha-hemolysin [Brucella abortus bv. 3 str. Tulya]
 gi|262766103|gb|EEZ11892.1| alpha-hemolysin [Brucella melitensis bv. 3 str. Ether]
 gi|263001938|gb|EEZ14513.1| alpha-hemolysin [Brucella melitensis bv. 1 str. Rev.1]
 gi|263094077|gb|EEZ17999.1| alpha-hemolysin [Brucella melitensis bv. 2 str. 63/9]
 gi|326409096|gb|ADZ66161.1| conserved hypothetical protein [Brucella melitensis M28]
 gi|326538800|gb|ADZ87015.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 123

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 50/88 (56%), Positives = 64/88 (72%)

Query: 41  PKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIG 100
           P SRN+   + KT GRL G  +IR YQ+  S++ GNSCR+LPTCSEY YEAIAR+GLW G
Sbjct: 16  PYSRNFTDPWRKTPGRLFGTALIRFYQITLSSLIGNSCRHLPTCSEYAYEAIARHGLWRG 75

Query: 101 SWLTLLRLIKCNPLGSDGFDPVPDDLPP 128
            W+   R+++C P G+ GFDPVP +L P
Sbjct: 76  GWMGFFRVVRCGPFGTHGFDPVPRELSP 103


>gi|16272936|ref|NP_439162.1| hypothetical protein HI1000 [Haemophilus influenzae Rd KW20]
 gi|68249584|ref|YP_248696.1| hypothetical protein NTHI1174 [Haemophilus influenzae 86-028NP]
 gi|145628057|ref|ZP_01783858.1| hypothetical protein CGSHi22121_03430 [Haemophilus influenzae
           22.1-21]
 gi|145630097|ref|ZP_01785879.1| hypothetical protein CGSHi22421_08598 [Haemophilus influenzae
           R3021]
 gi|145637305|ref|ZP_01792966.1| hypothetical protein CGSHiHH_05372 [Haemophilus influenzae PittHH]
 gi|145638179|ref|ZP_01793789.1| hypothetical protein CGSHiII_05394 [Haemophilus influenzae PittII]
 gi|148828170|ref|YP_001292923.1| hypothetical protein CGSHiGG_08600 [Haemophilus influenzae PittGG]
 gi|229843941|ref|ZP_04464082.1| hypothetical protein CGSHi6P18H1_05866 [Haemophilus influenzae
           6P18H1]
 gi|229846057|ref|ZP_04466169.1| hypothetical protein CGSHi7P49H1_04393 [Haemophilus influenzae
           7P49H1]
 gi|260580090|ref|ZP_05847920.1| conserved hypothetical protein [Haemophilus influenzae RdAW]
 gi|260581922|ref|ZP_05849718.1| conserved hypothetical protein [Haemophilus influenzae NT127]
 gi|319775067|ref|YP_004137555.1| hypothetical protein HICON_04010 [Haemophilus influenzae F3047]
 gi|319897489|ref|YP_004135686.1| hypothetical protein HIBPF12490 [Haemophilus influenzae F3031]
 gi|329123022|ref|ZP_08251593.1| alpha-hemolysin [Haemophilus aegyptius ATCC 11116]
 gi|1176311|sp|P44972|Y1000_HAEIN RecName: Full=UPF0161 protein HI_1000
 gi|81335987|sp|Q4QLR1|Y1174_HAEI8 RecName: Full=UPF0161 protein NTHI1174
 gi|166235105|sp|A5UID4|Y8600_HAEIG RecName: Full=UPF0161 protein CGSHiGG_08600
 gi|1574031|gb|AAC22662.1| hemolysin, putative [Haemophilus influenzae Rd KW20]
 gi|68057783|gb|AAX88036.1| conserved hypothetical protein [Haemophilus influenzae 86-028NP]
 gi|144979832|gb|EDJ89491.1| hypothetical protein CGSHi22121_03430 [Haemophilus influenzae
           22.1-21]
 gi|144984378|gb|EDJ91801.1| hypothetical protein CGSHi22421_08598 [Haemophilus influenzae
           R3021]
 gi|145269557|gb|EDK09499.1| hypothetical protein CGSHiHH_05372 [Haemophilus influenzae PittHH]
 gi|145272508|gb|EDK12415.1| hypothetical protein CGSHiII_05394 [Haemophilus influenzae PittII]
 gi|148719412|gb|ABR00540.1| hypothetical protein CGSHiGG_08600 [Haemophilus influenzae PittGG]
 gi|229811061|gb|EEP46778.1| hypothetical protein CGSHi7P49H1_04393 [Haemophilus influenzae
           7P49H1]
 gi|229812935|gb|EEP48623.1| hypothetical protein CGSHi6P18H1_05866 [Haemophilus influenzae
           6P18H1]
 gi|260093374|gb|EEW77307.1| conserved hypothetical protein [Haemophilus influenzae RdAW]
 gi|260095115|gb|EEW79007.1| conserved hypothetical protein [Haemophilus influenzae NT127]
 gi|309751335|gb|ADO81319.1| Conserved hypothetical protein [Haemophilus influenzae R2866]
 gi|309973501|gb|ADO96702.1| Conserved hypothetical protein [Haemophilus influenzae R2846]
 gi|317432995|emb|CBY81366.1| conserved hypothetical protein [Haemophilus influenzae F3031]
 gi|317449658|emb|CBY85864.1| conserved hypothetical protein [Haemophilus influenzae F3047]
 gi|327471953|gb|EGF17393.1| alpha-hemolysin [Haemophilus aegyptius ATCC 11116]
          Length = 86

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 42/84 (50%), Positives = 55/84 (65%), Gaps = 3/84 (3%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
             +LG  I I IIR+YQ++ S   G  CR++PTCS YG EA+  +GL  G WLTL R++K
Sbjct: 4   THSLGTKILIKIIRLYQIMISPFIGARCRFVPTCSCYGIEALKTHGLLKGGWLTLKRVLK 63

Query: 111 CNPLGSDGFDPVPDDLPPKKNNPK 134
           C+PL + GFDPVP   P   NN +
Sbjct: 64  CHPLNAGGFDPVP---PKTNNNDE 84


>gi|23501951|ref|NP_698078.1| hypothetical protein BR1073 [Brucella suis 1330]
 gi|148560428|ref|YP_001259005.1| hypothetical protein BOV_1039 [Brucella ovis ATCC 25840]
 gi|225627546|ref|ZP_03785583.1| conserved hypothetical protein [Brucella ceti str. Cudo]
 gi|254701820|ref|ZP_05163648.1| hypothetical protein Bsuib55_13313 [Brucella suis bv. 5 str. 513]
 gi|254704363|ref|ZP_05166191.1| hypothetical protein Bsuib36_10631 [Brucella suis bv. 3 str. 686]
 gi|254706740|ref|ZP_05168568.1| hypothetical protein BpinM_07056 [Brucella pinnipedialis
           M163/99/10]
 gi|254710153|ref|ZP_05171964.1| hypothetical protein BpinB_07758 [Brucella pinnipedialis B2/94]
 gi|254714152|ref|ZP_05175963.1| hypothetical protein BcetM6_12525 [Brucella ceti M644/93/1]
 gi|254716790|ref|ZP_05178601.1| hypothetical protein BcetM_10260 [Brucella ceti M13/05/1]
 gi|256031648|ref|ZP_05445262.1| hypothetical protein BpinM2_13533 [Brucella pinnipedialis
           M292/94/1]
 gi|256061159|ref|ZP_05451312.1| hypothetical protein Bneo5_12464 [Brucella neotomae 5K33]
 gi|256159792|ref|ZP_05457535.1| hypothetical protein BcetM4_12508 [Brucella ceti M490/95/1]
 gi|256255050|ref|ZP_05460586.1| hypothetical protein BcetB_12305 [Brucella ceti B1/94]
 gi|256369500|ref|YP_003107008.1| hypothetical protein BMI_I1080 [Brucella microti CCM 4915]
 gi|260168778|ref|ZP_05755589.1| hypothetical protein BruF5_10498 [Brucella sp. F5/99]
 gi|260566391|ref|ZP_05836861.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|261218588|ref|ZP_05932869.1| alpha-hemolysin [Brucella ceti M13/05/1]
 gi|261222241|ref|ZP_05936522.1| alpha-hemolysin [Brucella ceti B1/94]
 gi|261314204|ref|ZP_05953401.1| alpha-hemolysin [Brucella pinnipedialis M163/99/10]
 gi|261317707|ref|ZP_05956904.1| alpha-hemolysin [Brucella pinnipedialis B2/94]
 gi|261321915|ref|ZP_05961112.1| alpha-hemolysin [Brucella ceti M644/93/1]
 gi|261325164|ref|ZP_05964361.1| alpha-hemolysin [Brucella neotomae 5K33]
 gi|261752377|ref|ZP_05996086.1| alpha-hemolysin [Brucella suis bv. 5 str. 513]
 gi|261755035|ref|ZP_05998744.1| alpha-hemolysin [Brucella suis bv. 3 str. 686]
 gi|261758259|ref|ZP_06001968.1| alpha-hemolysin [Brucella sp. F5/99]
 gi|265988740|ref|ZP_06101297.1| alpha-hemolysin [Brucella pinnipedialis M292/94/1]
 gi|265998205|ref|ZP_06110762.1| alpha-hemolysin [Brucella ceti M490/95/1]
 gi|29428212|sp|Q8G0L6|Y1073_BRUSU RecName: Full=UPF0161 protein BR1073
 gi|166228365|sp|A5VQK8|Y1039_BRUO2 RecName: Full=UPF0161 protein BOV_1039
 gi|23347897|gb|AAN29993.1| conserved hypothetical protein TIGR00278 [Brucella suis 1330]
 gi|148371685|gb|ABQ61664.1| conserved hypothetical protein TIGR00278 [Brucella ovis ATCC 25840]
 gi|225617551|gb|EEH14596.1| conserved hypothetical protein [Brucella ceti str. Cudo]
 gi|255999660|gb|ACU48059.1| hypothetical protein BMI_I1080 [Brucella microti CCM 4915]
 gi|260155909|gb|EEW90989.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|260920825|gb|EEX87478.1| alpha-hemolysin [Brucella ceti B1/94]
 gi|260923677|gb|EEX90245.1| alpha-hemolysin [Brucella ceti M13/05/1]
 gi|261294605|gb|EEX98101.1| alpha-hemolysin [Brucella ceti M644/93/1]
 gi|261296930|gb|EEY00427.1| alpha-hemolysin [Brucella pinnipedialis B2/94]
 gi|261301144|gb|EEY04641.1| alpha-hemolysin [Brucella neotomae 5K33]
 gi|261303230|gb|EEY06727.1| alpha-hemolysin [Brucella pinnipedialis M163/99/10]
 gi|261738243|gb|EEY26239.1| alpha-hemolysin [Brucella sp. F5/99]
 gi|261742130|gb|EEY30056.1| alpha-hemolysin [Brucella suis bv. 5 str. 513]
 gi|261744788|gb|EEY32714.1| alpha-hemolysin [Brucella suis bv. 3 str. 686]
 gi|262552673|gb|EEZ08663.1| alpha-hemolysin [Brucella ceti M490/95/1]
 gi|264660937|gb|EEZ31198.1| alpha-hemolysin [Brucella pinnipedialis M292/94/1]
          Length = 123

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 50/88 (56%), Positives = 64/88 (72%)

Query: 41  PKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIG 100
           P SRN+   + KT GRL G  +IR YQ+  S++ GNSCR+LPTCSEY YEAIAR+GLW G
Sbjct: 16  PYSRNFTDPWRKTPGRLFGTALIRFYQITLSSLIGNSCRHLPTCSEYAYEAIARHGLWRG 75

Query: 101 SWLTLLRLIKCNPLGSDGFDPVPDDLPP 128
            W+   R+++C P G+ GFDPVP +L P
Sbjct: 76  GWMGFFRVVRCGPFGTHGFDPVPRELSP 103


>gi|152977150|ref|YP_001376667.1| hypothetical protein Bcer98_3462 [Bacillus cereus subsp. cytotoxis
           NVH 391-98]
 gi|189040148|sp|A7GU64|Y3462_BACCN RecName: Full=UPF0161 protein Bcer98_3462
 gi|152025902|gb|ABS23672.1| protein of unknown function DUF37 [Bacillus cytotoxicus NVH 391-98]
          Length = 75

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 37/75 (49%), Positives = 45/75 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I IGIIR YQ   S +   +CR+ PTCS YG EA   +G   G WLTL R++KC+P 
Sbjct: 1   MKQIFIGIIRFYQKFISPMTPPTCRFYPTCSHYGLEAFQTHGALKGFWLTLKRILKCHPF 60

Query: 115 GSDGFDPVPDDLPPK 129
              GFDPVPD    K
Sbjct: 61  HPGGFDPVPDKKDDK 75


>gi|109900611|ref|YP_663866.1| hypothetical protein Patl_4313 [Pseudoalteromonas atlantica T6c]
 gi|109702892|gb|ABG42812.1| protein of unknown function DUF37 [Pseudoalteromonas atlantica T6c]
          Length = 84

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 38/76 (50%), Positives = 52/76 (68%)

Query: 56  RLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLG 115
           R I IG+IR+YQL  S + G +CR+ PTCS Y  EAI ++G+ IG WL++ R++KC+PL 
Sbjct: 9   RKIPIGLIRLYQLWLSPMLGQNCRFHPTCSYYAIEAIKQHGIIIGGWLSIKRILKCHPLH 68

Query: 116 SDGFDPVPDDLPPKKN 131
           S G D VPD     K+
Sbjct: 69  SGGIDLVPDKKKQNKH 84


>gi|300774238|ref|ZP_07084105.1| possible alpha-hemolysin [Sphingobacterium spiritivorum ATCC 33861]
 gi|300758917|gb|EFK55746.1| possible alpha-hemolysin [Sphingobacterium spiritivorum ATCC 33861]
          Length = 84

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 38/75 (50%), Positives = 48/75 (64%)

Query: 49  KFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRL 108
           K  K   R   I +IR YQL  S + G +CRY PTCS+YG EAI +YG + G WL + R+
Sbjct: 10  KIIKGALRFFFILLIRFYQLFISPLLGANCRYTPTCSQYGMEAIKKYGPFKGGWLAIKRI 69

Query: 109 IKCNPLGSDGFDPVP 123
           ++CNP G  G DPVP
Sbjct: 70  LRCNPWGGHGHDPVP 84


>gi|152985718|ref|YP_001348602.1| hypothetical protein PSPA7_3242 [Pseudomonas aeruginosa PA7]
 gi|150960876|gb|ABR82901.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7]
          Length = 99

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 30/70 (42%), Positives = 43/70 (61%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + IG+IR YQ + S + G  CR+ P+CS Y  EAI  +G   G +L   RL++C+P 
Sbjct: 14  MKFLLIGLIRFYQYVISPLIGPRCRFYPSCSHYTLEAIRTHGALRGGYLGARRLLRCHPW 73

Query: 115 GSDGFDPVPD 124
              GFDPVP+
Sbjct: 74  HPGGFDPVPE 83


>gi|294852341|ref|ZP_06793014.1| hypothetical protein BAZG_01263 [Brucella sp. NVSL 07-0026]
 gi|294820930|gb|EFG37929.1| hypothetical protein BAZG_01263 [Brucella sp. NVSL 07-0026]
          Length = 115

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 50/88 (56%), Positives = 64/88 (72%)

Query: 41  PKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIG 100
           P SRN+   + KT GRL G  +IR YQ+  S++ GNSCR+LPTCSEY YEAIAR+GLW G
Sbjct: 8   PYSRNFTDPWRKTPGRLFGTALIRFYQITLSSLIGNSCRHLPTCSEYAYEAIARHGLWRG 67

Query: 101 SWLTLLRLIKCNPLGSDGFDPVPDDLPP 128
            W+   R+++C P G+ GFDPVP +L P
Sbjct: 68  GWMGFFRVVRCGPFGTHGFDPVPRELSP 95


>gi|90417793|ref|ZP_01225705.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337465|gb|EAS51116.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 113

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 44/89 (49%), Positives = 64/89 (71%)

Query: 41  PKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIG 100
              RN++G +  T GR +G+G++R+YQL  S + G+ CR+LPTCSEY YEA+AR+GLW G
Sbjct: 4   AAGRNYSGPWRATPGRYLGLGLVRLYQLTLSPLIGSHCRHLPTCSEYAYEAVARHGLWSG 63

Query: 101 SWLTLLRLIKCNPLGSDGFDPVPDDLPPK 129
            WL++ R+ +C P G+ G D VP+ LP +
Sbjct: 64  GWLSVFRVGRCGPFGTSGIDNVPEALPAR 92


>gi|15965175|ref|NP_385528.1| hypothetical protein SMc01007 [Sinorhizobium meliloti 1021]
 gi|307309189|ref|ZP_07588860.1| protein of unknown function DUF37 [Sinorhizobium meliloti BL225C]
 gi|307321519|ref|ZP_07600914.1| protein of unknown function DUF37 [Sinorhizobium meliloti AK83]
 gi|29428234|sp|Q92QB2|Y1422_RHIME RecName: Full=UPF0161 protein R01422
 gi|15074355|emb|CAC46001.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
 gi|306892826|gb|EFN23617.1| protein of unknown function DUF37 [Sinorhizobium meliloti AK83]
 gi|306900335|gb|EFN30951.1| protein of unknown function DUF37 [Sinorhizobium meliloti BL225C]
          Length = 124

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 57/92 (61%), Positives = 70/92 (76%)

Query: 40  TPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWI 99
               RNW+G F KT GRL+G+ +IR YQL  S+  GNSCR+LPTCSEYG+EAIARYGLW 
Sbjct: 18  AAGGRNWSGPFRKTPGRLVGMTLIRAYQLTLSSFIGNSCRHLPTCSEYGFEAIARYGLWA 77

Query: 100 GSWLTLLRLIKCNPLGSDGFDPVPDDLPPKKN 131
           G WLTL R+++C P G+ GFDPVPD L P++ 
Sbjct: 78  GGWLTLFRVVRCGPGGTHGFDPVPDSLAPRQR 109


>gi|297248389|ref|ZP_06932107.1| conserved hypothetical protein [Brucella abortus bv. 5 str. B3196]
 gi|297175558|gb|EFH34905.1| conserved hypothetical protein [Brucella abortus bv. 5 str. B3196]
          Length = 141

 Score =  118 bits (295), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 50/88 (56%), Positives = 64/88 (72%)

Query: 41  PKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIG 100
           P SRN+   + KT GRL G  +IR YQ+  S++ GNSCR+LPTCSEY YEAIAR+GLW G
Sbjct: 34  PYSRNFTDPWRKTPGRLFGTALIRFYQITLSSLIGNSCRHLPTCSEYAYEAIARHGLWRG 93

Query: 101 SWLTLLRLIKCNPLGSDGFDPVPDDLPP 128
            W+   R+++C P G+ GFDPVP +L P
Sbjct: 94  GWMGFFRVVRCGPFGTHGFDPVPRELSP 121


>gi|325293130|ref|YP_004278994.1| hypothetical protein AGROH133_06708 [Agrobacterium sp. H13-3]
 gi|325060983|gb|ADY64674.1| hypothetical protein AGROH133_06708 [Agrobacterium sp. H13-3]
          Length = 119

 Score =  118 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 58/105 (55%), Positives = 70/105 (66%), Gaps = 4/105 (3%)

Query: 31  GSPLLLKNNTP----KSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSE 86
           G P      T     +SRNW G F KT GRL G+G IR+YQL  S   GNSCR++PTCSE
Sbjct: 3   GEPDCGHQKTGEKVGRSRNWGGVFAKTPGRLFGVGFIRLYQLTLSGFVGNSCRHIPTCSE 62

Query: 87  YGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVPDDLPPKKN 131
           YGYEAIAR+GLW G W+TL R+ +C P G+ G DPVP+ L   K+
Sbjct: 63  YGYEAIARHGLWPGGWMTLFRVARCGPGGTSGLDPVPETLAADKH 107


>gi|222086052|ref|YP_002544584.1| hypothetical protein Arad_2474 [Agrobacterium radiobacter K84]
 gi|221723500|gb|ACM26656.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 142

 Score =  118 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 53/104 (50%), Positives = 72/104 (69%), Gaps = 1/104 (0%)

Query: 27  IQKKGSPLLLKNNTP-KSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCS 85
             ++G      N  P  SRN++G F KT  RL G+G+IR+YQL  S+  GNSCR++PTCS
Sbjct: 22  GLRRGETASRDNAKPLHSRNYSGPFRKTPDRLFGMGLIRLYQLTLSSFIGNSCRHIPTCS 81

Query: 86  EYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVPDDLPPK 129
           EYGYE++AR+GLW G W+TL R+ +C P G+ G DPVP+ L  +
Sbjct: 82  EYGYESVARHGLWAGGWMTLFRVARCGPGGTSGLDPVPEALENR 125


>gi|190891878|ref|YP_001978420.1| hypothetical protein RHECIAT_CH0002287 [Rhizobium etli CIAT 652]
 gi|190697157|gb|ACE91242.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 134

 Score =  118 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 53/96 (55%), Positives = 69/96 (71%)

Query: 31  GSPLLLKNNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYE 90
           GS    K +   SRN+ G F KT  RL+G+G+IR+YQL  S   GNSCR++PTCSEYGYE
Sbjct: 19  GSSQPRKRSARYSRNYTGAFRKTPDRLLGMGLIRLYQLTLSGFVGNSCRHIPTCSEYGYE 78

Query: 91  AIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVPDDL 126
           ++AR+GLW G W+TL R+ +C P G+ G DPVP+ L
Sbjct: 79  SVARHGLWAGGWMTLFRVSRCGPGGTSGLDPVPETL 114


>gi|163942525|ref|YP_001647409.1| hypothetical protein BcerKBAB4_4627 [Bacillus weihenstephanensis
           KBAB4]
 gi|226706211|sp|A9VLF7|Y4627_BACWK RecName: Full=UPF0161 protein BcerKBAB4_4627
 gi|163864722|gb|ABY45781.1| protein of unknown function DUF37 [Bacillus weihenstephanensis
           KBAB4]
          Length = 78

 Score =  117 bits (294), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 37/78 (47%), Positives = 48/78 (61%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I IGIIR YQ   S +   +CR+ PTCS YG EA  ++G + G WLT  R++KC+P 
Sbjct: 1   MKQIFIGIIRFYQKFISPMTPPTCRFYPTCSHYGLEAFQKHGTFKGFWLTCKRILKCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              GFDPVPD    K N+
Sbjct: 61  HPGGFDPVPDKKDDKVNS 78


>gi|110633360|ref|YP_673568.1| hypothetical protein Meso_1006 [Mesorhizobium sp. BNC1]
 gi|116256128|sp|Q11JM2|Y1006_MESSB RecName: Full=UPF0161 protein Meso_1006
 gi|110284344|gb|ABG62403.1| protein of unknown function DUF37 [Chelativorans sp. BNC1]
          Length = 108

 Score =  117 bits (294), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 50/88 (56%), Positives = 64/88 (72%)

Query: 42  KSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGS 101
            SRNW+G +PKT GR++G   +R+YQL  S   GNSCR+ PTCSEY YEAIAR+GLW G 
Sbjct: 7   YSRNWSGPWPKTPGRVLGTAFVRLYQLTLSGFIGNSCRHFPTCSEYAYEAIARHGLWAGG 66

Query: 102 WLTLLRLIKCNPLGSDGFDPVPDDLPPK 129
           W+ L R++ C P G+ G DPVP+ L P+
Sbjct: 67  WMGLFRVMHCGPGGTHGIDPVPEILQPR 94


>gi|51598231|ref|YP_072422.1| hypothetical protein YPTB3947 [Yersinia pseudotuberculosis IP
           32953]
 gi|108810136|ref|YP_654052.1| hypothetical protein YPA_4146 [Yersinia pestis Antiqua]
 gi|108814118|ref|YP_649885.1| hypothetical protein YPN_3958 [Yersinia pestis Nepal516]
 gi|145601171|ref|YP_001165247.1| hypothetical protein YPDSF_3933 [Yersinia pestis Pestoides F]
 gi|170026451|ref|YP_001722956.1| hypothetical protein YPK_4247 [Yersinia pseudotuberculosis YPIII]
 gi|186897491|ref|YP_001874603.1| hypothetical protein YPTS_4203 [Yersinia pseudotuberculosis PB1/+]
 gi|229839808|ref|ZP_04459967.1| YidD [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229841893|ref|ZP_04462049.1| YidD [Yersinia pestis biovar Orientalis str. India 195]
 gi|229896770|ref|ZP_04511933.1| YidD [Yersinia pestis Pestoides A]
 gi|229904658|ref|ZP_04519769.1| YidD [Yersinia pestis Nepal516]
 gi|47606245|sp|P61475|Y4101_YERPE RecName: Full=UPF0161 protein YPO4101.1/y4115.1/YP_4008
 gi|81638081|sp|Q663S8|Y3947_YERPS RecName: Full=UPF0161 protein YPTB3947
 gi|122382411|sp|Q1C0B5|Y4146_YERPA RecName: Full=UPF0161 protein YPA_4146
 gi|122383980|sp|Q1CCJ5|Y3958_YERPN RecName: Full=UPF0161 protein YPN_3958
 gi|166201484|sp|A4TSL2|Y3933_YERPP RecName: Full=UPF0161 protein YPDSF_3933
 gi|226706144|sp|B2K870|Y4203_YERPB RecName: Full=UPF0161 protein YPTS_4203
 gi|226706151|sp|B1JRQ3|Y4247_YERPY RecName: Full=UPF0161 protein YPK_4247
 gi|51591513|emb|CAH23185.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP
           32953]
 gi|108777766|gb|ABG20285.1| Protein of unknown function DUF37 [Yersinia pestis Nepal516]
 gi|108782049|gb|ABG16107.1| Protein of unknown function DUF37 [Yersinia pestis Antiqua]
 gi|145212867|gb|ABP42274.1| Protein of unknown function DUF37 [Yersinia pestis Pestoides F]
 gi|169752985|gb|ACA70503.1| protein of unknown function DUF37 [Yersinia pseudotuberculosis
           YPIII]
 gi|186700517|gb|ACC91146.1| protein of unknown function DUF37 [Yersinia pseudotuberculosis
           PB1/+]
 gi|229678776|gb|EEO74881.1| YidD [Yersinia pestis Nepal516]
 gi|229691232|gb|EEO83285.1| YidD [Yersinia pestis biovar Orientalis str. India 195]
 gi|229696174|gb|EEO86221.1| YidD [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229700208|gb|EEO88244.1| YidD [Yersinia pestis Pestoides A]
 gi|320017431|gb|ADW01003.1| YidD [Yersinia pestis biovar Medievalis str. Harbin 35]
          Length = 85

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 42/82 (51%), Positives = 55/82 (67%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
           P + G  I IG+IR YQL+ S + G  CR+ PTCS YG EA+ R+G+  GSWLTL R++K
Sbjct: 4   PLSPGSRILIGLIRGYQLVISPLLGPRCRFHPTCSHYGIEALRRFGMIKGSWLTLKRVLK 63

Query: 111 CNPLGSDGFDPVPDDLPPKKNN 132
           C+PL S G DPVP  L   + +
Sbjct: 64  CHPLNSGGDDPVPPKLDDNREH 85


>gi|327188323|gb|EGE55541.1| hypothetical protein RHECNPAF_910016 [Rhizobium etli CNPAF512]
          Length = 134

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 53/96 (55%), Positives = 69/96 (71%)

Query: 31  GSPLLLKNNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYE 90
           GS    K +   SRN+ G F KT  RL+G+G+IR+YQL  S   GNSCR++PTCSEYGYE
Sbjct: 19  GSSQPRKRSARYSRNYTGAFRKTPDRLLGMGLIRLYQLALSGFVGNSCRHIPTCSEYGYE 78

Query: 91  AIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVPDDL 126
           ++AR+GLW G W+TL R+ +C P G+ G DPVP+ L
Sbjct: 79  SVARHGLWAGGWMTLFRVSRCGPGGTSGLDPVPETL 114


>gi|37528713|ref|NP_932058.1| hypothetical protein plu4907 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|47606255|sp|Q7MXZ3|Y4907_PHOLL RecName: Full=UPF0161 protein plu4907
 gi|36788152|emb|CAE17279.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 86

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 38/82 (46%), Positives = 53/82 (64%), Gaps = 3/82 (3%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           + G    I +IR YQL+ S + G  CR+ PTCS+YG EA+ R+G+  G WLT+ R++KC+
Sbjct: 6   SFGSRFLIALIRGYQLVISPLLGPRCRFNPTCSQYGIEALRRFGVIKGCWLTVKRVLKCH 65

Query: 113 PLGSDGFDPVPDDLPPKKNNPK 134
           PL   G DPVP   P K N+ +
Sbjct: 66  PLHEGGDDPVP---PVKNNDNR 84


>gi|47565228|ref|ZP_00236271.1| conserved hypothetical protein protein TIGR00278 [Bacillus cereus
           G9241]
 gi|47558014|gb|EAL16339.1| conserved hypothetical protein protein TIGR00278 [Bacillus cereus
           G9241]
          Length = 78

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 47/78 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I +GIIR YQ   S +   +CR+ PTCS YG EA  ++G   G WLT  R++KC+P 
Sbjct: 1   MKQIFMGIIRFYQKFISPMTPPTCRFYPTCSHYGLEAFQKHGALKGFWLTCKRILKCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              GFDPVPD    K N+
Sbjct: 61  HPGGFDPVPDKKDDKVNS 78


>gi|116049995|ref|YP_791194.1| hypothetical protein PA14_38060 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|296389544|ref|ZP_06879019.1| hypothetical protein PaerPAb_15401 [Pseudomonas aeruginosa PAb1]
 gi|313111136|ref|ZP_07796961.1| hypothetical protein PA39016_003020003 [Pseudomonas aeruginosa
           39016]
 gi|122259110|sp|Q02LJ2|Y3806_PSEAB RecName: Full=UPF0161 protein PA14_38060
 gi|115585216|gb|ABJ11231.1| conserved hypothetical protein [Pseudomonas aeruginosa UCBPP-PA14]
 gi|310883463|gb|EFQ42057.1| hypothetical protein PA39016_003020003 [Pseudomonas aeruginosa
           39016]
          Length = 86

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 42/70 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + IG+IR YQ   S + G  CR+ P+CS Y  EAI  +G   G +L   RL++C+P 
Sbjct: 1   MKFLLIGLIRFYQYAISPLIGPRCRFYPSCSHYTLEAIRVHGALRGGYLGARRLLRCHPW 60

Query: 115 GSDGFDPVPD 124
              G+DPVP+
Sbjct: 61  HPGGYDPVPE 70


>gi|88800331|ref|ZP_01115897.1| hypothetical protein MED297_00475 [Reinekea sp. MED297]
 gi|88776908|gb|EAR08117.1| hypothetical protein MED297_00475 [Reinekea sp. MED297]
          Length = 86

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 48/80 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I IG+++ Y+ + S + G  CR+ PTCSEY   A+  +G   GSWL + R+ +C+P 
Sbjct: 1   MKWILIGLVQFYRWVISPMLGPRCRFYPTCSEYALIALKHHGALKGSWLAMKRIARCHPG 60

Query: 115 GSDGFDPVPDDLPPKKNNPK 134
              GFDPVP   PP  ++ +
Sbjct: 61  CEGGFDPVPGTEPPTDDSTE 80


>gi|294101694|ref|YP_003553552.1| protein of unknown function DUF37 [Aminobacterium colombiense DSM
           12261]
 gi|293616674|gb|ADE56828.1| protein of unknown function DUF37 [Aminobacterium colombiense DSM
           12261]
          Length = 86

 Score =  117 bits (293), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 37/78 (47%), Positives = 51/78 (65%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
           I +  IR YQ   S + G +CR+ PTCS+Y  EAI  +G+ IGSWL L+R++KC P    
Sbjct: 5   IAVTAIRFYQKWISPMLGKNCRFYPTCSQYTLEAIEMHGILIGSWLGLIRIMKCGPWHPG 64

Query: 118 GFDPVPDDLPPKKNNPKL 135
           G+DPVPD    +K +PK+
Sbjct: 65  GYDPVPDFPLKRKISPKI 82


>gi|145634175|ref|ZP_01789886.1| hypothetical protein CGSHiAA_09025 [Haemophilus influenzae PittAA]
 gi|145268619|gb|EDK08612.1| hypothetical protein CGSHiAA_09025 [Haemophilus influenzae PittAA]
          Length = 86

 Score =  117 bits (293), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 41/84 (48%), Positives = 54/84 (64%), Gaps = 3/84 (3%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
             + G  I I IIR+YQ++ S   G  CR++PTCS YG EA+  +GL  G WLTL R++K
Sbjct: 4   THSFGTKILIKIIRLYQIMISPFIGARCRFVPTCSCYGIEALKTHGLLKGGWLTLKRVLK 63

Query: 111 CNPLGSDGFDPVPDDLPPKKNNPK 134
           C+PL + GFDPVP   P   NN +
Sbjct: 64  CHPLNAGGFDPVP---PKTNNNDE 84


>gi|239993747|ref|ZP_04714271.1| hypothetical protein AmacA2_04596 [Alteromonas macleodii ATCC
           27126]
          Length = 82

 Score =  117 bits (293), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 49/82 (59%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            + L   + + +I+ YQ   S + G  CR+ P+CS Y  +A+  +GL  G WL++ R++K
Sbjct: 1   MRQLLIAVPLALIKFYQWFISPMLGQRCRFHPSCSWYAIDALKTHGLVKGGWLSIKRILK 60

Query: 111 CNPLGSDGFDPVPDDLPPKKNN 132
           C+PL + G+DPVP+    K + 
Sbjct: 61  CHPLHAGGYDPVPEKQQDKHSK 82


>gi|154253108|ref|YP_001413932.1| hypothetical protein Plav_2667 [Parvibaculum lavamentivorans DS-1]
 gi|154157058|gb|ABS64275.1| protein of unknown function DUF37 [Parvibaculum lavamentivorans
           DS-1]
          Length = 104

 Score =  117 bits (293), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 38/76 (50%), Positives = 49/76 (64%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            +    LI  G+IR YQ   S + G  CR+LPTCS+Y  +AI R+G W G WL L R+ +
Sbjct: 2   RRDPLSLIMRGLIRFYQWFISPLIGPKCRHLPTCSDYTMQAIERHGAWRGGWLGLARIAR 61

Query: 111 CNPLGSDGFDPVPDDL 126
           C+P GS GFDPVP+ L
Sbjct: 62  CHPWGSHGFDPVPERL 77


>gi|225852574|ref|YP_002732807.1| hypothetical protein BMEA_A1114 [Brucella melitensis ATCC 23457]
 gi|225640939|gb|ACO00853.1| conserved hypothetical protein [Brucella melitensis ATCC 23457]
          Length = 159

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 50/88 (56%), Positives = 64/88 (72%)

Query: 41  PKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIG 100
           P SRN+   + KT GRL G  +IR YQ+  S++ GNSCR+LPTCSEY YEAIAR+GLW G
Sbjct: 52  PYSRNFTDPWRKTPGRLFGTALIRFYQITLSSLIGNSCRHLPTCSEYAYEAIARHGLWRG 111

Query: 101 SWLTLLRLIKCNPLGSDGFDPVPDDLPP 128
            W+   R+++C P G+ GFDPVP +L P
Sbjct: 112 GWMGFFRVVRCGPFGTHGFDPVPRELSP 139


>gi|161619023|ref|YP_001592910.1| hypothetical protein BCAN_A1088 [Brucella canis ATCC 23365]
 gi|161335834|gb|ABX62139.1| conserved hypothetical protein [Brucella canis ATCC 23365]
          Length = 159

 Score =  116 bits (292), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 50/88 (56%), Positives = 64/88 (72%)

Query: 41  PKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIG 100
           P SRN+   + KT GRL G  +IR YQ+  S++ GNSCR+LPTCSEY YEAIAR+GLW G
Sbjct: 52  PYSRNFTDPWRKTPGRLFGTALIRFYQITLSSLIGNSCRHLPTCSEYAYEAIARHGLWRG 111

Query: 101 SWLTLLRLIKCNPLGSDGFDPVPDDLPP 128
            W+   R+++C P G+ GFDPVP +L P
Sbjct: 112 GWMGFFRVVRCGPFGTHGFDPVPRELSP 139


>gi|42783993|ref|NP_981240.1| hypothetical protein BCE_4947 [Bacillus cereus ATCC 10987]
 gi|49478762|ref|YP_038838.1| hypothetical protein BT9727_4526 [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|206978339|ref|ZP_03239214.1| conserved hypothetical protein TIGR00278 [Bacillus cereus H3081.97]
 gi|217962284|ref|YP_002340854.1| hypothetical protein BCAH187_A4932 [Bacillus cereus AH187]
 gi|222098265|ref|YP_002532322.1| hypothetical protein BCQ_4607 [Bacillus cereus Q1]
 gi|47606234|sp|P61464|Y4947_BACC1 RecName: Full=UPF0161 protein BCE_4947
 gi|81394500|sp|Q6HC88|Y4526_BACHK RecName: Full=UPF0161 protein BT9727_4526
 gi|226707637|sp|B7HTQ3|Y4932_BACC7 RecName: Full=UPF0161 protein BCAH187_A4932
 gi|254803932|sp|B9J290|Y4607_BACCQ RecName: Full=UPF0161 protein BCQ_4607
 gi|42739923|gb|AAS43848.1| conserved hypothetical protein TIGR00278 [Bacillus cereus ATCC
           10987]
 gi|49330318|gb|AAT60964.1| conserved hypothetical protein, possible alpha-hemolysin [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|206743470|gb|EDZ54902.1| conserved hypothetical protein TIGR00278 [Bacillus cereus H3081.97]
 gi|217065956|gb|ACJ80206.1| conserved hypothetical protein TIGR00278 [Bacillus cereus AH187]
 gi|221242323|gb|ACM15033.1| conserved hypothetical protein [Bacillus cereus Q1]
 gi|324328696|gb|ADY23956.1| hypothetical protein YBT020_23640 [Bacillus thuringiensis serovar
           finitimus YBT-020]
          Length = 78

 Score =  116 bits (292), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 47/78 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I IGIIR YQ   S +   +CR+ PTCS YG EA  ++G   G WLT  R++KC+P 
Sbjct: 1   MKQIFIGIIRFYQKFISPMTPPTCRFYPTCSHYGLEAFQKHGALKGFWLTCKRILKCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              GFDPVPD    K ++
Sbjct: 61  HPGGFDPVPDKKDDKVHS 78


>gi|145632385|ref|ZP_01788120.1| hypothetical protein CGSHi3655_08019 [Haemophilus influenzae 3655]
 gi|144987292|gb|EDJ93822.1| hypothetical protein CGSHi3655_08019 [Haemophilus influenzae 3655]
          Length = 80

 Score =  116 bits (292), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 39/75 (52%), Positives = 51/75 (68%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
             +LG  I I IIR+YQ++ S   G  CR++PTCS YG EA+  +GL  G WLTL R++K
Sbjct: 4   THSLGTKILIKIIRLYQIMISPFIGARCRFVPTCSCYGIEALKTHGLLKGGWLTLKRVLK 63

Query: 111 CNPLGSDGFDPVPDD 125
           C+PL + GFDPVP  
Sbjct: 64  CHPLNAGGFDPVPPK 78


>gi|49073784|gb|AAT49354.1| PA2045 [synthetic construct]
          Length = 87

 Score =  116 bits (292), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 42/70 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + IG+IR YQ   S + G  CR+ P+CS Y  EAI  +G   G +L   RL++C+P 
Sbjct: 1   MKFLLIGLIRFYQYAISPLIGPRCRFYPSCSHYTLEAIRVHGALRGGYLGARRLLRCHPW 60

Query: 115 GSDGFDPVPD 124
              G+DPVP+
Sbjct: 61  HPGGYDPVPE 70


>gi|229543443|ref|ZP_04432503.1| protein of unknown function DUF37 [Bacillus coagulans 36D1]
 gi|229327863|gb|EEN93538.1| protein of unknown function DUF37 [Bacillus coagulans 36D1]
          Length = 78

 Score =  116 bits (292), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 37/78 (47%), Positives = 52/78 (66%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + I I +IR YQL  S +F  SCR+ PTCS YG EA+ R+G   G +L + R++KC+P
Sbjct: 1   MLKFIFIKLIRFYQLAISPLFPPSCRFQPTCSNYGLEAVKRFGALRGGYLAIRRILKCHP 60

Query: 114 LGSDGFDPVPDDLPPKKN 131
             + G+DPVPD  P KK+
Sbjct: 61  FHAGGYDPVPDQWPVKKH 78


>gi|15597241|ref|NP_250735.1| hypothetical protein PA2045 [Pseudomonas aeruginosa PAO1]
 gi|107101472|ref|ZP_01365390.1| hypothetical protein PaerPA_01002514 [Pseudomonas aeruginosa PACS2]
 gi|218891999|ref|YP_002440866.1| hypothetical protein PLES_32771 [Pseudomonas aeruginosa LESB58]
 gi|254240479|ref|ZP_04933801.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|14286080|sp|Q9I270|Y2045_PSEAE RecName: Full=UPF0161 protein PA2045
 gi|226703772|sp|B7VA59|Y3277_PSEA8 RecName: Full=UPF0161 protein PLES_32771
 gi|9948052|gb|AAG05433.1|AE004631_2 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|126193857|gb|EAZ57920.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|218772225|emb|CAW28004.1| conserved hypothetical protein [Pseudomonas aeruginosa LESB58]
          Length = 86

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 42/70 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + IG+IR YQ   S + G  CR+ P+CS Y  EAI  +G   G +L   RL++C+P 
Sbjct: 1   MKFLLIGLIRFYQYAISPLIGPRCRFYPSCSHYTLEAIRVHGALRGGYLGARRLLRCHPW 60

Query: 115 GSDGFDPVPD 124
              G+DPVP+
Sbjct: 61  HPGGYDPVPE 70


>gi|13471049|ref|NP_102618.1| hypothetical protein mll0918 [Mesorhizobium loti MAFF303099]
 gi|14021793|dbj|BAB48404.1| mll0918 [Mesorhizobium loti MAFF303099]
          Length = 153

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 45/89 (50%), Positives = 59/89 (66%)

Query: 36  LKNNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARY 95
                 + RNW G + KT GRL+G   +R+YQL  S   GNSCR+LPTCSEY +EAIAR+
Sbjct: 39  TVRPPGRGRNWPGPWRKTPGRLLGTSFVRLYQLTLSGFVGNSCRHLPTCSEYAHEAIARH 98

Query: 96  GLWIGSWLTLLRLIKCNPLGSDGFDPVPD 124
           GLW G W+   R+++C P G+ G D VP+
Sbjct: 99  GLWAGGWMGFFRVLRCGPFGTHGIDLVPE 127


>gi|163843339|ref|YP_001627743.1| hypothetical protein BSUIS_A1117 [Brucella suis ATCC 23445]
 gi|163674062|gb|ABY38173.1| conserved hypothetical protein [Brucella suis ATCC 23445]
          Length = 159

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 49/88 (55%), Positives = 64/88 (72%)

Query: 41  PKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIG 100
           P SRN+   + KT GRL G  +IR YQ+  S++ GNSCR+LPTCSEY +EAIAR+GLW G
Sbjct: 52  PYSRNFTDPWRKTPGRLFGTALIRFYQITLSSLIGNSCRHLPTCSEYAHEAIARHGLWRG 111

Query: 101 SWLTLLRLIKCNPLGSDGFDPVPDDLPP 128
            W+   R+++C P G+ GFDPVP +L P
Sbjct: 112 GWMGFFRVVRCGPFGTHGFDPVPRELSP 139


>gi|197286947|ref|YP_002152819.1| hypothetical protein PMI3129 [Proteus mirabilis HI4320]
 gi|141374|sp|P22834|YIDD_PROMI RecName: Full=UPF0161 protein in rnpA 3'region
 gi|226703719|sp|B4F0U2|Y3129_PROMH RecName: Full=UPF0161 protein PMI3129
 gi|150875|gb|AAA83955.1| ORF2; 9 kDa protein; putative [Proteus mirabilis]
 gi|194684434|emb|CAR46146.1| conserved hypothetical protein [Proteus mirabilis HI4320]
          Length = 86

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 54/80 (67%), Gaps = 4/80 (5%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           +LG  I I +IR YQL  S + G  CR+ PTCS YG EA+ R+G+  GSWLT+ R++KC+
Sbjct: 6   SLGSKILILLIRGYQLGISPLLGPRCRFNPTCSHYGIEALRRFGMIKGSWLTVKRILKCH 65

Query: 113 PLGSDGFDPVPDDLPPKKNN 132
           PL   G DPVP    P+KN+
Sbjct: 66  PLHEGGDDPVP----PRKND 81


>gi|308174742|ref|YP_003921447.1| hypothetical protein BAMF_2851 [Bacillus amyloliquefaciens DSM 7]
 gi|307607606|emb|CBI43977.1| conserved hypothetical protein [Bacillus amyloliquefaciens DSM 7]
 gi|328554674|gb|AEB25166.1| hypothetical protein BAMTA208_15035 [Bacillus amyloliquefaciens
           TA208]
 gi|328913082|gb|AEB64678.1| hypothetical protein LL3_03147 [Bacillus amyloliquefaciens LL3]
          Length = 75

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 44/74 (59%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I +IR YQ   S +   SCR+ PTCS+YG EA+  +G   G WLTL R+++C+P 
Sbjct: 1   MKTIMIALIRGYQKFISPLTPPSCRFYPTCSQYGIEAVKTHGALKGGWLTLKRILRCHPF 60

Query: 115 GSDGFDPVPDDLPP 128
              G DPVP+    
Sbjct: 61  HPGGVDPVPEKKQK 74


>gi|332995878|gb|AEF05933.1| hypothetical protein ambt_22240 [Alteromonas sp. SN2]
          Length = 82

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 48/75 (64%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
           I + +I++YQ   S + G  CR+ P+CS Y  EA+  +GL  G WL++ R+++C+PL + 
Sbjct: 8   IPLILIKLYQWFISPILGQRCRFHPSCSWYAIEALKTHGLVKGGWLSIKRILRCHPLHAG 67

Query: 118 GFDPVPDDLPPKKNN 132
           G+DPVP+    K + 
Sbjct: 68  GYDPVPEKQQDKHSK 82


>gi|294781808|ref|ZP_06747141.1| alpha-hemolysin [Fusobacterium sp. 1_1_41FAA]
 gi|294481918|gb|EFG29686.1| alpha-hemolysin [Fusobacterium sp. 1_1_41FAA]
          Length = 82

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 33/85 (38%), Positives = 49/85 (57%), Gaps = 3/85 (3%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I +IR YQ   S +F   CRY PTCS+Y  EAI  YG   G++L + R+++C+P 
Sbjct: 1   MKKIFILLIRFYQKFISPLFPAKCRYYPTCSQYTLEAIQEYGAIKGTYLGIKRILRCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNNPKLLSKK 139
              G+DPVP     K+ + +   K+
Sbjct: 61  HEGGYDPVP---KRKREDSEEKEKE 82


>gi|319783889|ref|YP_004143365.1| hypothetical protein Mesci_4204 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317169777|gb|ADV13315.1| protein of unknown function DUF37 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 124

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 46/85 (54%), Positives = 61/85 (71%)

Query: 42  KSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGS 101
           + RNW G + KT GRL+G  ++R+YQL  S   GNSCR+LPTCSEY +EAIAR+GLW G 
Sbjct: 16  RGRNWPGPWRKTPGRLLGTSLVRLYQLTLSGFVGNSCRHLPTCSEYAHEAIARHGLWAGG 75

Query: 102 WLTLLRLIKCNPLGSDGFDPVPDDL 126
           W+   R+++C P G+ G D VP+ L
Sbjct: 76  WMGFFRVLRCGPFGTHGIDLVPEAL 100


>gi|81428729|ref|YP_395729.1| hypothetical protein LSA1120 [Lactobacillus sakei subsp. sakei 23K]
 gi|116256131|sp|Q38WL1|Y1120_LACSS RecName: Full=UPF0161 protein LCA_1120
 gi|78610371|emb|CAI55421.1| Hypothetical protein LCA_1120 [Lactobacillus sakei subsp. sakei
           23K]
          Length = 82

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 43/78 (55%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R I I ++R YQ   S     SCRY PTCS Y  +AI ++G   G  + + R+++C+P 
Sbjct: 1   MRKILIALVRFYQTGISPFLPPSCRYYPTCSSYMIQAIQKHGAIKGLAMGIGRILRCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G+DPVPD     +N 
Sbjct: 61  IKGGYDPVPDHFTVFRNK 78


>gi|262066865|ref|ZP_06026477.1| putative toxin-antitoxin system, toxin component [Fusobacterium
           periodonticum ATCC 33693]
 gi|291379416|gb|EFE86934.1| putative toxin-antitoxin system, toxin component [Fusobacterium
           periodonticum ATCC 33693]
          Length = 82

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 31/70 (44%), Positives = 43/70 (61%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I +IR YQ   S +F   CRY PTCS+Y  EAI  YG   G++L + R+++C+P 
Sbjct: 1   MKKIFILLIRFYQKFISPLFPAKCRYYPTCSQYTLEAIQEYGAIKGTYLGIKRILRCHPF 60

Query: 115 GSDGFDPVPD 124
              G+DPVP 
Sbjct: 61  HEGGYDPVPK 70


>gi|145301205|ref|YP_001144046.1| hypothetical protein ASA_4383 [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|166227255|sp|A4STS6|Y4383_AERS4 RecName: Full=UPF0161 protein ASA_4383
 gi|142853977|gb|ABO92298.1| conserved hypothetical protein [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 82

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 50/79 (63%), Gaps = 2/79 (2%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           T  + + + +IR+YQLI S + G  CR+ PTCS++  EAI  +G   G WL   RL+KC+
Sbjct: 6   TPLQWVAVKLIRLYQLIISPLLGQRCRFTPTCSQFAIEAIRLHGFIKGVWLASKRLLKCH 65

Query: 113 PLGSDGFDPVPDDLPPKKN 131
           PL   G+DPVP   P ++N
Sbjct: 66  PLSEGGYDPVPQ--PKRRN 82


>gi|260553775|ref|ZP_05826045.1| UPF0161 protein [Acinetobacter sp. RUH2624]
 gi|260405079|gb|EEW98579.1| UPF0161 protein [Acinetobacter sp. RUH2624]
          Length = 106

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 42/69 (60%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            I    IR+YQ+  S + G  CRY+PTCS+Y  EA+  +G   G WL+  R+ +C+P G 
Sbjct: 3   RILRWFIRLYQIAISPLLGPRCRYIPTCSQYAIEALQTHGAIKGVWLSSKRICRCHPWGG 62

Query: 117 DGFDPVPDD 125
            G+DPVP  
Sbjct: 63  SGYDPVPPK 71


>gi|298373589|ref|ZP_06983578.1| toxin-antitoxin system,toxin component [Bacteroidetes oral taxon
           274 str. F0058]
 gi|298274641|gb|EFI16193.1| toxin-antitoxin system,toxin component [Bacteroidetes oral taxon
           274 str. F0058]
          Length = 74

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 33/74 (44%), Positives = 47/74 (63%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            K + R + I  I  YQ   S +  +SCRY+PTCS+Y  EAI ++G   G WL + R+++
Sbjct: 1   MKKIIRQLLILPIIFYQKAISPMLPSSCRYVPTCSQYAIEAIRKHGAVRGLWLAVRRILR 60

Query: 111 CNPLGSDGFDPVPD 124
           C+P G  G+DPVPD
Sbjct: 61  CHPWGGHGYDPVPD 74


>gi|114320667|ref|YP_742350.1| hypothetical protein Mlg_1511 [Alkalilimnicola ehrlichii MLHE-1]
 gi|114227061|gb|ABI56860.1| protein of unknown function DUF37 [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 123

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 32/73 (43%), Positives = 43/73 (58%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            K    L+ IG++R+YQ   S + G  CRY PTCS Y  EA+  +G   G W+ L R ++
Sbjct: 25  RKNPLTLLLIGLVRVYQYGISPLIGPRCRYWPTCSHYAVEALQVHGPVRGGWMALRRFLR 84

Query: 111 CNPLGSDGFDPVP 123
           C+P G  G DPVP
Sbjct: 85  CHPWGGHGVDPVP 97


>gi|237738568|ref|ZP_04569049.1| alpha-hemolysin [Fusobacterium sp. 2_1_31]
 gi|229424051|gb|EEO39098.1| alpha-hemolysin [Fusobacterium sp. 2_1_31]
          Length = 82

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 31/70 (44%), Positives = 43/70 (61%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I +IR YQ   S +F   CRY PTCS+Y  EAI  YG   G++L + R+++C+P 
Sbjct: 1   MKKIFILLIRFYQKFISPLFPAKCRYYPTCSQYTLEAIQEYGAIKGTYLGIKRILRCHPF 60

Query: 115 GSDGFDPVPD 124
              G+DPVP 
Sbjct: 61  HEGGYDPVPK 70


>gi|307545190|ref|YP_003897669.1| hypothetical protein HELO_2600 [Halomonas elongata DSM 2581]
 gi|307217214|emb|CBV42484.1| K08998 hypothetical protein [Halomonas elongata DSM 2581]
          Length = 110

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 43/67 (64%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            I IG++R+YQ + S + G  CRY P+CS+Y  EA+  +G   G WL   R+++C+P  +
Sbjct: 23  FIMIGLVRLYQWLISPLLGPRCRYWPSCSQYTVEALRVHGPLRGGWLATRRILRCHPGAA 82

Query: 117 DGFDPVP 123
            G DPVP
Sbjct: 83  GGIDPVP 89


>gi|260459850|ref|ZP_05808104.1| protein of unknown function DUF37 [Mesorhizobium opportunistum
           WSM2075]
 gi|259034652|gb|EEW35909.1| protein of unknown function DUF37 [Mesorhizobium opportunistum
           WSM2075]
          Length = 124

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 46/85 (54%), Positives = 61/85 (71%)

Query: 40  TPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWI 99
             + RNW+G + KT GRL+G  I+R+YQL  S   GNSCR+LPTCSEY +EAIAR+GLW 
Sbjct: 14  PRRGRNWSGPWRKTPGRLLGTSIVRLYQLTLSGFVGNSCRHLPTCSEYAHEAIARHGLWA 73

Query: 100 GSWLTLLRLIKCNPLGSDGFDPVPD 124
           G W+   R+++C P G+ G D VP+
Sbjct: 74  GGWMGFFRVLRCGPFGTHGVDLVPE 98


>gi|167949045|ref|ZP_02536119.1| alpha-hemolysin [Endoriftia persephone 'Hot96_1+Hot96_2']
          Length = 78

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 45/75 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R I   +IRIYQ+  S   GN CR+ P+CS Y  EA+ ++G   G WL++ R+ +C+P 
Sbjct: 1   MRSIITFLIRIYQVALSPFLGNHCRFYPSCSSYAVEAVQKHGTLYGLWLSIKRISRCHPW 60

Query: 115 GSDGFDPVPDDLPPK 129
              G DPVP+ +  K
Sbjct: 61  HEGGVDPVPESVNKK 75


>gi|90413739|ref|ZP_01221727.1| hypothetical protein P3TCK_22979 [Photobacterium profundum 3TCK]
 gi|90325208|gb|EAS41705.1| hypothetical protein P3TCK_22979 [Photobacterium profundum 3TCK]
          Length = 85

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 34/82 (41%), Positives = 50/82 (60%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
           P +    + I ++R+YQLI S + G  CR+ PTCS+Y  EAI  +G+  G W    RL++
Sbjct: 4   PVSPFAWLAIRLVRLYQLIISPLLGPRCRFTPTCSQYAIEAIKMHGVVKGCWFAAKRLLR 63

Query: 111 CNPLGSDGFDPVPDDLPPKKNN 132
           C+PL + GFDPVP      ++N
Sbjct: 64  CHPLNNGGFDPVPPTKHNDRDN 85


>gi|169634940|ref|YP_001708676.1| hypothetical protein ABSDF3681 [Acinetobacter baumannii SDF]
 gi|226705822|sp|B0VQP6|Y3681_ACIBS RecName: Full=UPF0161 protein ABSDF3681
 gi|169153732|emb|CAP02933.1| conserved hypothetical protein [Acinetobacter baumannii]
          Length = 106

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 30/67 (44%), Positives = 42/67 (62%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            I    IR+YQ+  S + G  CRY+PTCS+Y  EA+  +G   G WL+  R+ +C+P G 
Sbjct: 3   RILRWFIRLYQIAISPLLGPRCRYIPTCSQYALEALQTHGAIKGVWLSSKRICRCHPWGG 62

Query: 117 DGFDPVP 123
            G+DPVP
Sbjct: 63  SGYDPVP 69


>gi|262281559|ref|ZP_06059338.1| UPF0161 protein [Acinetobacter calcoaceticus RUH2202]
 gi|293611388|ref|ZP_06693684.1| hypothetical protein HMPREF0013_03561 [Acinetobacter sp. SH024]
 gi|299772122|ref|YP_003734148.1| hypothetical protein AOLE_19465 [Acinetobacter sp. DR1]
 gi|262257018|gb|EEY75757.1| UPF0161 protein [Acinetobacter calcoaceticus RUH2202]
 gi|292826260|gb|EFF84629.1| hypothetical protein HMPREF0013_03561 [Acinetobacter sp. SH024]
 gi|298702210|gb|ADI92775.1| hypothetical protein AOLE_19465 [Acinetobacter sp. DR1]
          Length = 106

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 29/65 (44%), Positives = 42/65 (64%)

Query: 61  GIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFD 120
            +IR+YQ+  S + G  CRY+PTCS+Y  EA+  +G   G WL+  R+ +C+P G  G+D
Sbjct: 7   WLIRLYQIAISPLLGPRCRYIPTCSQYAIEALQTHGAIKGVWLSSKRICRCHPWGGSGYD 66

Query: 121 PVPDD 125
           PVP  
Sbjct: 67  PVPPK 71


>gi|126643003|ref|YP_001085987.1| hypothetical protein A1S_2982 [Acinetobacter baumannii ATCC 17978]
 gi|169797811|ref|YP_001715604.1| hypothetical protein ABAYE3901 [Acinetobacter baumannii AYE]
 gi|184156328|ref|YP_001844667.1| hypothetical protein ACICU_00008 [Acinetobacter baumannii ACICU]
 gi|213155393|ref|YP_002317438.1| hypothetical protein AB57_0023 [Acinetobacter baumannii AB0057]
 gi|215485158|ref|YP_002327399.1| hypothetical protein ABBFA_003529 [Acinetobacter baumannii
           AB307-0294]
 gi|239503912|ref|ZP_04663222.1| hypothetical protein AbauAB_16498 [Acinetobacter baumannii AB900]
 gi|260558090|ref|ZP_05830301.1| UPF0161 protein [Acinetobacter baumannii ATCC 19606]
 gi|301345948|ref|ZP_07226689.1| hypothetical protein AbauAB0_06875 [Acinetobacter baumannii AB056]
 gi|301510085|ref|ZP_07235322.1| hypothetical protein AbauAB05_00867 [Acinetobacter baumannii AB058]
 gi|301594677|ref|ZP_07239685.1| hypothetical protein AbauAB059_02670 [Acinetobacter baumannii
           AB059]
 gi|332854710|ref|ZP_08435497.1| conserved hypothetical protein YidD [Acinetobacter baumannii
           6013150]
 gi|332865590|ref|ZP_08436430.1| conserved hypothetical protein YidD [Acinetobacter baumannii
           6013113]
 gi|332873304|ref|ZP_08441259.1| conserved hypothetical protein YidD [Acinetobacter baumannii
           6014059]
 gi|166228937|sp|A3M8Z1|Y2982_ACIBT RecName: Full=UPF0161 protein A1S_2982
 gi|226703857|sp|B7H341|Y3529_ACIB3 RecName: Full=UPF0161 protein ABBFA_003529
 gi|226706242|sp|B0V5R1|Y3901_ACIBY RecName: Full=UPF0161 protein ABAYE3901
 gi|226734003|sp|B2HZX4|Y008_ACIBC RecName: Full=UPF0161 protein ACICU_00008
 gi|226734010|sp|B7IBI0|Y023_ACIB5 RecName: Full=UPF0161 protein AB57_0023
 gi|126388887|gb|ABO13385.1| hypothetical protein A1S_2982 [Acinetobacter baumannii ATCC 17978]
 gi|169150738|emb|CAM88650.1| conserved hypothetical protein [Acinetobacter baumannii AYE]
 gi|183207922|gb|ACC55320.1| uncharacterized conserved protein [Acinetobacter baumannii ACICU]
 gi|213054553|gb|ACJ39455.1| conserved hypothetical protein [Acinetobacter baumannii AB0057]
 gi|213987717|gb|ACJ58016.1| conserved hypothetical protein [Acinetobacter baumannii AB307-0294]
 gi|260408444|gb|EEX01751.1| UPF0161 protein [Acinetobacter baumannii ATCC 19606]
 gi|322506197|gb|ADX01651.1| Hypothetical protein ABK1_0017 [Acinetobacter baumannii 1656-2]
 gi|323516073|gb|ADX90454.1| hypothetical protein ABTW07_0015 [Acinetobacter baumannii
           TCDC-AB0715]
 gi|332727867|gb|EGJ59269.1| conserved hypothetical protein YidD [Acinetobacter baumannii
           6013150]
 gi|332735242|gb|EGJ66319.1| conserved hypothetical protein YidD [Acinetobacter baumannii
           6013113]
 gi|332738510|gb|EGJ69382.1| conserved hypothetical protein YidD [Acinetobacter baumannii
           6014059]
          Length = 106

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 42/69 (60%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            I    IR+YQ+  S + G  CRY+PTCS+Y  EA+  +G   G WL+  R+ +C+P G 
Sbjct: 3   RILRWFIRLYQIAISPLLGPRCRYIPTCSQYALEALQTHGAIKGVWLSSKRICRCHPWGG 62

Query: 117 DGFDPVPDD 125
            G+DPVP  
Sbjct: 63  SGYDPVPPK 71


>gi|253991871|ref|YP_003043227.1| hypothetical protein PAU_04399 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253783321|emb|CAQ86486.1| conserved hypothetical protein [Photorhabdus asymbiotica]
          Length = 86

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 40/73 (54%), Positives = 52/73 (71%), Gaps = 4/73 (5%)

Query: 60  IGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGF 119
           IG+IR YQL+ S + G  CR+ PTCS+YG EA+ R+G+  G WLT+ R++KC+PL   G 
Sbjct: 13  IGLIRGYQLVISPLLGPRCRFNPTCSQYGIEALNRFGMIKGGWLTVKRVLKCHPLHEGGD 72

Query: 120 DPVPDDLPPKKNN 132
           DPVP    PKKNN
Sbjct: 73  DPVP----PKKNN 81


>gi|152972612|ref|YP_001337758.1| hypothetical protein KPN_04108 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|150957461|gb|ABR79491.1| putative inner membrane protein [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
          Length = 86

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 37/77 (48%), Positives = 52/77 (67%)

Query: 47  NGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLL 106
               P + G  + IG+IR+YQ + S + G  CR+ PTCS+YG EA+ R+G+  GSWLT+ 
Sbjct: 1   MMAPPLSPGSRVLIGLIRVYQRLISPLLGPHCRFTPTCSQYGIEALRRFGVIKGSWLTMK 60

Query: 107 RLIKCNPLGSDGFDPVP 123
           R++KC+PL   G DPVP
Sbjct: 61  RVLKCHPLHPGGDDPVP 77


>gi|221135462|ref|ZP_03561765.1| hypothetical protein GHTCC_11088 [Glaciecola sp. HTCC2999]
          Length = 89

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 35/84 (41%), Positives = 48/84 (57%)

Query: 47  NGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLL 106
             K  + +  L  I +IR YQ+  S   GN+CR+ PTCS+Y  E+I  YG   G WL+  
Sbjct: 4   TQKALRKVVTLPFIALIRFYQIAISPFLGNNCRFHPTCSQYALESIKTYGCIKGVWLSSR 63

Query: 107 RLIKCNPLGSDGFDPVPDDLPPKK 130
           R++KC+P    G DPVPD+    K
Sbjct: 64  RILKCHPFHPGGIDPVPDNNKNHK 87


>gi|237743157|ref|ZP_04573638.1| alpha-hemolysin [Fusobacterium sp. 7_1]
 gi|256027564|ref|ZP_05441398.1| Alpha-hemolysin [Fusobacterium sp. D11]
 gi|260495363|ref|ZP_05815490.1| conserved hypothetical protein [Fusobacterium sp. 3_1_33]
 gi|289765523|ref|ZP_06524901.1| alpha-hemolysin [Fusobacterium sp. D11]
 gi|229433453|gb|EEO43665.1| alpha-hemolysin [Fusobacterium sp. 7_1]
 gi|260197141|gb|EEW94661.1| conserved hypothetical protein [Fusobacterium sp. 3_1_33]
 gi|289717078|gb|EFD81090.1| alpha-hemolysin [Fusobacterium sp. D11]
          Length = 82

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 48/85 (56%), Gaps = 5/85 (5%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I +IR YQ   S +F   CR+ PTCS+Y  EAI  YG   G++L + R++KC+P 
Sbjct: 1   MKKILILLIRFYQKFISPMFPAKCRFYPTCSQYTLEAIKEYGAIKGTYLGIKRILKCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNNPKLLSKK 139
              G+DPVP     K+ N     KK
Sbjct: 61  HEGGYDPVP-----KRKNKNSEGKK 80


>gi|29428250|sp|Q98LQ9|Y918_RHILO RecName: Full=UPF0161 protein mll0918
          Length = 124

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 45/89 (50%), Positives = 59/89 (66%)

Query: 36  LKNNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARY 95
                 + RNW G + KT GRL+G   +R+YQL  S   GNSCR+LPTCSEY +EAIAR+
Sbjct: 10  TVRPPGRGRNWPGPWRKTPGRLLGTSFVRLYQLTLSGFVGNSCRHLPTCSEYAHEAIARH 69

Query: 96  GLWIGSWLTLLRLIKCNPLGSDGFDPVPD 124
           GLW G W+   R+++C P G+ G D VP+
Sbjct: 70  GLWAGGWMGFFRVLRCGPFGTHGIDLVPE 98


>gi|121602223|ref|YP_988946.1| hypothetical protein BARBAKC583_0642 [Bartonella bacilliformis
           KC583]
 gi|166228804|sp|A1USJ3|Y642_BARBK RecName: Full=UPF0161 protein BARBAKC583_0642
 gi|120614400|gb|ABM45001.1| conserved hypothetical protein TIGR00278 [Bartonella bacilliformis
           KC583]
          Length = 117

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 51/85 (60%), Positives = 66/85 (77%)

Query: 42  KSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGS 101
           ++RN+ G + KT GRL+G G+IR+YQ+  SN  GN CRY+PTCSEY YEAIAR+GLW G+
Sbjct: 12  QTRNYAGPWRKTPGRLLGTGLIRLYQITLSNFIGNQCRYMPTCSEYTYEAIARHGLWAGA 71

Query: 102 WLTLLRLIKCNPLGSDGFDPVPDDL 126
           W+ L R++ CNP G+ GFDPVP  L
Sbjct: 72  WMGLFRIVCCNPFGTHGFDPVPTSL 96


>gi|237809902|ref|YP_002894342.1| hypothetical protein Tola_3168 [Tolumonas auensis DSM 9187]
 gi|259646944|sp|C4LDZ5|Y3168_TOLAT RecName: Full=UPF0161 protein Tola_3168
 gi|237502163|gb|ACQ94756.1| protein of unknown function DUF37 [Tolumonas auensis DSM 9187]
          Length = 85

 Score =  114 bits (286), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 35/82 (42%), Positives = 49/82 (59%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
           P+T  + + + +IR+YQ + S + G  CR+ PTCS+Y   AI  +GL  G WL   RL+K
Sbjct: 4   PRTPQQRLAVALIRVYQWVISPLLGPRCRFTPTCSQYMINAICLHGLIKGIWLGGKRLLK 63

Query: 111 CNPLGSDGFDPVPDDLPPKKNN 132
           C+PL S G DPVP     K+  
Sbjct: 64  CHPLHSGGHDPVPQPQQSKRRK 85


>gi|260595828|ref|YP_003208399.1| hypothetical protein CTU_00360 [Cronobacter turicensis z3032]
 gi|260215005|emb|CBA26664.1| Putative alpha-hemolysin [Cronobacter turicensis z3032]
          Length = 86

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 35/71 (49%), Positives = 49/71 (69%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           + G  + I +IR+YQ   S + G  CR+ PTCS+YG EA+ R+G+  GSWLT+ R++KC+
Sbjct: 7   SPGSRLLIALIRVYQRFISPLLGPHCRFHPTCSQYGIEALRRFGVLKGSWLTVKRVLKCH 66

Query: 113 PLGSDGFDPVP 123
           PL   G DPVP
Sbjct: 67  PLNPGGDDPVP 77


>gi|304560651|gb|ADM43315.1| Uncharacterized conserved protein [Edwardsiella tarda FL6-60]
          Length = 84

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 41/82 (50%), Positives = 53/82 (64%), Gaps = 4/82 (4%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
           P + G  + I +IR YQ   S + G  CR+ PTCS+YG EA+ R+G+  GSWLTL R++K
Sbjct: 4   PLSPGSRLLIALIRGYQRFISPLLGPHCRFHPTCSQYGIEALRRFGVVKGSWLTLKRVLK 63

Query: 111 CNPLGSDGFDPVPDDLPPKKNN 132
           C+PL   G DPVP    PK NN
Sbjct: 64  CHPLNPGGDDPVP----PKTNN 81


>gi|227328548|ref|ZP_03832572.1| hypothetical protein PcarcW_14924 [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 85

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 41/82 (50%), Positives = 55/82 (67%), Gaps = 4/82 (4%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           + G  + IG+IR YQL+ S + G  CR+ PTCS+YG EAI R+G+  G WLTL R++KC+
Sbjct: 6   SFGSRLLIGLIRGYQLVISPLLGPHCRFQPTCSQYGIEAIRRFGMIKGCWLTLKRVLKCH 65

Query: 113 PLGSDGFDPVPDDLPPKKNNPK 134
           PL   G DPVP    PK +N +
Sbjct: 66  PLNPGGDDPVP----PKTDNNR 83


>gi|288932890|ref|YP_003436949.1| hypothetical protein Kvar_0002 [Klebsiella variicola At-22]
 gi|288887619|gb|ADC55937.1| protein of unknown function DUF37 [Klebsiella variicola At-22]
          Length = 85

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 37/76 (48%), Positives = 52/76 (68%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
              P + G  + IG+IR+YQ + S + G  CR+ PTCS+YG EA+ R+G+  GSWLT+ R
Sbjct: 1   MAPPLSPGSRVLIGLIRVYQRLISPLLGPHCRFTPTCSQYGIEALRRFGVIKGSWLTMKR 60

Query: 108 LIKCNPLGSDGFDPVP 123
           ++KC+PL   G DPVP
Sbjct: 61  VLKCHPLHPGGDDPVP 76


>gi|326793319|ref|YP_004311140.1| hypothetical protein Clole_4271 [Clostridium lentocellum DSM 5427]
 gi|326544083|gb|ADZ85942.1| protein of unknown function DUF37 [Clostridium lentocellum DSM
           5427]
          Length = 92

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 30/85 (35%), Positives = 50/85 (58%), Gaps = 1/85 (1%)

Query: 50  FPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLI 109
             + + + + + +IR YQ   S + G  CR+ PTCS+Y YEAI  +G   G++L + R++
Sbjct: 8   IMRNIPKKVALILIRFYQRGISPMLGGHCRFTPTCSQYTYEAIQIHGFIKGTFLGVKRIL 67

Query: 110 KCNPLGSDGFDPVPDDLPPKKNNPK 134
           KC+P     +DPVP+    K ++ K
Sbjct: 68  KCHPFHPVMYDPVPEK-KVKNSDKK 91


>gi|312886266|ref|ZP_07745880.1| protein of unknown function DUF37 [Mucilaginibacter paludis DSM
           18603]
 gi|311301291|gb|EFQ78346.1| protein of unknown function DUF37 [Mucilaginibacter paludis DSM
           18603]
          Length = 80

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 37/74 (50%), Positives = 49/74 (66%)

Query: 50  FPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLI 109
             KT+     I +I++YQ++ S + G  CRY PTCS+YG EAI +YG + G WLTL R+ 
Sbjct: 7   LLKTIVGSFFIALIKLYQILLSPILGAQCRYTPTCSQYGIEAIKKYGAFKGGWLTLKRIA 66

Query: 110 KCNPLGSDGFDPVP 123
           +CNP G  G DPVP
Sbjct: 67  RCNPWGGHGHDPVP 80


>gi|319898980|ref|YP_004159073.1| hypothetical protein BARCL_0814 [Bartonella clarridgeiae 73]
 gi|319402944|emb|CBI76495.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 114

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 51/91 (56%), Positives = 67/91 (73%)

Query: 36  LKNNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARY 95
           +K     +RN+ G + KT GRL+GIG+IR YQ++ SN  GN CR+ PTCSEY YEAIAR+
Sbjct: 6   VKTKKTYTRNYTGPWQKTPGRLLGIGLIRFYQIMLSNFIGNQCRHRPTCSEYTYEAIARH 65

Query: 96  GLWIGSWLTLLRLIKCNPLGSDGFDPVPDDL 126
           GLW G+W+   RLI+C P G++GFDPVP  +
Sbjct: 66  GLWAGAWMGFFRLIRCCPFGTNGFDPVPTSI 96


>gi|86141204|ref|ZP_01059750.1| hypothetical protein MED217_04282 [Leeuwenhoekiella blandensis
           MED217]
 gi|85831763|gb|EAQ50218.1| hypothetical protein MED217_04282 [Leeuwenhoekiella blandensis
           MED217]
          Length = 87

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 35/82 (42%), Positives = 48/82 (58%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            K+L + + I  IR+YQ   S +   +CRY PTCS+Y  EAI ++G   GSWL + R+  
Sbjct: 1   MKSLAKKVLIFPIRLYQRFLSPLLPPACRYSPTCSQYSVEAIQQHGALKGSWLAIKRIAS 60

Query: 111 CNPLGSDGFDPVPDDLPPKKNN 132
           CNP G  G+DPVP     K + 
Sbjct: 61  CNPWGGSGYDPVPPAGDEKSHK 82


>gi|218680396|ref|ZP_03528293.1| hypothetical protein RetlC8_16490 [Rhizobium etli CIAT 894]
          Length = 168

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 49/84 (58%), Positives = 63/84 (75%)

Query: 43  SRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSW 102
           SRN+ G F K+  RL+G+G IR+YQL  S   GNSCR++PTCSEYGYE+IAR+GLW G W
Sbjct: 31  SRNYTGPFRKSPDRLLGMGFIRLYQLTLSGFVGNSCRHIPTCSEYGYESIARHGLWAGGW 90

Query: 103 LTLLRLIKCNPLGSDGFDPVPDDL 126
           +TL R+ +C P G+ G D VP+ L
Sbjct: 91  MTLFRVGRCGPGGTSGLDQVPEML 114


>gi|87120552|ref|ZP_01076446.1| hypothetical protein MED121_22382 [Marinomonas sp. MED121]
 gi|86164195|gb|EAQ65466.1| hypothetical protein MED121_22382 [Marinomonas sp. MED121]
          Length = 79

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 33/79 (41%), Positives = 52/79 (65%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + + I +IR+YQ+I S + G++CR+ P+CS Y  EA+ R+G + G +L + RL KC+P
Sbjct: 1   MIKWVAIKLIRVYQIIISPLIGSNCRFYPSCSAYMIEAMERFGFFKGLYLGIKRLGKCHP 60

Query: 114 LGSDGFDPVPDDLPPKKNN 132
           L   G DPVP+  P K  +
Sbjct: 61  LHEGGMDPVPEKKPCKHKH 79


>gi|154687197|ref|YP_001422358.1| hypothetical protein RBAM_027690 [Bacillus amyloliquefaciens FZB42]
 gi|189039766|sp|A7Z801|Y2769_BACA2 RecName: Full=UPF0161 protein RBAM_027690
 gi|154353048|gb|ABS75127.1| YtjA [Bacillus amyloliquefaciens FZB42]
          Length = 75

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 34/74 (45%), Positives = 43/74 (58%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I  IR YQ   S +   SCR+ PTCS+YG EA+  +G   G WLTL R++KC+P 
Sbjct: 1   MKTIMIAFIRGYQKFISPLTPPSCRFYPTCSQYGIEAVKTHGALKGGWLTLKRILKCHPF 60

Query: 115 GSDGFDPVPDDLPP 128
              G DPVPD    
Sbjct: 61  HPGGVDPVPDKKQK 74


>gi|196250028|ref|ZP_03148723.1| protein of unknown function DUF37 [Geobacillus sp. G11MC16]
 gi|196210542|gb|EDY05306.1| protein of unknown function DUF37 [Geobacillus sp. G11MC16]
          Length = 95

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 33/76 (43%), Positives = 46/76 (60%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           +   + I +IR YQ   S +   +CR+ PTCS YG EA+ R+G   G WLT+ R++KC+P
Sbjct: 3   MVAKLLIMLIRFYQRFLSPLKPPTCRFYPTCSHYGIEAVTRFGAIKGGWLTVKRILKCHP 62

Query: 114 LGSDGFDPVPDDLPPK 129
               GFDPVP+    K
Sbjct: 63  FHPGGFDPVPEKPQKK 78


>gi|225025481|ref|ZP_03714673.1| hypothetical protein EIKCOROL_02381 [Eikenella corrodens ATCC
           23834]
 gi|224941765|gb|EEG22974.1| hypothetical protein EIKCOROL_02381 [Eikenella corrodens ATCC
           23834]
          Length = 70

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 31/70 (44%), Positives = 42/70 (60%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           +   I +G+IR YQ   S +    CRY PTCS+Y  EA+ +YG   G WL   R+ +C+P
Sbjct: 1   MLAKILLGLIRFYQYAISPMLPPRCRYQPTCSQYAIEAVRKYGALKGGWLAAKRIGRCHP 60

Query: 114 LGSDGFDPVP 123
            G  G+DPVP
Sbjct: 61  WGGSGYDPVP 70


>gi|116333883|ref|YP_795410.1| hypothetical protein LVIS_1274 [Lactobacillus brevis ATCC 367]
 gi|122269430|sp|Q03QZ3|Y1274_LACBA RecName: Full=UPF0161 protein LVIS_1274
 gi|116099230|gb|ABJ64379.1| hypothetical protein LVIS_1274 [Lactobacillus brevis ATCC 367]
          Length = 99

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 32/77 (41%), Positives = 45/77 (58%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R I I  +R YQ   S +F  +CRY PTCS Y  +A++++G   GS + L R+++C P 
Sbjct: 1   MRHILIWFVRGYQRFISPLFPPTCRYYPTCSTYMVQALSKHGALKGSLMGLARILRCQPF 60

Query: 115 GSDGFDPVPDDLPPKKN 131
              G DPVPD    K+N
Sbjct: 61  VRGGIDPVPDHFTLKRN 77


>gi|16080120|ref|NP_390946.1| hypothetical protein BSU30680 [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|221311008|ref|ZP_03592855.1| hypothetical protein Bsubs1_16696 [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221315334|ref|ZP_03597139.1| hypothetical protein BsubsN3_16607 [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221320251|ref|ZP_03601545.1| hypothetical protein BsubsJ_16528 [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221324534|ref|ZP_03605828.1| hypothetical protein BsubsS_16672 [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|321312605|ref|YP_004204892.1| hypothetical protein BSn5_06185 [Bacillus subtilis BSn5]
 gi|14286083|sp|O34601|YTJA_BACSU RecName: Full=UPF0161 protein ytjA
 gi|2293294|gb|AAC00372.1| YtjA [Bacillus subtilis]
 gi|2635552|emb|CAB15046.1| conserved hypothetical protein [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|291485506|dbj|BAI86581.1| hypothetical protein BSNT_04466 [Bacillus subtilis subsp. natto
           BEST195]
 gi|320018879|gb|ADV93865.1| hypothetical protein BSn5_06185 [Bacillus subtilis BSn5]
          Length = 75

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 31/74 (41%), Positives = 44/74 (59%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I +IR YQ   S +   +CR+ PTCS+YG EAI  +G   G WLT+ R++KC+P 
Sbjct: 1   MKTLFIALIRGYQKFISPLTPPTCRFYPTCSQYGIEAIKTHGALKGGWLTIKRILKCHPF 60

Query: 115 GSDGFDPVPDDLPP 128
              G DPVP+    
Sbjct: 61  HPGGVDPVPEKKQK 74


>gi|226942149|ref|YP_002797223.1| hypothetical protein LHK_03237 [Laribacter hongkongensis HLHK9]
 gi|254801640|sp|C1D6H9|Y3237_LARHH RecName: Full=UPF0161 protein LHK_03237
 gi|226717076|gb|ACO76214.1| hypothetical protein LHK_03237 [Laribacter hongkongensis HLHK9]
          Length = 69

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 32/69 (46%), Positives = 42/69 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              I + +IR YQL  S      CRY PTCS+Y  EA+ ++G   G WL L R+ +C+P 
Sbjct: 1   MSRIVLALIRFYQLAISPWLPPRCRYQPTCSQYAIEAVQKHGALKGGWLALRRIGRCHPW 60

Query: 115 GSDGFDPVP 123
           GS G+DPVP
Sbjct: 61  GSSGYDPVP 69


>gi|332143492|ref|YP_004429230.1| hypothetical protein MADE_1020550 [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327553514|gb|AEB00233.1| hypothetical protein MADE_1020550 [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 82

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 50/82 (60%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            + L  ++ + +I+ YQ   S + G  CR+ P+CS Y  +A+  +GL  G WL++ R++K
Sbjct: 1   MRQLLIVVPLALIKCYQWFISPMLGQRCRFHPSCSWYAIDALKTHGLAKGGWLSIKRILK 60

Query: 111 CNPLGSDGFDPVPDDLPPKKNN 132
           C+PL + G+DPVP+    K + 
Sbjct: 61  CHPLHAGGYDPVPEKQQDKHSK 82


>gi|117619119|ref|YP_858699.1| hypothetical protein AHA_4282 [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117560526|gb|ABK37474.1| conserved hypothetical protein [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 75

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 34/77 (44%), Positives = 49/77 (63%), Gaps = 2/77 (2%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + + +IR+YQLI S + G  CR+ PTCS++  EAI  +G   G WL   RL+KC+PL
Sbjct: 1   MQWVAVKLIRLYQLIISPLLGPRCRFTPTCSQFAIEAIRLHGFIKGVWLASKRLLKCHPL 60

Query: 115 GSDGFDPVPDDLPPKKN 131
              G+DPVP   P ++N
Sbjct: 61  SEGGYDPVPQ--PKRRN 75


>gi|262377656|ref|ZP_06070876.1| UPF0161 protein [Acinetobacter lwoffii SH145]
 gi|262307415|gb|EEY88558.1| UPF0161 protein [Acinetobacter lwoffii SH145]
          Length = 106

 Score =  113 bits (284), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 29/65 (44%), Positives = 40/65 (61%)

Query: 61  GIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFD 120
            +IR YQ+  S + G  CRY+PTCS+Y  EA+  +G   G WL   R+ +C+P G  G+D
Sbjct: 7   WLIRFYQIAISPLLGPRCRYIPTCSQYSLEAVQMHGAGRGVWLATKRICRCHPWGGSGYD 66

Query: 121 PVPDD 125
           PVP  
Sbjct: 67  PVPSK 71


>gi|90581130|ref|ZP_01236929.1| hypothetical protein VAS14_22402 [Vibrio angustum S14]
 gi|90437651|gb|EAS62843.1| hypothetical protein VAS14_22402 [Vibrio angustum S14]
          Length = 85

 Score =  113 bits (284), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 35/84 (41%), Positives = 50/84 (59%), Gaps = 4/84 (4%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
           P +    + +G++R YQL  S + G  CR+ PTCS+Y  EA+  +G   G WL   RL+K
Sbjct: 4   PVSPFAWLVVGLVRFYQLAISPLLGPRCRFTPTCSQYAIEAVKTHGALKGCWLAAKRLLK 63

Query: 111 CNPLGSDGFDPVPDDLPPKKNNPK 134
           C+PL   G+DPVP    P K+N +
Sbjct: 64  CHPLNDGGYDPVP----PTKHNDR 83


>gi|269129165|ref|YP_003302535.1| hypothetical protein Tcur_4983 [Thermomonospora curvata DSM 43183]
 gi|268314123|gb|ACZ00498.1| protein of unknown function DUF37 [Thermomonospora curvata DSM
           43183]
          Length = 132

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 3/82 (3%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
           G    +L   + I ++R Y+   S + G  CR+ PTCS Y  EA+  +G   G WLT+ R
Sbjct: 27  GTARISLAARLLILLVRGYRRFLSPLLGQQCRFYPTCSAYSLEALRMHGALRGGWLTVRR 86

Query: 108 LIKCNPLGSDGFDPVPDDLPPK 129
           + +C+P    G+DPVP   PPK
Sbjct: 87  IGRCHPFHRGGYDPVP---PPK 105


>gi|289523249|ref|ZP_06440103.1| alpha-hemolysin [Anaerobaculum hydrogeniformans ATCC BAA-1850]
 gi|289503792|gb|EFD24956.1| alpha-hemolysin [Anaerobaculum hydrogeniformans ATCC BAA-1850]
          Length = 90

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 34/82 (41%), Positives = 50/82 (60%)

Query: 42  KSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGS 101
           +  N  G  P+   + + I  IR+YQ+  S + G +CR+ P+CS+Y  EAI ++G   GS
Sbjct: 2   RRMNKIGYLPEKAFKRVLILSIRLYQIFLSPLLGRNCRFYPSCSQYALEAIEQWGAIRGS 61

Query: 102 WLTLLRLIKCNPLGSDGFDPVP 123
           WLT+ RL +C P    G+DPVP
Sbjct: 62  WLTVKRLCRCGPWHPGGYDPVP 83


>gi|241204768|ref|YP_002975864.1| hypothetical protein Rleg_2047 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240858658|gb|ACS56325.1| protein of unknown function DUF37 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 134

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 49/85 (57%), Positives = 64/85 (75%)

Query: 42  KSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGS 101
            SRN+ G F K+  RL+G+G+IR+YQL  S   GNSCR++PTCSEYGYE+IAR+GLW G 
Sbjct: 30  TSRNYTGPFRKSPDRLLGMGLIRLYQLTLSGFIGNSCRHIPTCSEYGYESIARHGLWAGG 89

Query: 102 WLTLLRLIKCNPLGSDGFDPVPDDL 126
           W+TL R+ +C P G+ G D VP+ L
Sbjct: 90  WMTLFRVGRCGPGGTSGLDQVPEML 114


>gi|227113119|ref|ZP_03826775.1| hypothetical protein PcarbP_09160 [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 85

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 41/82 (50%), Positives = 55/82 (67%), Gaps = 4/82 (4%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           + G  + IG+IR YQL+ S + G  CR+ PTCS+YG EAI R+G+  G WLTL R++KC+
Sbjct: 6   SFGSRLLIGLIRGYQLVISPLLGPHCRFRPTCSQYGIEAIRRFGMIKGCWLTLKRVLKCH 65

Query: 113 PLGSDGFDPVPDDLPPKKNNPK 134
           PL   G DPVP    PK +N +
Sbjct: 66  PLNPGGDDPVP----PKTDNNR 83


>gi|311281729|ref|YP_003943960.1| hypothetical protein Entcl_4447 [Enterobacter cloacae SCF1]
 gi|308750924|gb|ADO50676.1| protein of unknown function DUF37 [Enterobacter cloacae SCF1]
          Length = 85

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 52/85 (61%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
                + G  + I +IR+YQ + S + G  CR+ PTCS+YG EA+ R+G+  GSWLT+ R
Sbjct: 1   MAPSLSPGSRVLIALIRVYQRLISPLLGPHCRFTPTCSQYGIEALRRFGVIKGSWLTVKR 60

Query: 108 LIKCNPLGSDGFDPVPDDLPPKKNN 132
           ++KC+PL   G DPVP      + +
Sbjct: 61  VLKCHPLHPGGDDPVPPGPSNTREH 85


>gi|23099142|ref|NP_692608.1| hypothetical protein OB1687 [Oceanobacillus iheyensis HTE831]
 gi|29428202|sp|Q8EQL0|Y1687_OCEIH RecName: Full=UPF0161 protein OB1687
 gi|22777370|dbj|BAC13643.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831]
          Length = 90

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 38/84 (45%), Positives = 50/84 (59%), Gaps = 1/84 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I IG+I+ Y+   S    +SCR+ PTCSEYG EAI R+G + G  LT+ R+ KC+P 
Sbjct: 1   MKFIFIGLIKFYRSAISPFTPSSCRFYPTCSEYGLEAIKRFGAFKGGILTIKRISKCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNNPKLLSK 138
              G D VPD +    NN K L K
Sbjct: 61  HPGGVDVVPDKVKNI-NNEKHLEK 83


>gi|296328799|ref|ZP_06871313.1| alpha-hemolysin [Fusobacterium nucleatum subsp. nucleatum ATCC
           23726]
 gi|296154134|gb|EFG94938.1| alpha-hemolysin [Fusobacterium nucleatum subsp. nucleatum ATCC
           23726]
          Length = 82

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 33/85 (38%), Positives = 48/85 (56%), Gaps = 5/85 (5%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I +IR YQ   S +F   CR+ PTCS+Y  EAI  +G   G++L + R++KC+P 
Sbjct: 1   MKKILILLIRFYQKFISPMFPAKCRFYPTCSQYTLEAIKDHGTIKGTYLGIRRILKCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNNPKLLSKK 139
              G+DPVP     K+ N     K+
Sbjct: 61  HEGGYDPVP-----KRKNKNSEGKR 80


>gi|297565964|ref|YP_003684936.1| hypothetical protein Mesil_1538 [Meiothermus silvanus DSM 9946]
 gi|296850413|gb|ADH63428.1| protein of unknown function DUF37 [Meiothermus silvanus DSM 9946]
          Length = 107

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 52/85 (61%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           L R   +G++R YQ   S +   +CR+ PTCS Y  EA+ R+G + GS+L + R++KC+P
Sbjct: 3   LVRFFLVGLVRFYQRFLSPLKPPTCRFYPTCSHYAVEALERHGAFWGSYLAVKRILKCHP 62

Query: 114 LGSDGFDPVPDDLPPKKNNPKLLSK 138
           L   G DPVP D P  +   ++LS 
Sbjct: 63  LHPGGIDPVPQDTPRIRVPLRILSP 87


>gi|119471655|ref|ZP_01614040.1| hypothetical protein ATW7_16283 [Alteromonadales bacterium TW-7]
 gi|119445434|gb|EAW26721.1| hypothetical protein ATW7_16283 [Alteromonadales bacterium TW-7]
          Length = 91

 Score =  113 bits (283), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 34/74 (45%), Positives = 46/74 (62%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           L  L  + +IR YQ   S + G  CR+ P+CS Y  +AI  +GL  GSWL L R++KC+P
Sbjct: 10  LPTLCLVLLIRGYQKWISPLLGPHCRFNPSCSHYAIQAIKLHGLIKGSWLALKRILKCHP 69

Query: 114 LGSDGFDPVPDDLP 127
           L S G DPVP+ + 
Sbjct: 70  LHSGGDDPVPEKIT 83


>gi|296330075|ref|ZP_06872558.1| hypothetical protein BSU6633_03152 [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305675652|ref|YP_003867324.1| hypothetical protein BSUW23_14890 [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296152800|gb|EFG93666.1| hypothetical protein BSU6633_03152 [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305413896|gb|ADM39015.1| conserved hypothetical protein [Bacillus subtilis subsp. spizizenii
           str. W23]
          Length = 75

 Score =  113 bits (283), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 31/74 (41%), Positives = 45/74 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I +IR YQ   S +   +CR+ PTCS+YG EAI  +G   G WLT++R++KC+P 
Sbjct: 1   MKTLFIALIRGYQKFISPLTPPTCRFYPTCSQYGIEAIKTHGALKGGWLTIIRILKCHPF 60

Query: 115 GSDGFDPVPDDLPP 128
              G DPVP+    
Sbjct: 61  HPGGVDPVPEKKKK 74


>gi|311069561|ref|YP_003974484.1| hypothetical protein BATR1942_13130 [Bacillus atrophaeus 1942]
 gi|310870078|gb|ADP33553.1| hypothetical protein BATR1942_13130 [Bacillus atrophaeus 1942]
          Length = 75

 Score =  113 bits (283), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 36/74 (48%), Positives = 46/74 (62%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I IG+IR YQ   S +   SCR+ PTCS+YG EAI  +G   G WLTL R++KC+PL
Sbjct: 1   MKTIFIGLIRCYQKFISPLTPPSCRFYPTCSQYGIEAIKTHGALKGGWLTLKRILKCHPL 60

Query: 115 GSDGFDPVPDDLPP 128
              G DPVP+    
Sbjct: 61  HPGGVDPVPEKKRK 74


>gi|255320706|ref|ZP_05361883.1| conserved hypothetical protein [Acinetobacter radioresistens SK82]
 gi|262380664|ref|ZP_06073817.1| UPF0161 protein [Acinetobacter radioresistens SH164]
 gi|255302322|gb|EET81562.1| conserved hypothetical protein [Acinetobacter radioresistens SK82]
 gi|262297612|gb|EEY85528.1| UPF0161 protein [Acinetobacter radioresistens SH164]
          Length = 106

 Score =  113 bits (283), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 31/71 (43%), Positives = 42/71 (59%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R +   +IR YQ+  S + G  CRY+PTCS+Y  EAI  +G   G WL   R+ +C+P 
Sbjct: 1   MRRLLHWLIRFYQIAISPLLGPRCRYIPTCSQYSLEAIHAHGAMRGVWLAGKRICRCHPW 60

Query: 115 GSDGFDPVPDD 125
           G  G+DPVP  
Sbjct: 61  GGSGYDPVPPK 71


>gi|50086620|ref|YP_048130.1| hypothetical protein ACIAD3682 [Acinetobacter sp. ADP1]
 gi|81392036|sp|Q6F6K9|Y3682_ACIAD RecName: Full=UPF0161 protein ACIAD3682
 gi|49532594|emb|CAG70308.1| conserved hypothetical protein; putative conserved domain
           [Acinetobacter sp. ADP1]
          Length = 106

 Score =  113 bits (283), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 31/69 (44%), Positives = 43/69 (62%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            I   +IR YQ+  S + G  CRY+PTCS+Y  EAI  +G   G+WL + R+ +C+P G 
Sbjct: 3   RILHWLIRFYQIAISPMLGPRCRYIPTCSQYSLEAIHTHGAMKGTWLAIHRVCRCHPWGG 62

Query: 117 DGFDPVPDD 125
            G+DPVP  
Sbjct: 63  SGYDPVPPK 71


>gi|149277973|ref|ZP_01884112.1| hypothetical protein PBAL39_24825 [Pedobacter sp. BAL39]
 gi|149231171|gb|EDM36551.1| hypothetical protein PBAL39_24825 [Pedobacter sp. BAL39]
          Length = 76

 Score =  113 bits (283), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 34/76 (44%), Positives = 49/76 (64%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
            K    +     + +IR+YQ + S + G +CR+ PTCS+YG EAI ++G + G WLTL R
Sbjct: 1   MKIINQIIGAFFLLLIRLYQYLISPMLGANCRFTPTCSQYGMEAIKKHGPFKGGWLTLKR 60

Query: 108 LIKCNPLGSDGFDPVP 123
           + KC+P G+ G DPVP
Sbjct: 61  IGKCHPWGAHGHDPVP 76


>gi|284036003|ref|YP_003385933.1| hypothetical protein Slin_1083 [Spirosoma linguale DSM 74]
 gi|283815296|gb|ADB37134.1| protein of unknown function DUF37 [Spirosoma linguale DSM 74]
          Length = 70

 Score =  113 bits (283), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 47/70 (67%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + I IG++RIYQ   S  F N+CRY P+CS+Y  EAI ++G   G W+ L R+ +C+P
Sbjct: 1   MMKSILIGLVRIYQAALSPYFPNACRYTPSCSQYMVEAIQKHGAVRGGWMGLKRMGRCHP 60

Query: 114 LGSDGFDPVP 123
            G  G+DPVP
Sbjct: 61  WGGHGYDPVP 70


>gi|317050195|ref|YP_004117843.1| hypothetical protein Pat9b_3997 [Pantoea sp. At-9b]
 gi|316951812|gb|ADU71287.1| protein of unknown function DUF37 [Pantoea sp. At-9b]
          Length = 80

 Score =  113 bits (283), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 35/73 (47%), Positives = 50/73 (68%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           + G  + IG+IR+YQ   S + G  CR+ P+CS+YG EA+ R+G+  GSWLT+ R++KC+
Sbjct: 6   SPGSRLLIGLIRVYQRAISPLLGPHCRFHPSCSQYGIEALRRFGVIKGSWLTIKRVLKCH 65

Query: 113 PLGSDGFDPVPDD 125
           PL   G DPVP  
Sbjct: 66  PLNPGGDDPVPPK 78


>gi|145220573|ref|YP_001131282.1| hypothetical protein Cvib_1772 [Prosthecochloris vibrioformis DSM
           265]
 gi|145206737|gb|ABP37780.1| protein of unknown function DUF37 [Chlorobium phaeovibrioides DSM
           265]
          Length = 89

 Score =  113 bits (283), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 28/72 (38%), Positives = 45/72 (62%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           +++   + I +I+ Y+   S + G SCR+ PTCS Y  EA  R+  +  +WL++ R+++C
Sbjct: 5   RSVFAALPIALIKFYRAYISPLLGPSCRFYPTCSAYAIEAFERHNFFKATWLSVWRVLRC 64

Query: 112 NPLGSDGFDPVP 123
           NP    GFDPVP
Sbjct: 65  NPFSRGGFDPVP 76


>gi|19703355|ref|NP_602917.1| Alpha-hemolysin [Fusobacterium nucleatum subsp. nucleatum ATCC
           25586]
 gi|25009580|sp|Q8RHA5|Y003_FUSNN RecName: Full=UPF0161 protein FN0003
 gi|19713417|gb|AAL94216.1| hypothetical cytosolic protein [Fusobacterium nucleatum subsp.
           nucleatum ATCC 25586]
          Length = 82

 Score =  113 bits (283), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 33/85 (38%), Positives = 48/85 (56%), Gaps = 5/85 (5%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I +IR YQ   S +F   CR+ PTCS+Y  EAI  +G   G++L + R++KC+P 
Sbjct: 1   MKKILILLIRFYQKFISPMFPAKCRFYPTCSQYTLEAIKEHGTIKGTYLAIRRILKCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNNPKLLSKK 139
              G+DPVP     K+ N     K+
Sbjct: 61  HEGGYDPVP-----KRKNKNSEGKR 80


>gi|163868455|ref|YP_001609664.1| hypothetical protein Btr_1305 [Bartonella tribocorum CIP 105476]
 gi|189038654|sp|A9IVA8|Y1305_BART1 RecName: Full=UPF0161 protein BT_1305
 gi|161018111|emb|CAK01669.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 116

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 49/84 (58%), Positives = 65/84 (77%)

Query: 43  SRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSW 102
           +RN+ G + KT GRL+GI +IR YQ+  S++ GN CR+ PTCSEY YEAIAR+GLW G+W
Sbjct: 12  TRNYTGAWQKTPGRLLGIFLIRFYQITLSSLIGNQCRHAPTCSEYIYEAIARHGLWAGAW 71

Query: 103 LTLLRLIKCNPLGSDGFDPVPDDL 126
           + L R+++C P G+DGFDPVP  L
Sbjct: 72  MGLFRIMRCGPFGTDGFDPVPPSL 95


>gi|326796351|ref|YP_004314171.1| hypothetical protein Marme_3116 [Marinomonas mediterranea MMB-1]
 gi|326547115|gb|ADZ92335.1| UPF0161 protein yidD [Marinomonas mediterranea MMB-1]
          Length = 77

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 47/77 (61%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +++ I +++ YQ   S + G++CR+ P+CS+Y  EAI  +G+  G WL + RL +C+P 
Sbjct: 1   MKILFIYLVKGYQYFISPLLGSNCRFYPSCSQYMIEAIEEHGVLKGVWLGMKRLGRCHPG 60

Query: 115 GSDGFDPVPDDLPPKKN 131
              G DPVP +   + +
Sbjct: 61  CDGGLDPVPKNEKKQNS 77


>gi|86607211|ref|YP_475974.1| hypothetical protein CYA_2594 [Synechococcus sp. JA-3-3Ab]
 gi|116256210|sp|Q2JQD1|Y2594_SYNJA RecName: Full=UPF0161 protein CYA_2594
 gi|86555753|gb|ABD00711.1| conserved hypothetical protein TIGR00278 [Synechococcus sp.
           JA-3-3Ab]
          Length = 100

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 32/66 (48%), Positives = 43/66 (65%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            + +IR YQ+  S +   +CRY PTCS+Y  EA+ RYG   GSWL + RL +C+P    G
Sbjct: 12  LVALIRGYQVAISPLLPPACRYYPTCSQYTLEAVRRYGAIRGSWLGIRRLCRCHPWHPGG 71

Query: 119 FDPVPD 124
           +DPVPD
Sbjct: 72  YDPVPD 77


>gi|241759495|ref|ZP_04757599.1| conserved hypothetical protein [Neisseria flavescens SK114]
 gi|241320277|gb|EER56610.1| conserved hypothetical protein [Neisseria flavescens SK114]
          Length = 73

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 43/73 (58%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
             TL   + + +IR YQ   S +    CRY PTCS+Y  EA+ +YG + G WL + R+ +
Sbjct: 1   MNTLLSKLFLALIRFYQYCISPLIPPRCRYTPTCSQYAVEAVKKYGAFKGGWLAIKRIAR 60

Query: 111 CNPLGSDGFDPVP 123
           C+P G  G DPVP
Sbjct: 61  CHPFGGHGHDPVP 73


>gi|146313780|ref|YP_001178854.1| hypothetical protein Ent638_4150 [Enterobacter sp. 638]
 gi|167012907|sp|A4WGH3|Y4150_ENT38 RecName: Full=UPF0161 protein Ent638_4150
 gi|145320656|gb|ABP62803.1| protein of unknown function DUF37 [Enterobacter sp. 638]
          Length = 85

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 37/76 (48%), Positives = 51/76 (67%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
              P + G  + IG+IR+YQ + S + G  CR+ PTCS YG EA+ R+G+  GSWLT+ R
Sbjct: 1   MAPPLSPGSRVLIGLIRVYQRLISPLLGPHCRFTPTCSSYGIEALRRFGVIKGSWLTVKR 60

Query: 108 LIKCNPLGSDGFDPVP 123
           ++KC+PL   G DPVP
Sbjct: 61  VLKCHPLHPGGDDPVP 76


>gi|262371176|ref|ZP_06064497.1| UPF0161 protein [Acinetobacter johnsonii SH046]
 gi|262313906|gb|EEY94952.1| UPF0161 protein [Acinetobacter johnsonii SH046]
          Length = 106

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 29/65 (44%), Positives = 41/65 (63%)

Query: 61  GIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFD 120
            +IR YQ+  S + G  CRY+PTCS+Y  EA+  +G   G WL   R+ +C+P G  G+D
Sbjct: 7   WLIRFYQIAISPLLGPRCRYIPTCSQYSLEAVHTHGAVRGVWLATKRICRCHPWGGSGYD 66

Query: 121 PVPDD 125
           PVP+ 
Sbjct: 67  PVPNK 71


>gi|15640037|ref|NP_062589.1| hypothetical protein VC0005 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|227080242|ref|YP_002808793.1| hypothetical protein VCM66_0005 [Vibrio cholerae M66-2]
 gi|254226944|ref|ZP_04920510.1| conserved hypothetical protein [Vibrio cholerae V51]
 gi|297581960|ref|ZP_06943880.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|298501191|ref|ZP_07010990.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|14285807|sp|Q9KVY3|Y005_VIBCH RecName: Full=UPF0161 protein VC_0005
 gi|254799450|sp|C3LP78|Y005_VIBCM RecName: Full=UPF0161 protein VCM66_0005
 gi|9654396|gb|AAF93183.1| conserved hypothetical protein [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|125620549|gb|EAZ48917.1| conserved hypothetical protein [Vibrio cholerae V51]
 gi|227008130|gb|ACP04342.1| conserved hypothetical protein [Vibrio cholerae M66-2]
 gi|227011992|gb|ACP08202.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|297533827|gb|EFH72668.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|297540063|gb|EFH76125.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
          Length = 85

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 33/85 (38%), Positives = 47/85 (55%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
              P +    + IGI+++YQ   S + G  CR+ PTCS Y  EA+  +G   G WL+  R
Sbjct: 1   MATPLSPFSWLAIGIVKLYQWFISPLIGPRCRFTPTCSTYAIEALRAHGFIKGCWLSTKR 60

Query: 108 LIKCNPLGSDGFDPVPDDLPPKKNN 132
           L+KC+PL   GFDPVP      ++ 
Sbjct: 61  LLKCHPLNEGGFDPVPPVQKQDRDK 85


>gi|158333932|ref|YP_001515104.1| hypothetical protein AM1_0746 [Acaryochloris marina MBIC11017]
 gi|158304173|gb|ABW25790.1| conserved hypothetical protein [Acaryochloris marina MBIC11017]
          Length = 97

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 31/69 (44%), Positives = 45/69 (65%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + IG+I++Y+ + S +F  SCR+ PTCS Y  EAI+ +G   GSWL   R+ +CNP 
Sbjct: 1   MKQLLIGMIQVYRRLISPLFPPSCRFHPTCSAYAIEAISTWGSVKGSWLAAKRICRCNPF 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  HPGGYDPVP 69


>gi|110598559|ref|ZP_01386827.1| Protein of unknown function DUF37 [Chlorobium ferrooxidans DSM
           13031]
 gi|110339793|gb|EAT58300.1| Protein of unknown function DUF37 [Chlorobium ferrooxidans DSM
           13031]
          Length = 112

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 42/66 (63%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
           + I +I+ YQ+  S + G+SCRY PTCS Y  EA   +  +   WLT+ R+++CNP    
Sbjct: 31  VPILLIKFYQVFLSPLLGSSCRYYPTCSAYALEAFRTHNFFYAVWLTVWRILRCNPFAKG 90

Query: 118 GFDPVP 123
           GFDPVP
Sbjct: 91  GFDPVP 96


>gi|310765878|gb|ADP10828.1| conserved hypothetical protein [Erwinia sp. Ejp617]
          Length = 80

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 34/75 (45%), Positives = 49/75 (65%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
           P + G  + I +IR+YQ + S + G  CR+ P+CS+YG EA+ R+G+  GSWL + RL+K
Sbjct: 4   PLSPGSRLLIALIRVYQRVISPLLGPHCRFHPSCSQYGIEALRRFGMIKGSWLAMKRLLK 63

Query: 111 CNPLGSDGFDPVPDD 125
           C+P    G DPVP  
Sbjct: 64  CHPFNPGGDDPVPPH 78


>gi|205374603|ref|ZP_03227398.1| hypothetical protein Bcoam_16106 [Bacillus coahuilensis m4-4]
          Length = 77

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 51/80 (63%), Gaps = 4/80 (5%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           +   + I +I+IYQ + S +   SCR+ PTCS YG EAI ++G   G WLT+ R+ +C+P
Sbjct: 1   MLSKLFIFLIKIYQRVISPLKPPSCRFYPTCSHYGVEAIQKHGAVKGGWLTIKRISRCHP 60

Query: 114 LGSDGFDPVPDDLPPKKNNP 133
               GFDPVP+    KK+NP
Sbjct: 61  FHPGGFDPVPE----KKSNP 76


>gi|261856985|ref|YP_003264268.1| hypothetical protein Hneap_2412 [Halothiobacillus neapolitanus c2]
 gi|261837454|gb|ACX97221.1| protein of unknown function DUF37 [Halothiobacillus neapolitanus
           c2]
          Length = 136

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R + I ++R YQ+  S     SCR+ PTCS Y  EAI ++G   G W+ L R+ +CNP 
Sbjct: 1   MRWLLIRLVRFYQIFISPFLPPSCRFEPTCSHYAIEAIQKHGALKGGWMALRRIGRCNPF 60

Query: 115 GSDGFDPVPDDLP 127
              G+DPVP+   
Sbjct: 61  CEGGYDPVPESKS 73


>gi|52081555|ref|YP_080346.1| hypothetical protein BL05307 [Bacillus licheniformis ATCC 14580]
 gi|52786934|ref|YP_092763.1| hypothetical protein BLi03210 [Bacillus licheniformis ATCC 14580]
 gi|319647465|ref|ZP_08001686.1| hypothetical protein HMPREF1012_02725 [Bacillus sp. BT1B_CT2]
 gi|81384760|sp|Q65FU4|Y5307_BACLD RecName: Full=UPF0161 protein BLi03210/BL05307
 gi|52004766|gb|AAU24708.1| conserved protein YtjA [Bacillus licheniformis ATCC 14580]
 gi|52349436|gb|AAU42070.1| YtjA [Bacillus licheniformis ATCC 14580]
 gi|317390511|gb|EFV71317.1| hypothetical protein HMPREF1012_02725 [Bacillus sp. BT1B_CT2]
          Length = 75

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 30/74 (40%), Positives = 44/74 (59%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + + +IR YQ   S     +CR+ PTCS YG EAI ++G + G WLT+ R++KC+P 
Sbjct: 1   MKTVFLLLIRFYQKWISPALPPTCRFYPTCSNYGLEAIEKHGAFKGGWLTIKRILKCHPF 60

Query: 115 GSDGFDPVPDDLPP 128
              G DPVP+    
Sbjct: 61  HPGGIDPVPEKKQK 74


>gi|307133250|ref|YP_003885266.1| hypothetical protein Dda3937_01062 [Dickeya dadantii 3937]
 gi|306530779|gb|ADN00710.1| hypothetical protein Dda3937_01062 [Dickeya dadantii 3937]
          Length = 85

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 37/85 (43%), Positives = 51/85 (60%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
                + G  + IG+IR YQ   S + G  CR+ P+CS+YG EAI R+G+  GSWLTL R
Sbjct: 1   MAPSLSFGSRLLIGLIRGYQRFISPLLGPHCRFQPSCSQYGIEAIRRFGMIKGSWLTLKR 60

Query: 108 LIKCNPLGSDGFDPVPDDLPPKKNN 132
           ++KC+PL   G DPVP      + +
Sbjct: 61  VLKCHPLNPGGDDPVPPKPDNNREH 85


>gi|325965293|ref|YP_004243199.1| hypothetical protein Asphe3_39770 [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323471380|gb|ADX75065.1| conserved hypothetical protein TIGR00278 [Arthrobacter
           phenanthrenivorans Sphe3]
          Length = 131

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 30/74 (40%), Positives = 44/74 (59%)

Query: 50  FPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLI 109
           F   L R I I +++ Y+ + S ++G  CR+ P+CS Y  EA+  +G   GSWL L RL 
Sbjct: 22  FFWNLPRNILILLLKAYRKVISPLYGQVCRFFPSCSAYALEAVTVHGAVKGSWLALRRLG 81

Query: 110 KCNPLGSDGFDPVP 123
           +C+P  + G D VP
Sbjct: 82  RCHPWNAGGVDHVP 95


>gi|163803612|ref|ZP_02197478.1| putative inner membrane protein translocase component YidC [Vibrio
           sp. AND4]
 gi|159172606|gb|EDP57464.1| putative inner membrane protein translocase component YidC [Vibrio
           sp. AND4]
          Length = 85

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 47/82 (57%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
           P +    I IG+I +Y+   S + G  CR+ PTCS Y  EA+  +G   G WL+  RL+K
Sbjct: 4   PVSPFTWIAIGLINLYRWFISPLIGPRCRFTPTCSTYALEALRAHGFVKGCWLSGKRLLK 63

Query: 111 CNPLGSDGFDPVPDDLPPKKNN 132
           C+PL   G+DPVP      ++N
Sbjct: 64  CHPLNEGGYDPVPPAQKQDRDN 85


>gi|320539851|ref|ZP_08039510.1| hypothetical protein SSYM_1704 [Serratia symbiotica str. Tucson]
 gi|320030037|gb|EFW12057.1| hypothetical protein SSYM_1704 [Serratia symbiotica str. Tucson]
          Length = 85

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 35/82 (42%), Positives = 51/82 (62%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
           P + G  I IG++R YQ + S + G  CR+ PTCS Y  EA++++G+  GSWL L R++K
Sbjct: 4   PLSPGSRILIGLVRAYQFVISPLLGPRCRFQPTCSHYTIEALSQFGMIKGSWLALKRILK 63

Query: 111 CNPLGSDGFDPVPDDLPPKKNN 132
           C+PL   G DPVP      + +
Sbjct: 64  CHPLNPGGDDPVPPKTDDNREH 85


>gi|332525675|ref|ZP_08401824.1| hypothetical protein RBXJA2T_07508 [Rubrivivax benzoatilyticus JA2]
 gi|332109234|gb|EGJ10157.1| hypothetical protein RBXJA2T_07508 [Rubrivivax benzoatilyticus JA2]
          Length = 100

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 31/74 (41%), Positives = 48/74 (64%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           L R + + ++R Y+L+     GN+CR+ PTCS+Y  +A+ R+G   GS LT+ RL++C+P
Sbjct: 8   LPRHLLVLLVRGYRLLLKPWLGNACRFEPTCSQYALDALDRHGAARGSALTVWRLLRCHP 67

Query: 114 LGSDGFDPVPDDLP 127
               G DPVP+  P
Sbjct: 68  WCDGGCDPVPERFP 81


>gi|212712608|ref|ZP_03320736.1| hypothetical protein PROVALCAL_03703 [Providencia alcalifaciens DSM
           30120]
 gi|212684824|gb|EEB44352.1| hypothetical protein PROVALCAL_03703 [Providencia alcalifaciens DSM
           30120]
          Length = 86

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 40/84 (47%), Positives = 55/84 (65%), Gaps = 3/84 (3%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           +LG  + I +IR YQL  S + G  CR+ PTCS YG EA+ R+G+  GSWLT  R++KC+
Sbjct: 6   SLGSKVLIMLIRGYQLAISPLLGPRCRFNPTCSNYGIEALRRFGMLKGSWLTAKRVLKCH 65

Query: 113 PLGSDGFDPVPDDLPPKKNNPKLL 136
           PL + G DPVP   P K ++ + L
Sbjct: 66  PLHAGGDDPVP---PRKTDDNREL 86


>gi|262374716|ref|ZP_06067988.1| conserved hypothetical protein [Acinetobacter junii SH205]
 gi|262310372|gb|EEY91464.1| conserved hypothetical protein [Acinetobacter junii SH205]
          Length = 106

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 29/65 (44%), Positives = 41/65 (63%)

Query: 61  GIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFD 120
            +IR YQ+  S + G  CRY+PTCS+Y  EA+  +G   G WL+  R+ +C+P G  G+D
Sbjct: 7   WLIRCYQIAISPLLGPRCRYIPTCSQYALEALQTHGAAKGVWLSTKRICRCHPWGGSGYD 66

Query: 121 PVPDD 125
           PVP  
Sbjct: 67  PVPPK 71


>gi|14285476|sp|Q44066|HLYA_AERHY RecName: Full=Putative alpha-hemolysin
 gi|1005414|gb|AAB81225.1| alpha-hemolysin [Aeromonas hydrophila]
          Length = 85

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 35/71 (49%), Positives = 49/71 (69%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           + G  + I +IR+YQ + S + G  CR+ PTCS YG EA+ R+G+  GSWLT+ R++KC+
Sbjct: 6   SPGSRVLIALIRVYQRLISPLLGPHCRFTPTCSSYGIEALRRFGVIKGSWLTVKRVLKCH 65

Query: 113 PLGSDGFDPVP 123
           PL   G DPVP
Sbjct: 66  PLHPGGDDPVP 76


>gi|240850679|ref|YP_002972079.1| hypothetical protein Bgr_11350 [Bartonella grahamii as4aup]
 gi|240267802|gb|ACS51390.1| hypothetical protein Bgr_11350 [Bartonella grahamii as4aup]
          Length = 116

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 49/81 (60%), Positives = 64/81 (79%)

Query: 43  SRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSW 102
           +RN+ G + KT GRL+GI +IR YQ+  S++ GN CR+ PTCSEY YEAIAR+GLW G+W
Sbjct: 12  TRNYTGTWQKTPGRLLGIFLIRFYQITLSSLIGNQCRHAPTCSEYTYEAIARHGLWAGAW 71

Query: 103 LTLLRLIKCNPLGSDGFDPVP 123
           + L R+I+C P G+DGFDPVP
Sbjct: 72  MGLFRIIRCGPFGTDGFDPVP 92


>gi|119512903|ref|ZP_01631967.1| hypothetical protein N9414_07129 [Nodularia spumigena CCY9414]
 gi|119462441|gb|EAW43414.1| hypothetical protein N9414_07129 [Nodularia spumigena CCY9414]
          Length = 95

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 47/70 (67%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +L+ I +I+ Y++  S +F  +CR+ PTCS Y  EAI R+G+W G W+   R+++C+P 
Sbjct: 1   MKLLFIWLIKGYRMFISPLFPPTCRFQPTCSMYAIEAIERFGIWRGGWMATRRILRCHPF 60

Query: 115 GSDGFDPVPD 124
              G+DPVP+
Sbjct: 61  HPGGYDPVPE 70


>gi|186686387|ref|YP_001869583.1| hypothetical protein Npun_R6368 [Nostoc punctiforme PCC 73102]
 gi|226707982|sp|B2IY41|Y6368_NOSP7 RecName: Full=UPF0161 protein Npun_R6368
 gi|186468839|gb|ACC84640.1| protein of unknown function DUF37 [Nostoc punctiforme PCC 73102]
          Length = 78

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 31/76 (40%), Positives = 49/76 (64%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +L+ I +IR Y++  S +F  +CR+ PTCS Y  EAI R+G+  GSW+   R+++C+P 
Sbjct: 1   MKLLFIWLIRGYRMFISPLFLPTCRFQPTCSMYAIEAIERFGVLRGSWMATRRILRCHPF 60

Query: 115 GSDGFDPVPDDLPPKK 130
              G+DPVP+ +   K
Sbjct: 61  HPGGYDPVPEVVEKVK 76


>gi|312879851|ref|ZP_07739651.1| protein of unknown function DUF37 [Aminomonas paucivorans DSM
           12260]
 gi|310783142|gb|EFQ23540.1| protein of unknown function DUF37 [Aminomonas paucivorans DSM
           12260]
          Length = 84

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 44/67 (65%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
           + +G +R YQ   S + G++CR+ PTCS+Y  EA+ R+GL  G WL   R+++C P    
Sbjct: 1   MAMGAVRFYQRWISPLLGDNCRFHPTCSQYMVEALGRFGLLKGLWLGTARILRCGPWHPG 60

Query: 118 GFDPVPD 124
           G+DPVP+
Sbjct: 61  GYDPVPE 67


>gi|83594667|ref|YP_428419.1| hypothetical protein Rru_A3338 [Rhodospirillum rubrum ATCC 11170]
 gi|116256227|sp|Q2RP13|Y3338_RHORT RecName: Full=UPF0161 protein Rru_A3338
 gi|83577581|gb|ABC24132.1| Protein of unknown function DUF37 [Rhodospirillum rubrum ATCC
           11170]
          Length = 115

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 33/74 (44%), Positives = 49/74 (66%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
           L+  G+I +Y+L  S + G +CR+ P+CS Y  EAI R+G + G WL + R+ +C+P G 
Sbjct: 13  LLMRGLIWLYRLFLSPLLGQNCRFDPSCSRYALEAITRHGPFWGLWLAVRRISRCHPWGG 72

Query: 117 DGFDPVPDDLPPKK 130
            G+DPVPDD  P +
Sbjct: 73  MGYDPVPDDPRPGR 86


>gi|16767126|ref|NP_462741.1| hypothetical protein STM3841 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|56415714|ref|YP_152789.1| hypothetical protein SPA3685 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|74314019|ref|YP_312438.1| hypothetical protein SSON_3655 [Shigella sonnei Ss046]
 gi|82546031|ref|YP_409978.1| hypothetical protein SBO_3672 [Shigella boydii Sb227]
 gi|82779234|ref|YP_405583.1| hypothetical protein SDY_4187 [Shigella dysenteriae Sd197]
 gi|89110308|ref|AP_004088.1| hypothetical protein [Escherichia coli str. K-12 substr. W3110]
 gi|91213229|ref|YP_543215.1| hypothetical protein UTI89_C4257 [Escherichia coli UTI89]
 gi|94541129|ref|YP_588472.1| conserved protein, UPF0161 family [Escherichia coli str. K-12
           substr. MG1655]
 gi|157163185|ref|YP_001460503.1| hypothetical protein EcHS_A3918 [Escherichia coli HS]
 gi|170022259|ref|YP_001727213.1| hypothetical protein EcolC_4290 [Escherichia coli ATCC 8739]
 gi|170083206|ref|YP_001732526.1| hypothetical protein ECDH10B_3891 [Escherichia coli str. K-12
           substr. DH10B]
 gi|197364642|ref|YP_002144279.1| hypothetical protein SSPA3440 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|205354572|ref|YP_002228373.1| hypothetical protein SG3590 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207859067|ref|YP_002245718.1| hypothetical protein SEN3658 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|213026874|ref|ZP_03341321.1| hypothetical protein Salmonelentericaenterica_32305 [Salmonella
           enterica subsp. enterica serovar Typhi str. 404ty]
 gi|213052694|ref|ZP_03345572.1| hypothetical protein Salmoneentericaenterica_07141 [Salmonella
           enterica subsp. enterica serovar Typhi str. E00-7866]
 gi|213424949|ref|ZP_03357699.1| hypothetical protein SentesTyphi_04160 [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213648782|ref|ZP_03378835.1| hypothetical protein SentesTy_16743 [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213865389|ref|ZP_03387508.1| hypothetical protein SentesT_36878 [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|218551235|ref|YP_002385027.1| hypothetical protein EFER_4001 [Escherichia fergusonii ATCC 35469]
 gi|218556271|ref|YP_002389185.1| hypothetical protein ECIAI1_3884 [Escherichia coli IAI1]
 gi|218560780|ref|YP_002393693.1| hypothetical protein ECS88_4128 [Escherichia coli S88]
 gi|218691993|ref|YP_002400205.1| hypothetical protein ECED1_4396 [Escherichia coli ED1a]
 gi|218697427|ref|YP_002405094.1| hypothetical protein EC55989_4175 [Escherichia coli 55989]
 gi|218702554|ref|YP_002410183.1| hypothetical protein ECIAI39_4309 [Escherichia coli IAI39]
 gi|218707351|ref|YP_002414870.1| hypothetical protein ECUMN_4236 [Escherichia coli UMN026]
 gi|224585640|ref|YP_002639439.1| hypothetical protein SPC_3928 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|238902795|ref|YP_002928591.1| hypothetical protein BWG_3395 [Escherichia coli BW2952]
 gi|238913093|ref|ZP_04656930.1| hypothetical protein SentesTe_18460 [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|253775661|ref|YP_003038492.1| hypothetical protein ECBD_4328 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254163656|ref|YP_003046764.1| hypothetical protein ECB_03588 [Escherichia coli B str. REL606]
 gi|256021277|ref|ZP_05435142.1| hypothetical protein ShiD9_20320 [Shigella sp. D9]
 gi|256025564|ref|ZP_05439429.1| hypothetical protein E4_19482 [Escherichia sp. 4_1_40B]
 gi|289826407|ref|ZP_06545519.1| hypothetical protein Salmonellentericaenterica_13755 [Salmonella
           enterica subsp. enterica serovar Typhi str. E98-3139]
 gi|293464028|ref|ZP_06664442.1| hypothetical protein ECCG_04110 [Escherichia coli B088]
 gi|297521629|ref|ZP_06940015.1| hypothetical protein EcolOP_28574 [Escherichia coli OP50]
 gi|300903019|ref|ZP_07120961.1| hypothetical protein HMPREF9536_01161 [Escherichia coli MS 84-1]
 gi|301644377|ref|ZP_07244378.1| conserved hypothetical protein YidD [Escherichia coli MS 146-1]
 gi|306815942|ref|ZP_07450080.1| hypothetical protein ECNC101_04999 [Escherichia coli NC101]
 gi|307140405|ref|ZP_07499761.1| hypothetical protein EcolH7_19972 [Escherichia coli H736]
 gi|331644429|ref|ZP_08345558.1| putative alpha-hemolysin [Escherichia coli H736]
 gi|331649532|ref|ZP_08350618.1| putative alpha-hemolysin [Escherichia coli M605]
 gi|331655366|ref|ZP_08356365.1| putative alpha-hemolysin [Escherichia coli M718]
 gi|331660048|ref|ZP_08360986.1| putative alpha-hemolysin [Escherichia coli TA206]
 gi|331665355|ref|ZP_08366256.1| putative alpha-hemolysin [Escherichia coli TA143]
 gi|331670549|ref|ZP_08371388.1| putative alpha-hemolysin [Escherichia coli TA271]
 gi|331675196|ref|ZP_08375949.1| putative alpha-hemolysin [Escherichia coli TA280]
 gi|331679803|ref|ZP_08380473.1| putative alpha-hemolysin [Escherichia coli H591]
 gi|331685429|ref|ZP_08386015.1| putative alpha-hemolysin [Escherichia coli H299]
 gi|332282506|ref|ZP_08394919.1| conserved hypothetical protein [Shigella sp. D9]
 gi|47606242|sp|P61472|YIDD_SALTI RecName: Full=UPF0161 protein yidD
 gi|67476547|sp|P0A8C8|YIDD_ECOLI RecName: Full=UPF0161 protein yidD
 gi|67476550|sp|P0A8C9|YIDD_SALTY RecName: Full=UPF0161 protein yidD
 gi|81361370|sp|Q5PKU3|YIDD_SALPA RecName: Full=UPF0161 protein yidD
 gi|116256233|sp|Q3YWA9|YIDD_SHISS RecName: Full=UPF0161 protein yidD
 gi|116256235|sp|Q31UV8|YIDD_SHIBS RecName: Full=UPF0161 protein yidD
 gi|116256239|sp|Q329B3|YIDD_SHIDS RecName: Full=UPF0161 protein yidD
 gi|116256243|sp|Q1R4N0|YIDD_ECOUT RecName: Full=UPF0161 protein yidD
 gi|166979895|sp|A8A6G6|YIDD_ECOHS RecName: Full=UPF0161 protein yidD
 gi|189030252|sp|B1IX34|YIDD_ECOLC RecName: Full=UPF0161 protein yidD
 gi|226730949|sp|B7MGC6|YIDD_ECO45 RecName: Full=UPF0161 protein yidD
 gi|226730950|sp|B7NR07|YIDD_ECO7I RecName: Full=UPF0161 protein yidD
 gi|226731031|sp|B7M557|YIDD_ECO8A RecName: Full=UPF0161 protein yidD
 gi|226731032|sp|B1X9T3|YIDD_ECODH RecName: Full=UPF0161 protein yidD
 gi|226731033|sp|B7NF22|YIDD_ECOLU RecName: Full=UPF0161 protein yidD
 gi|226731034|sp|B7LK47|YIDD_ESCF3 RecName: Full=UPF0161 protein yidD
 gi|226731035|sp|B5QUQ3|YIDD_SALEP RecName: Full=UPF0161 protein yidD
 gi|226731036|sp|B5RFY4|YIDD_SALG2 RecName: Full=UPF0161 protein yidD
 gi|226731037|sp|B5BIL7|YIDD_SALPK RecName: Full=UPF0161 protein yidD
 gi|254765634|sp|B7L848|YIDD_ECO55 RecName: Full=UPF0161 protein yidD
 gi|254765635|sp|B7N2F0|YIDD_ECO81 RecName: Full=UPF0161 protein yidD
 gi|254765636|sp|C0Q2L2|YIDD_SALPC RecName: Full=UPF0161 protein yidD
 gi|259710266|sp|C4ZYY2|YIDD_ECOBW RecName: Full=UPF0161 protein yidD
 gi|16422415|gb|AAL22700.1| putative inner membrane protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|56129971|gb|AAV79477.1| putative inner membrane protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|73857496|gb|AAZ90203.1| Uncharacterized conserved protein [Shigella sonnei Ss046]
 gi|81243382|gb|ABB64092.1| Uncharacterized conserved protein [Shigella dysenteriae Sd197]
 gi|81247442|gb|ABB68150.1| Uncharacterized conserved protein [Shigella boydii Sb227]
 gi|85676339|dbj|BAE77589.1| hypothetical protein [Escherichia coli str. K12 substr. W3110]
 gi|87082322|gb|ABD18707.1| conserved protein, UPF0161 family [Escherichia coli str. K-12
           substr. MG1655]
 gi|91074803|gb|ABE09684.1| hypothetical protein UTI89_C4257 [Escherichia coli UTI89]
 gi|157068865|gb|ABV08120.1| conserved hypothetical protein [Escherichia coli HS]
 gi|169757187|gb|ACA79886.1| protein of unknown function DUF37 [Escherichia coli ATCC 8739]
 gi|169891041|gb|ACB04748.1| predicted protein [Escherichia coli str. K-12 substr. DH10B]
 gi|197096119|emb|CAR61715.1| putative inner membrane protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|205274353|emb|CAR39378.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|206710870|emb|CAR35234.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|218354159|emb|CAV00762.1| conserved hypothetical protein [Escherichia coli 55989]
 gi|218358777|emb|CAQ91435.1| conserved hypothetical protein [Escherichia fergusonii ATCC 35469]
 gi|218363040|emb|CAR00679.1| conserved hypothetical protein [Escherichia coli IAI1]
 gi|218367549|emb|CAR05334.1| conserved hypothetical protein [Escherichia coli S88]
 gi|218372540|emb|CAR20415.1| conserved hypothetical protein [Escherichia coli IAI39]
 gi|218429557|emb|CAR10521.2| conserved hypothetical protein [Escherichia coli ED1a]
 gi|218434448|emb|CAR15376.1| conserved hypothetical protein [Escherichia coli UMN026]
 gi|222035419|emb|CAP78164.1| UPF0161 protein yidD [Escherichia coli LF82]
 gi|224470168|gb|ACN47998.1| hypothetical protein SPC_3928 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|238863048|gb|ACR65046.1| predicted protein [Escherichia coli BW2952]
 gi|242379244|emb|CAQ34049.1| predicted protein [Escherichia coli BL21(DE3)]
 gi|253326705|gb|ACT31307.1| protein of unknown function DUF37 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253975557|gb|ACT41228.1| hypothetical protein ECB_03588 [Escherichia coli B str. REL606]
 gi|253979713|gb|ACT45383.1| hypothetical protein ECD_03588 [Escherichia coli BL21(DE3)]
 gi|261248982|emb|CBG26839.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267996128|gb|ACY91013.1| hypothetical protein STM14_4636 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|281603069|gb|ADA76053.1| protein yidD [Shigella flexneri 2002017]
 gi|284923788|emb|CBG36886.1| conserved hypothetical protein [Escherichia coli 042]
 gi|291321660|gb|EFE61096.1| hypothetical protein ECCG_04110 [Escherichia coli B088]
 gi|300404925|gb|EFJ88463.1| hypothetical protein HMPREF9536_01161 [Escherichia coli MS 84-1]
 gi|301077318|gb|EFK92124.1| conserved hypothetical protein YidD [Escherichia coli MS 146-1]
 gi|301160374|emb|CBW19899.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|305850338|gb|EFM50795.1| hypothetical protein ECNC101_04999 [Escherichia coli NC101]
 gi|307628781|gb|ADN73085.1| hypothetical protein UM146_18715 [Escherichia coli UM146]
 gi|309704152|emb|CBJ03499.1| conserved hypothetical protein [Escherichia coli ETEC H10407]
 gi|312914970|dbj|BAJ38944.1| hypothetical protein STMDT12_C40010 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|312948272|gb|ADR29099.1| hypothetical protein NRG857_18455 [Escherichia coli O83:H1 str. NRG
           857C]
 gi|315138289|dbj|BAJ45448.1| predicted protein [Escherichia coli DH1]
 gi|320088262|emb|CBY98024.1| UPF0161 protein Ent638_4150 [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
 gi|322617247|gb|EFY14152.1| hypothetical protein SEEM315_06475 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322619065|gb|EFY15951.1| hypothetical protein SEEM971_18729 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322625132|gb|EFY21960.1| hypothetical protein SEEM973_14679 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322630183|gb|EFY26954.1| hypothetical protein SEEM974_14063 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322634391|gb|EFY31125.1| hypothetical protein SEEM201_15809 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322635276|gb|EFY31991.1| hypothetical protein SEEM202_18772 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322642900|gb|EFY39484.1| hypothetical protein SEEM954_04183 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322647620|gb|EFY44107.1| hypothetical protein SEEM054_00660 [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322650574|gb|EFY46981.1| hypothetical protein SEEM675_22289 [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322656400|gb|EFY52692.1| hypothetical protein SEEM965_22924 [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322661580|gb|EFY57803.1| hypothetical protein SEEM19N_04559 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322661661|gb|EFY57880.1| hypothetical protein SEEM801_08857 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322668225|gb|EFY64383.1| hypothetical protein SEEM507_19690 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322672846|gb|EFY68954.1| hypothetical protein SEEM877_07949 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322674973|gb|EFY71059.1| hypothetical protein SEEM867_02942 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322683663|gb|EFY79676.1| hypothetical protein SEEM180_08399 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322687739|gb|EFY83708.1| hypothetical protein SEEM600_19786 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323132202|gb|ADX19632.1| UPF0161 protein yidD [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|323192046|gb|EFZ77281.1| hypothetical protein SEEM581_08259 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323200528|gb|EFZ85606.1| hypothetical protein SEEM501_07772 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323204954|gb|EFZ89939.1| hypothetical protein SEEM460_03163 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323206697|gb|EFZ91654.1| hypothetical protein SEEM020_14591 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323211769|gb|EFZ96602.1| hypothetical protein SEEM6152_04690 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323218631|gb|EGA03338.1| hypothetical protein SEEM0077_06643 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323220032|gb|EGA04502.1| hypothetical protein SEEM0047_03424 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323224802|gb|EGA09067.1| hypothetical protein SEEM0055_13672 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323232489|gb|EGA16591.1| hypothetical protein SEEM0052_08676 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323235264|gb|EGA19349.1| hypothetical protein SEEM3312_12569 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323241052|gb|EGA25089.1| hypothetical protein SEEM5258_17530 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323241398|gb|EGA25430.1| hypothetical protein SEEM1156_10685 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323248629|gb|EGA32559.1| hypothetical protein SEEM9199_13884 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323252072|gb|EGA35932.1| hypothetical protein SEEM8282_05340 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323258624|gb|EGA42287.1| hypothetical protein SEEM8283_14135 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323262345|gb|EGA45903.1| hypothetical protein SEEM8284_00188 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323268181|gb|EGA51657.1| hypothetical protein SEEM8285_10116 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323270595|gb|EGA54040.1| hypothetical protein SEEM8287_10092 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|323380928|gb|ADX53196.1| protein of unknown function DUF37 [Escherichia coli KO11]
 gi|323934944|gb|EGB31322.1| yidD [Escherichia coli E1520]
 gi|323939232|gb|EGB35445.1| hypothetical protein ERDG_04207 [Escherichia coli E482]
 gi|323944177|gb|EGB40257.1| yidD [Escherichia coli H120]
 gi|323949949|gb|EGB45833.1| hypothetical protein ERKG_03792 [Escherichia coli H252]
 gi|323955000|gb|EGB50778.1| hypothetical protein ERLG_03718 [Escherichia coli H263]
 gi|323959770|gb|EGB55420.1| hypothetical protein ERGG_03721 [Escherichia coli H489]
 gi|323965766|gb|EGB61217.1| hypothetical protein ERJG_02838 [Escherichia coli M863]
 gi|323971182|gb|EGB66428.1| hypothetical protein ERHG_02799 [Escherichia coli TA007]
 gi|323975228|gb|EGB70332.1| hypothetical protein ERFG_03930 [Escherichia coli TW10509]
 gi|324111602|gb|EGC05583.1| hypothetical protein ERIG_03898 [Escherichia fergusonii B253]
 gi|324115943|gb|EGC09869.1| hypothetical protein ERBG_04030 [Escherichia coli E1167]
 gi|326629708|gb|EGE36051.1| UPF0161 protein yidD [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 9]
 gi|331036723|gb|EGI08949.1| putative alpha-hemolysin [Escherichia coli H736]
 gi|331042030|gb|EGI14174.1| putative alpha-hemolysin [Escherichia coli M605]
 gi|331047381|gb|EGI19459.1| putative alpha-hemolysin [Escherichia coli M718]
 gi|331053263|gb|EGI25296.1| putative alpha-hemolysin [Escherichia coli TA206]
 gi|331057865|gb|EGI29851.1| putative alpha-hemolysin [Escherichia coli TA143]
 gi|331062611|gb|EGI34531.1| putative alpha-hemolysin [Escherichia coli TA271]
 gi|331067641|gb|EGI39043.1| putative alpha-hemolysin [Escherichia coli TA280]
 gi|331072975|gb|EGI44300.1| putative alpha-hemolysin [Escherichia coli H591]
 gi|331077800|gb|EGI49012.1| putative alpha-hemolysin [Escherichia coli H299]
 gi|332104858|gb|EGJ08204.1| conserved hypothetical protein [Shigella sp. D9]
 gi|332990691|gb|AEF09674.1| hypothetical protein STMUK_3829 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 85

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 36/76 (47%), Positives = 50/76 (65%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
              P + G  + I +IR+YQ + S + G  CR+ PTCS YG EA+ R+G+  GSWLT+ R
Sbjct: 1   MAPPLSPGSRVLIALIRVYQRLISPLLGPHCRFTPTCSSYGIEALRRFGVIKGSWLTVKR 60

Query: 108 LIKCNPLGSDGFDPVP 123
           ++KC+PL   G DPVP
Sbjct: 61  VLKCHPLHPGGDDPVP 76


>gi|261363928|ref|ZP_05976811.1| putative toxin-antitoxin system, toxin component [Neisseria mucosa
           ATCC 25996]
 gi|288567941|gb|EFC89501.1| putative toxin-antitoxin system, toxin component [Neisseria mucosa
           ATCC 25996]
          Length = 73

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 42/73 (57%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
             TL     + +IR YQ   S +    CRY PTCS+Y  EA+ +YG + G WL + R+ +
Sbjct: 1   MNTLLSKFILALIRFYQYAISPLIPPRCRYTPTCSQYAVEAVKKYGAFKGGWLAVKRIAR 60

Query: 111 CNPLGSDGFDPVP 123
           C+P G  G DPVP
Sbjct: 61  CHPFGGHGHDPVP 73


>gi|116256241|sp|Q3M5B5|Y4222_ANAVT RecName: Full=UPF0161 protein Ava_4222
          Length = 82

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 47/70 (67%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I +I+ Y++  S +F  +CR+ PTCS Y  EAI R+G++ G W+ + R+++C+P 
Sbjct: 1   MKQIFIWLIKGYRMFISPLFPPTCRFQPTCSMYALEAIERFGVFRGGWMGIRRILRCHPF 60

Query: 115 GSDGFDPVPD 124
              G+DPVP+
Sbjct: 61  HPGGYDPVPE 70


>gi|159902950|ref|YP_001550294.1| ribonuclease P [Prochlorococcus marinus str. MIT 9211]
 gi|159888126|gb|ABX08340.1| ribonuclease P [Prochlorococcus marinus str. MIT 9211]
          Length = 88

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 35/73 (47%), Positives = 46/73 (63%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
               R+  +  IR YQ   S + G +CR++PTCSEYG EAI+R+G   G WLT+ RL +C
Sbjct: 16  NNAMRMFLLAFIRFYQRWISPLMGPNCRFIPTCSEYGVEAISRHGPLKGGWLTMKRLSRC 75

Query: 112 NPLGSDGFDPVPD 124
           +P    G DPVPD
Sbjct: 76  HPFTPCGCDPVPD 88


>gi|87125590|ref|ZP_01081435.1| hypothetical protein RS9917_02416 [Synechococcus sp. RS9917]
 gi|86166890|gb|EAQ68152.1| hypothetical protein RS9917_02416 [Synechococcus sp. RS9917]
          Length = 99

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 57/97 (58%), Gaps = 3/97 (3%)

Query: 31  GSPLLLKNNTPKSRNWNGKFPKTLGRLI---GIGIIRIYQLIFSNVFGNSCRYLPTCSEY 87
           G    L+    +S   +G FP  + RLI    + +I +Y+  FS + G  CR++P+CS Y
Sbjct: 3   GKRPRLRLRMRESTTLSGGFPAQINRLISGLLLALIGVYRRWFSPLLGPRCRFIPSCSAY 62

Query: 88  GYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVPD 124
           G EAI R+G W G WLTL RL +C+P    G DPVPD
Sbjct: 63  GLEAIQRHGPWRGGWLTLRRLSRCHPFTPCGCDPVPD 99


>gi|298369730|ref|ZP_06981047.1| hypothetical protein HMPREF9016_02171 [Neisseria sp. oral taxon 014
           str. F0314]
 gi|298282287|gb|EFI23775.1| hypothetical protein HMPREF9016_02171 [Neisseria sp. oral taxon 014
           str. F0314]
          Length = 72

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 32/70 (45%), Positives = 43/70 (61%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           L   I +G+IR YQ   S +    CRY PTCS+Y  EA+ +YG + G WL + R+ +C+P
Sbjct: 3   LTAKIMLGLIRFYQYAVSPLIPPRCRYTPTCSQYALEAVKKYGAFKGGWLAVKRIARCHP 62

Query: 114 LGSDGFDPVP 123
            G  G DPVP
Sbjct: 63  FGGSGHDPVP 72


>gi|257065516|ref|YP_003145188.1| conserved hypothetical protein TIGR00278 [Slackia
           heliotrinireducens DSM 20476]
 gi|256793169|gb|ACV23839.1| conserved hypothetical protein TIGR00278 [Slackia
           heliotrinireducens DSM 20476]
          Length = 77

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 32/72 (44%), Positives = 46/72 (63%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           +   + I +IR Y+   S +F + CRY PTCS+YG  AI R+G   GSWLT+ R+ +C+P
Sbjct: 1   MPANLAILLIRFYRAAISPLFPSCCRYTPTCSQYGIIAIKRFGFLKGSWLTIKRISRCHP 60

Query: 114 LGSDGFDPVPDD 125
               G+DPVP+ 
Sbjct: 61  WHEGGYDPVPEK 72


>gi|304398071|ref|ZP_07379946.1| protein of unknown function DUF37 [Pantoea sp. aB]
 gi|308188768|ref|YP_003932899.1| UPF0161 protein [Pantoea vagans C9-1]
 gi|304354357|gb|EFM18729.1| protein of unknown function DUF37 [Pantoea sp. aB]
 gi|308059278|gb|ADO11450.1| UPF0161 protein [Pantoea vagans C9-1]
          Length = 85

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 37/73 (50%), Positives = 48/73 (65%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           + G  + I +IR+YQ   S + G  CR+ PTCS YG EA+ R+GL  GSWLTL R++KC+
Sbjct: 6   SPGARLLIVLIRVYQRGISPLLGPHCRFHPTCSHYGIEALRRFGLIKGSWLTLKRVLKCH 65

Query: 113 PLGSDGFDPVPDD 125
           PL   G DPVP  
Sbjct: 66  PLNPGGDDPVPPK 78


>gi|251791813|ref|YP_003006534.1| hypothetical protein Dd1591_4265 [Dickeya zeae Ech1591]
 gi|271502720|ref|YP_003335746.1| hypothetical protein Dd586_4214 [Dickeya dadantii Ech586]
 gi|247540434|gb|ACT09055.1| protein of unknown function DUF37 [Dickeya zeae Ech1591]
 gi|270346275|gb|ACZ79040.1| protein of unknown function DUF37 [Dickeya dadantii Ech586]
          Length = 85

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 36/85 (42%), Positives = 50/85 (58%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
                + G  + IG+IR YQ   S + G  CR+ P+CS+YG EAI R+G+  G WLTL R
Sbjct: 1   MAPSLSFGSRLLIGLIRGYQRFISPLLGPHCRFQPSCSQYGIEAIRRFGMIKGCWLTLKR 60

Query: 108 LIKCNPLGSDGFDPVPDDLPPKKNN 132
           ++KC+PL   G DPVP      + +
Sbjct: 61  VLKCHPLNPGGDDPVPPKPDNNREH 85


>gi|56964271|ref|YP_176002.1| hypothetical protein ABC2506 [Bacillus clausii KSM-K16]
 gi|81365832|sp|Q5WF19|Y2506_BACSK RecName: Full=UPF0161 protein ABC2506
 gi|56910514|dbj|BAD65041.1| conserved hypothetical protein [Bacillus clausii KSM-K16]
          Length = 80

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 45/79 (56%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R + I IIR+YQ   S +   SCR+ PTCS YG EAI  +G   GS+L + R++KC+P 
Sbjct: 1   MRKLLIQIIRLYQRFISPLTPPSCRFYPTCSAYGIEAIETHGAIKGSYLAIKRILKCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNNP 133
              G DPVP+    K    
Sbjct: 61  HPGGVDPVPECQHTKHKKT 79


>gi|46198384|ref|YP_004051.1| alpha-hemolysin [Thermus thermophilus HB27]
 gi|55980413|ref|YP_143710.1| alpha-hemolysin [Thermus thermophilus HB8]
 gi|81364531|sp|Q5SL49|Y444_THET8 RecName: Full=UPF0161 protein TTHA0444
 gi|81406314|sp|Q72LI3|Y076_THET2 RecName: Full=UPF0161 protein TT_C0076
 gi|46196006|gb|AAS80424.1| alpha-hemolysin [Thermus thermophilus HB27]
 gi|55771826|dbj|BAD70267.1| alpha-hemolysin [Thermus thermophilus HB8]
          Length = 82

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 31/76 (40%), Positives = 46/76 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R + I +IR Y+   S +   +CR+ PTCS Y  EA+ R+G + GS+L + R+++C+P 
Sbjct: 1   MREVLILLIRFYRRFLSPLKPRTCRFHPTCSAYALEALERHGAFWGSYLAVRRVLRCHPW 60

Query: 115 GSDGFDPVPDDLPPKK 130
              G DPVP   PP K
Sbjct: 61  NPGGLDPVPVLFPPGK 76


>gi|85060408|ref|YP_456110.1| hypothetical protein SG2430 [Sodalis glossinidius str. 'morsitans']
 gi|116256202|sp|Q2NQ70|Y2430_SODGM RecName: Full=UPF0161 protein SG2430
 gi|84780928|dbj|BAE75705.1| conserved hypothetical protein [Sodalis glossinidius str.
           'morsitans']
          Length = 85

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 39/78 (50%), Positives = 51/78 (65%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
              P +    + IG+IR YQL+ S + G  CR+ PTCS+YG EAI R+G+  GSWLTL R
Sbjct: 1   MAPPLSPVSKLLIGLIRGYQLVISPLLGPHCRFRPTCSQYGIEAIRRFGMLKGSWLTLKR 60

Query: 108 LIKCNPLGSDGFDPVPDD 125
           ++KC+PL   G DPVP  
Sbjct: 61  VLKCHPLNPGGEDPVPPK 78


>gi|255066612|ref|ZP_05318467.1| putative toxin-antitoxin system, toxin component [Neisseria sicca
           ATCC 29256]
 gi|255049196|gb|EET44660.1| putative toxin-antitoxin system, toxin component [Neisseria sicca
           ATCC 29256]
          Length = 73

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 32/73 (43%), Positives = 42/73 (57%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
             TL     + +IR YQ   S +    CRY PTCS+Y  EA+ +YG + G WL L R+ +
Sbjct: 1   MNTLLSKFILALIRFYQYAVSPLIPPRCRYTPTCSQYAVEAVKKYGAFKGGWLALKRIAR 60

Query: 111 CNPLGSDGFDPVP 123
           C+P G  G DPVP
Sbjct: 61  CHPFGGHGHDPVP 73


>gi|89099696|ref|ZP_01172570.1| hypothetical protein B14911_24310 [Bacillus sp. NRRL B-14911]
 gi|89085639|gb|EAR64766.1| hypothetical protein B14911_24310 [Bacillus sp. NRRL B-14911]
          Length = 79

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 48/78 (61%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            + + + + IG+IR YQ+  S +   SCR+ PTCS YG EA+ R+G + G WL + R+ K
Sbjct: 2   RQYMLQKMMIGLIRFYQIAISPLKPPSCRFYPTCSHYGLEAVKRFGPFKGGWLAVRRITK 61

Query: 111 CNPLGSDGFDPVPDDLPP 128
           C+P    GFDPVP+    
Sbjct: 62  CHPFHPGGFDPVPEKNEK 79


>gi|209549441|ref|YP_002281358.1| hypothetical protein Rleg2_1847 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209535197|gb|ACI55132.1| protein of unknown function DUF37 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 134

 Score =  111 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 50/84 (59%), Positives = 63/84 (75%)

Query: 43  SRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSW 102
           SRN+ G F KT  RL+G+G IR+YQL  S   GNSCR++PTCSEYGYE+IAR+GLW G W
Sbjct: 31  SRNYAGPFRKTPDRLLGMGFIRLYQLTLSGFIGNSCRHIPTCSEYGYESIARHGLWAGGW 90

Query: 103 LTLLRLIKCNPLGSDGFDPVPDDL 126
           +TL R+ +C P G+ G D VP+ L
Sbjct: 91  MTLFRVGRCGPGGTSGLDQVPEIL 114


>gi|225016763|ref|ZP_03705955.1| hypothetical protein CLOSTMETH_00675 [Clostridium methylpentosum
           DSM 5476]
 gi|224950431|gb|EEG31640.1| hypothetical protein CLOSTMETH_00675 [Clostridium methylpentosum
           DSM 5476]
          Length = 81

 Score =  111 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 37/85 (43%), Positives = 51/85 (60%), Gaps = 4/85 (4%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I +GIIR YQ   S +F  +CR+ PTCS+Y +EAI+ +G   GS+L + R++KC+P 
Sbjct: 1   MKKILMGIIRFYQKAISPLFPPTCRFYPTCSQYAFEAISVHGALKGSYLAIRRILKCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNNPKLLSKK 139
              G DPVP    PKK       KK
Sbjct: 61  HKGGIDPVP----PKKERGNTGKKK 81


>gi|195936327|ref|ZP_03081709.1| hypothetical protein EscherichcoliO157_07653 [Escherichia coli
           O157:H7 str. EC4024]
 gi|261225858|ref|ZP_05940139.1| hypothetical protein EscherichiacoliO157_14833 [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261258903|ref|ZP_05951436.1| hypothetical protein EscherichiacoliO157EcO_24322 [Escherichia coli
           O157:H7 str. FRIK966]
 gi|47606238|sp|P61468|YIDD_ECO57 RecName: Full=UPF0161 protein yidD
 gi|320639430|gb|EFX09045.1| hypothetical protein ECO5101_06023 [Escherichia coli O157:H7 str.
           G5101]
 gi|320644873|gb|EFX13909.1| hypothetical protein ECO9389_11925 [Escherichia coli O157:H- str.
           493-89]
 gi|320650137|gb|EFX18633.1| hypothetical protein ECO2687_17380 [Escherichia coli O157:H- str. H
           2687]
 gi|320655485|gb|EFX23420.1| hypothetical protein ECO7815_14577 [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320661111|gb|EFX28547.1| hypothetical protein ECO5905_17618 [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320666237|gb|EFX33243.1| hypothetical protein ECOSU61_05051 [Escherichia coli O157:H7 str.
           LSU-61]
          Length = 85

 Score =  111 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 36/76 (47%), Positives = 50/76 (65%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
              P + G  + I +IR+YQ + S + G  CR+ PTCS YG EA+ R+G+  GSWLT+ R
Sbjct: 1   MAPPLSPGSRVLIALIRVYQRLISPLLGPHCRFTPTCSSYGIEALRRFGVIKGSWLTVKR 60

Query: 108 LIKCNPLGSDGFDPVP 123
           ++KC+PL   G DPVP
Sbjct: 61  VLKCHPLHPGGDDPVP 76


>gi|157693462|ref|YP_001487924.1| hypothetical protein BPUM_2706 [Bacillus pumilus SAFR-032]
 gi|194017845|ref|ZP_03056454.1| conserved hypothetical protein [Bacillus pumilus ATCC 7061]
 gi|166988513|sp|A8FGJ7|Y2706_BACP2 RecName: Full=UPF0161 protein BPUM_2706
 gi|157682220|gb|ABV63364.1| hypothetical protein BPUM_2706 [Bacillus pumilus SAFR-032]
 gi|194010497|gb|EDW20070.1| conserved hypothetical protein [Bacillus pumilus ATCC 7061]
          Length = 74

 Score =  111 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 36/74 (48%), Positives = 44/74 (59%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I IGIIR YQ   S +   SCR+ PTCS YG EAI  +G   G WLT+ R++KC+PL
Sbjct: 1   MKQIFIGIIRFYQKCISPLTPPSCRFYPTCSNYGLEAIKTHGALKGGWLTIKRILKCHPL 60

Query: 115 GSDGFDPVPDDLPP 128
              G DPVP     
Sbjct: 61  HPGGIDPVPPKKEK 74


>gi|331701234|ref|YP_004398193.1| hypothetical protein Lbuc_0871 [Lactobacillus buchneri NRRL
           B-30929]
 gi|329128577|gb|AEB73130.1| UPF0161 protein yidD [Lactobacillus buchneri NRRL B-30929]
          Length = 91

 Score =  111 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 45/78 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I ++  YQ   S +F  +CRY PTCS Y   A+ ++G + G+ + + R+++C+P 
Sbjct: 1   MKNILISLVHGYQRFISPLFPPTCRYYPTCSSYMVTALKKHGAFKGAVMGIARILRCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G+DPVPD     +N 
Sbjct: 61  VKGGYDPVPDHFTIFRNK 78


>gi|255580315|ref|XP_002530986.1| conserved hypothetical protein [Ricinus communis]
 gi|223529438|gb|EEF31398.1| conserved hypothetical protein [Ricinus communis]
          Length = 175

 Score =  111 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 52/97 (53%), Gaps = 3/97 (3%)

Query: 28  QKKGSPLLLKNNTPKSRNWNGKFP---KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTC 84
            K  S  L+ N    S N N +       LG    + +++ Y+   S +  NSCRY+PTC
Sbjct: 67  PKHRSRRLVVNKLDTSSNQNNQQDEEVNNLGVKAALSMLKFYKREISPLLPNSCRYVPTC 126

Query: 85  SEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDP 121
           SEY   A  +YG+  G+ LT  RL +CNPLG  GFDP
Sbjct: 127 SEYSMIAYKKYGVVKGTVLTAWRLCRCNPLGGSGFDP 163


>gi|325104483|ref|YP_004274137.1| protein of unknown function DUF37 [Pedobacter saltans DSM 12145]
 gi|324973331|gb|ADY52315.1| protein of unknown function DUF37 [Pedobacter saltans DSM 12145]
          Length = 77

 Score =  111 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 34/75 (45%), Positives = 48/75 (64%)

Query: 49  KFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRL 108
              K +     + +I++YQ + S + G SCRY PTCS+YG EAI +YG + G WLT+ R+
Sbjct: 3   SILKKILSGFFLFLIKLYQYLLSPLLGASCRYTPTCSQYGIEAIKKYGPFKGFWLTVKRI 62

Query: 109 IKCNPLGSDGFDPVP 123
            +C+P G  G DPVP
Sbjct: 63  ARCHPWGGHGHDPVP 77


>gi|296271542|ref|YP_003654174.1| hypothetical protein Tbis_3594 [Thermobispora bispora DSM 43833]
 gi|296094329|gb|ADG90281.1| protein of unknown function DUF37 [Thermobispora bispora DSM 43833]
          Length = 107

 Score =  111 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 27/73 (36%), Positives = 42/73 (57%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
           P      + + +IR Y+     + G  CR+ P+CS Y  +AI+++G   G+WLT+ RL +
Sbjct: 22  PADPVARVLLAVIRFYRAFIGPLLGPHCRFWPSCSAYALQAISQHGPLRGTWLTMKRLGR 81

Query: 111 CNPLGSDGFDPVP 123
           C+P    G DPVP
Sbjct: 82  CHPFHPGGVDPVP 94


>gi|153873750|ref|ZP_02002228.1| protein containing DUF37 [Beggiatoa sp. PS]
 gi|152069786|gb|EDN67774.1| protein containing DUF37 [Beggiatoa sp. PS]
          Length = 75

 Score =  111 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 43/75 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I +IR YQL  S   G+ CR+LP+CSEY   AI  +G + G  L   R+ +C+P 
Sbjct: 1   MQKILIILIRGYQLFISPWLGSHCRFLPSCSEYTLIAIKTHGTFYGLVLGTKRIFRCHPW 60

Query: 115 GSDGFDPVPDDLPPK 129
              G+DPVP+    K
Sbjct: 61  HPGGYDPVPEKKENK 75


>gi|218439785|ref|YP_002378114.1| hypothetical protein PCC7424_2840 [Cyanothece sp. PCC 7424]
 gi|226701537|sp|B7K8P8|Y2840_CYAP7 RecName: Full=UPF0161 protein PCC7424_2840
 gi|218172513|gb|ACK71246.1| protein of unknown function DUF37 [Cyanothece sp. PCC 7424]
          Length = 75

 Score =  111 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 36/75 (48%), Positives = 51/75 (68%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +++ IG+IR Y+   S +F  SCR+ PTCS+YG EAI R+G   G+WLTL R+++C+P 
Sbjct: 1   MKIVLIGLIRGYRTFISPLFPPSCRFQPTCSQYGIEAIERFGAIKGAWLTLGRILRCHPF 60

Query: 115 GSDGFDPVPDDLPPK 129
              G+DPVP   P K
Sbjct: 61  HPGGYDPVPPVKPKK 75


>gi|258648283|ref|ZP_05735752.1| putative toxin-antitoxin system, toxin component [Prevotella
           tannerae ATCC 51259]
 gi|260852202|gb|EEX72071.1| putative toxin-antitoxin system, toxin component [Prevotella
           tannerae ATCC 51259]
          Length = 72

 Score =  111 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 30/67 (44%), Positives = 45/67 (67%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            + I  IR+YQ   S +   SCR+ PTCS+Y  EA+ ++GL+ G WL + R+++C+P G 
Sbjct: 6   RLFILPIRLYQRFISPLTPPSCRFTPTCSQYAIEALQKHGLFKGLWLAIRRILRCHPWGG 65

Query: 117 DGFDPVP 123
            G+DPVP
Sbjct: 66  SGYDPVP 72


>gi|329894826|ref|ZP_08270626.1| YidD [gamma proteobacterium IMCC3088]
 gi|328922720|gb|EGG30054.1| YidD [gamma proteobacterium IMCC3088]
          Length = 83

 Score =  111 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 32/73 (43%), Positives = 43/73 (58%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
              R + I  I++Y+L+ S   G +CR+ PTCSEY  EA+  +G   GS LT  RL KC+
Sbjct: 5   KPMRQLLISFIKLYRLLLSPFLGRNCRFYPTCSEYAIEALHEHGALRGSILTAQRLGKCH 64

Query: 113 PLGSDGFDPVPDD 125
           P    G+DPVP  
Sbjct: 65  PWHDGGYDPVPKT 77


>gi|271970553|ref|YP_003344749.1| hypothetical protein Sros_9388 [Streptosporangium roseum DSM 43021]
 gi|270513728|gb|ACZ92006.1| conserved hypothetical protein [Streptosporangium roseum DSM 43021]
          Length = 92

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 43/71 (60%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           +    I +  IR Y+   S + G  CR+ P+CS YG EA+A +G   G+WLT+ R+ +C+
Sbjct: 10  SPAARILMAPIRFYRAFVSPLLGPRCRFHPSCSAYGLEAMAVHGALRGTWLTIRRIGRCH 69

Query: 113 PLGSDGFDPVP 123
           P    GFDPVP
Sbjct: 70  PFHPGGFDPVP 80


>gi|332705790|ref|ZP_08425866.1| conserved hypothetical protein TIGR00278 [Lyngbya majuscula 3L]
 gi|332355582|gb|EGJ35046.1| conserved hypothetical protein TIGR00278 [Lyngbya majuscula 3L]
          Length = 103

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 32/73 (43%), Positives = 48/73 (65%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +L+ I +IR Y+   S +F   CR+ PTCS+Y  +AI R+G+  G WL + R+++C+PL
Sbjct: 1   MKLLLIWLIRGYRAFISPLFPPVCRFRPTCSQYAIQAIERFGVCRGGWLGIRRILRCHPL 60

Query: 115 GSDGFDPVPDDLP 127
              G+DPVPD  P
Sbjct: 61  YPGGYDPVPDVYP 73


>gi|307154500|ref|YP_003889884.1| hypothetical protein Cyan7822_4705 [Cyanothece sp. PCC 7822]
 gi|306984728|gb|ADN16609.1| protein of unknown function DUF37 [Cyanothece sp. PCC 7822]
          Length = 76

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 33/76 (43%), Positives = 49/76 (64%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +++ IG+IR Y+   S +F  SCR+ PTCS+Y  EAI R+G   GSWL + R+++C+P 
Sbjct: 1   MKVVLIGLIRAYRTFISPLFPPSCRFQPTCSQYTMEAIERFGGLKGSWLGIKRILRCHPF 60

Query: 115 GSDGFDPVPDDLPPKK 130
              G+DPVP     K+
Sbjct: 61  HPGGYDPVPPVKDKKR 76


>gi|116750022|ref|YP_846709.1| hypothetical protein Sfum_2596 [Syntrophobacter fumaroxidans MPOB]
 gi|166987528|sp|A0LLH2|Y2596_SYNFM RecName: Full=UPF0161 protein Sfum_2596
 gi|116699086|gb|ABK18274.1| protein of unknown function DUF37 [Syntrophobacter fumaroxidans
           MPOB]
          Length = 80

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 39/80 (48%), Positives = 55/80 (68%), Gaps = 2/80 (2%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + R I +G+IR YQ++ S + G  CR+LPTCS+Y YEAI RYG+W G +L   RL++C+P
Sbjct: 1   MIRSIFLGLIRFYQIVLSPLKGPRCRFLPTCSQYAYEAIERYGIWRGLFLGGKRLLRCHP 60

Query: 114 LGSDGFDPVPDDLPPKKNNP 133
             + G+DPVP   P   N+P
Sbjct: 61  FHAGGYDPVP--RPSANNHP 78


>gi|255531448|ref|YP_003091820.1| hypothetical protein Phep_1545 [Pedobacter heparinus DSM 2366]
 gi|255344432|gb|ACU03758.1| protein of unknown function DUF37 [Pedobacter heparinus DSM 2366]
          Length = 76

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 34/76 (44%), Positives = 49/76 (64%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
            K  K L     + +I++YQ + S + G SCR+ P+CS+YG EAI ++G + G WLTL R
Sbjct: 1   MKVIKQLLGWFFLAMIKLYQWLLSPLLGASCRFTPSCSQYGIEAIKKHGPFKGGWLTLKR 60

Query: 108 LIKCNPLGSDGFDPVP 123
           + +C+P G  G DPVP
Sbjct: 61  IGRCHPWGGHGPDPVP 76


>gi|288550160|ref|ZP_06390937.1| hypothetical protein ENTCAN_08101 [Enterobacter cancerogenus ATCC
           35316]
 gi|309795746|ref|ZP_07690161.1| conserved hypothetical protein YidD [Escherichia coli MS 145-7]
 gi|288315990|gb|EFC54928.1| putative alpha-hemolysin [Enterobacter cancerogenus ATCC 35316]
 gi|308120625|gb|EFO57887.1| conserved hypothetical protein YidD [Escherichia coli MS 145-7]
 gi|315254607|gb|EFU34575.1| putative alpha-hemolysin [Escherichia coli MS 85-1]
          Length = 81

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 35/71 (49%), Positives = 49/71 (69%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           + G  + I +IR+YQ + S + G  CR+ PTCS YG EA+ R+G+  GSWLT+ R++KC+
Sbjct: 2   SPGSRVLIALIRVYQRLISPLLGPHCRFTPTCSSYGIEALRRFGVIKGSWLTVKRVLKCH 61

Query: 113 PLGSDGFDPVP 123
           PL   G DPVP
Sbjct: 62  PLHPGGDDPVP 72


>gi|256823858|ref|YP_003147821.1| hypothetical protein Kkor_2645 [Kangiella koreensis DSM 16069]
 gi|256797397|gb|ACV28053.1| protein of unknown function DUF37 [Kangiella koreensis DSM 16069]
          Length = 74

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 32/70 (45%), Positives = 43/70 (61%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           +   I I ++R YQ + S V GN CR+ PTCS Y  EA+  +G   GSWLT+ R+ +C+P
Sbjct: 1   MINRILIVLVRGYQKVLSPVMGNQCRFYPTCSNYSIEALQEHGAIKGSWLTIKRIARCHP 60

Query: 114 LGSDGFDPVP 123
               G DPVP
Sbjct: 61  GCEGGHDPVP 70


>gi|239637892|ref|ZP_04678853.1| conserved hypothetical protein [Staphylococcus warneri L37603]
 gi|239596455|gb|EEQ78991.1| conserved hypothetical protein [Staphylococcus warneri L37603]
 gi|330684755|gb|EGG96450.1| YidD family protein [Staphylococcus epidermidis VCU121]
          Length = 79

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 46/78 (58%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I + +I  YQ   S +   +CR+ PTCSEY  EAI  +G + G +L + R++KC+PL
Sbjct: 1   MKKIFLALIHFYQRYISPLTPPTCRFYPTCSEYTREAIQYHGAFKGLYLGIRRILKCHPL 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G+DPVP      K++
Sbjct: 61  HKGGYDPVPLAKNKSKHH 78


>gi|119961135|ref|YP_949873.1| hypothetical protein AAur_4208 [Arthrobacter aurescens TC1]
 gi|119947994|gb|ABM06905.1| putative domain of unknown function DUF37 [Arthrobacter aurescens
           TC1]
          Length = 161

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 34/98 (34%), Positives = 49/98 (50%), Gaps = 3/98 (3%)

Query: 26  PIQKKGSPLLLKNNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCS 85
           P     S  +   + P      G F   L R I I +++ Y+ + S ++G  CR+ P+CS
Sbjct: 31  PSSSDPSGKVPHRSLPAVV---GTFLWELPRNILILLLKAYRKVVSPLYGQVCRFFPSCS 87

Query: 86  EYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVP 123
            Y  EA+  +G   GSWL   RL KC+P  + G D VP
Sbjct: 88  AYALEAVTVHGAVKGSWLAAKRLAKCHPWNAGGVDHVP 125


>gi|238021628|ref|ZP_04602054.1| hypothetical protein GCWU000324_01530 [Kingella oralis ATCC 51147]
 gi|237866242|gb|EEP67284.1| hypothetical protein GCWU000324_01530 [Kingella oralis ATCC 51147]
          Length = 70

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 44/70 (62%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + R + + +IR YQL  S +    CRY PTCS+Y  EA+ +YG   G WL L RL +C+P
Sbjct: 1   MFRKLFLALIRFYQLCISPLIPPRCRYTPTCSQYAIEAVRKYGALKGGWLALKRLARCHP 60

Query: 114 LGSDGFDPVP 123
            G  G+DPVP
Sbjct: 61  WGGCGYDPVP 70


>gi|326797759|ref|YP_004315578.1| hypothetical protein Sph21_0326 [Sphingobacterium sp. 21]
 gi|326548523|gb|ADZ76908.1| UPF0161 protein yidD [Sphingobacterium sp. 21]
          Length = 84

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 34/78 (43%), Positives = 49/78 (62%), Gaps = 1/78 (1%)

Query: 46  WNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTL 105
           W       +G  I + +I+ Y+L  S +F  +CRY PTCS+YG +AI ++G + G WLTL
Sbjct: 8   WQRGIKSIIG-FIFLMLIKAYRLFISPLFPGTCRYTPTCSQYGIDAIKKHGPFKGGWLTL 66

Query: 106 LRLIKCNPLGSDGFDPVP 123
            R+ +C+P G  G DPVP
Sbjct: 67  KRIGRCHPWGGHGHDPVP 84


>gi|258539400|ref|YP_003173899.1| hypothetical protein LC705_01209 [Lactobacillus rhamnosus Lc 705]
 gi|257151076|emb|CAR90048.1| Conserved protein [Lactobacillus rhamnosus Lc 705]
 gi|328463555|gb|EGF35179.1| hypothetical protein AAULR_08845 [Lactobacillus rhamnosus MTCC
           5462]
          Length = 101

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 43/78 (55%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I   ++R YQ   S +F  SCRY PTCS Y  +A+ R+G   G  + + R+++CNP 
Sbjct: 1   MKQILTWLVRGYQRFISPLFPPSCRYYPTCSTYMIQALQRHGAVKGLLMGIARILRCNPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G DPVP     ++N 
Sbjct: 61  VKGGLDPVPAYFTLRRNP 78


>gi|242241428|ref|YP_002989609.1| hypothetical protein Dd703_4036 [Dickeya dadantii Ech703]
 gi|242133485|gb|ACS87787.1| protein of unknown function DUF37 [Dickeya dadantii Ech703]
          Length = 85

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 38/85 (44%), Positives = 54/85 (63%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
                +LG  + IG+IR+YQL+ S + G  CR+ P+CS+YG EAI R+G+  G WLTL R
Sbjct: 1   MAPSPSLGSRLLIGLIRMYQLLISPLLGQHCRFQPSCSQYGIEAIRRFGMIKGCWLTLKR 60

Query: 108 LIKCNPLGSDGFDPVPDDLPPKKNN 132
           ++KC+PL   G DPVP      + +
Sbjct: 61  VLKCHPLNPGGDDPVPPKPDNNREH 85


>gi|47606237|sp|P61467|YIDD_ECOL6 RecName: Full=UPF0161 protein yidD
          Length = 85

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 36/76 (47%), Positives = 49/76 (64%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
              P + G    I +IR+YQ + S + G  CR+ PTCS YG EA+ R+G+  GSWLT+ R
Sbjct: 1   MAPPLSPGSRALIALIRVYQRLISPLLGPHCRFTPTCSSYGIEALRRFGVIKGSWLTVKR 60

Query: 108 LIKCNPLGSDGFDPVP 123
           ++KC+PL   G DPVP
Sbjct: 61  VLKCHPLHPGGDDPVP 76


>gi|319892843|ref|YP_004149718.1| Protein YidD [Staphylococcus pseudintermedius HKU10-03]
 gi|317162539|gb|ADV06082.1| Protein YidD [Staphylococcus pseudintermedius HKU10-03]
 gi|323464125|gb|ADX76278.1| conserved hypothetical protein [Staphylococcus pseudintermedius
           ED99]
          Length = 83

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 33/69 (47%), Positives = 41/69 (59%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I  IR YQ   S +   SCR+ PTCS Y  EAI  +G   GSWL L R++KC+P 
Sbjct: 1   MKTLFIYAIRFYQRFISPLTPPSCRFYPTCSNYTLEAIQVHGALKGSWLGLKRILKCHPF 60

Query: 115 GSDGFDPVP 123
              GFDPVP
Sbjct: 61  HKGGFDPVP 69


>gi|116493062|ref|YP_804797.1| hypothetical protein PEPE_1314 [Pediococcus pentosaceus ATCC 25745]
 gi|122265474|sp|Q03EL7|Y1314_PEDPA RecName: Full=UPF0161 protein PEPE_1314
 gi|116103212|gb|ABJ68355.1| hypothetical protein PEPE_1314 [Pediococcus pentosaceus ATCC 25745]
          Length = 85

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 33/79 (41%), Positives = 47/79 (59%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I + IIR YQ   S +F  SCRY PTCS Y  +AI R+G   G  + + R+++C+P 
Sbjct: 1   MKQILLLIIRGYQKFISPMFPPSCRYYPTCSNYSLQAIKRFGAIKGGLMGVARILRCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNNP 133
              G+DPVPD+   K+N  
Sbjct: 61  VRGGYDPVPDNFSLKRNQK 79


>gi|257095792|ref|YP_003169433.1| hypothetical protein CAP2UW1_4263 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257048316|gb|ACV37504.1| protein of unknown function DUF37 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 83

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 31/83 (37%), Positives = 43/83 (51%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            K L     + +IR YQ   S + G  CR+ P+CS Y  EA+  +GL  G WL L R+ +
Sbjct: 1   MKRLLTRAILLMIRGYQWFISPLLGPRCRFYPSCSHYAQEALQMHGLRRGGWLALRRIGR 60

Query: 111 CNPLGSDGFDPVPDDLPPKKNNP 133
           C+P    G DPVP       ++P
Sbjct: 61  CHPWHPGGVDPVPPAHASDTHHP 83


>gi|116494667|ref|YP_806401.1| hypothetical protein LSEI_1171 [Lactobacillus casei ATCC 334]
 gi|191638166|ref|YP_001987332.1| UPF0161 protein yrcB [Lactobacillus casei BL23]
 gi|227535349|ref|ZP_03965398.1| alpha-hemolysin family protein [Lactobacillus paracasei subsp.
           paracasei ATCC 25302]
 gi|239631733|ref|ZP_04674764.1| conserved hypothetical protein [Lactobacillus paracasei subsp.
           paracasei 8700:2]
 gi|301066226|ref|YP_003788249.1| hypothetical protein LCAZH_1160 [Lactobacillus casei str. Zhang]
 gi|122263912|sp|Q03A13|Y1171_LACC3 RecName: Full=UPF0161 protein LSEI_1171
 gi|226734143|sp|B3WDM3|Y1393_LACCB RecName: Full=UPF0161 protein LCABL_13930
 gi|116104817|gb|ABJ69959.1| hypothetical protein LSEI_1171 [Lactobacillus casei ATCC 334]
 gi|190712468|emb|CAQ66474.1| UPF0161 protein yrcB [Lactobacillus casei BL23]
 gi|227186945|gb|EEI67012.1| alpha-hemolysin family protein [Lactobacillus paracasei subsp.
           paracasei ATCC 25302]
 gi|239526198|gb|EEQ65199.1| conserved hypothetical protein [Lactobacillus paracasei subsp.
           paracasei 8700:2]
 gi|300438633|gb|ADK18399.1| conserved hypothetical protein [Lactobacillus casei str. Zhang]
 gi|327382197|gb|AEA53673.1| hypothetical protein LC2W_1339 [Lactobacillus casei LC2W]
 gi|327385394|gb|AEA56868.1| hypothetical protein LCBD_1371 [Lactobacillus casei BD-II]
          Length = 101

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 43/78 (55%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + +   ++R YQ   S +   SCRY PTCS Y  +A+ ++G   GS + + R+++CNP 
Sbjct: 1   MKQVLTWLVRGYQRFISPLLPPSCRYYPTCSTYMIQALQKHGAIKGSLMGIARILRCNPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G DPVP     ++N 
Sbjct: 61  VKGGLDPVPAFFTLRRNP 78


>gi|260435257|ref|ZP_05789227.1| conserved hypothetical protein [Synechococcus sp. WH 8109]
 gi|260413131|gb|EEX06427.1| conserved hypothetical protein [Synechococcus sp. WH 8109]
          Length = 114

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 36/113 (31%), Positives = 54/113 (47%), Gaps = 3/113 (2%)

Query: 15  LTTFSQSSYALPIQKKGSPLLLKNNTPKSRNWNGKFPKTLGRLIG---IGIIRIYQLIFS 71
                Q    L  ++  +   +  +   S     K  + L + +    +  I  Y+   S
Sbjct: 2   CVEIVQLLGMLEPKQLQASAAMHESATVSGGPMAKLRQALNQALAAVLLAGIGFYRRFIS 61

Query: 72  NVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVPD 124
            + G  CR+ PTCS YG EAI ++G W G WLT+ RL++C+P    G DPVPD
Sbjct: 62  PMIGPRCRFTPTCSAYGLEAIQKHGPWKGGWLTVKRLLRCHPFTPCGCDPVPD 114


>gi|199597571|ref|ZP_03211000.1| hypothetical protein LRH_06571 [Lactobacillus rhamnosus HN001]
 gi|258508185|ref|YP_003170936.1| hypothetical protein LGG_01190 [Lactobacillus rhamnosus GG]
 gi|199591594|gb|EDY99671.1| hypothetical protein LRH_06571 [Lactobacillus rhamnosus HN001]
 gi|257148112|emb|CAR87085.1| Conserved protein [Lactobacillus rhamnosus GG]
 gi|259649501|dbj|BAI41663.1| conserved hypothetical protein [Lactobacillus rhamnosus GG]
          Length = 101

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 43/78 (55%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I   ++R YQ   S +F  SCRY PTCS Y  +A+ R+G   G  + + R+++CNP 
Sbjct: 1   MKQILTWLVRGYQRFISPLFPPSCRYYPTCSTYMIQALQRHGAVKGFLMGIARILRCNPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G DPVP     ++N 
Sbjct: 61  VKGGLDPVPAYFTLRRNP 78


>gi|124002094|ref|ZP_01686948.1| conserved hypothetical protein [Microscilla marina ATCC 23134]
 gi|123992560|gb|EAY31905.1| conserved hypothetical protein [Microscilla marina ATCC 23134]
          Length = 87

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 35/83 (42%), Positives = 47/83 (56%), Gaps = 2/83 (2%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + I I  IR+YQ   S     +CRY PTCS Y  EAI  +G   G WL + R+ +C+P
Sbjct: 1   MLKAIFIFFIRVYQKGISPYLPATCRYQPTCSHYTVEAIQTHGALKGMWLGMKRISRCHP 60

Query: 114 LGSDGFDPVPDDLPPK--KNNPK 134
           +G  G+DPVP  +  K    NPK
Sbjct: 61  MGGSGYDPVPPKVDKKSPSQNPK 83


>gi|78043459|ref|YP_358875.1| hypothetical protein CHY_0003 [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|116256126|sp|Q3AG59|Y003_CARHZ RecName: Full=UPF0161 protein CHY_0003
 gi|77995574|gb|ABB14473.1| conserved hypothetical protein TIGR00278 [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 75

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 32/71 (45%), Positives = 49/71 (69%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R I + +IR YQ   S + G++CR+ P+CS+Y YEAI RYG+  GS+L + R+++C+P 
Sbjct: 1   MRKIILLLIRFYQKFVSPILGSNCRFYPSCSQYTYEAIERYGVIYGSYLGIKRILRCHPF 60

Query: 115 GSDGFDPVPDD 125
              G+DPVP+ 
Sbjct: 61  TPGGYDPVPEK 71


>gi|197124876|ref|YP_002136827.1| hypothetical protein AnaeK_4496 [Anaeromyxobacter sp. K]
 gi|220919594|ref|YP_002494898.1| protein of unknown function DUF37 [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|226706194|sp|B4UKG2|Y4496_ANASK RecName: Full=UPF0161 protein AnaeK_4496
 gi|254803922|sp|B8JDK6|Y4515_ANAD2 RecName: Full=UPF0161 protein A2cp1_4515
 gi|196174725|gb|ACG75698.1| protein of unknown function DUF37 [Anaeromyxobacter sp. K]
 gi|219957448|gb|ACL67832.1| protein of unknown function DUF37 [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 76

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 30/76 (39%), Positives = 47/76 (61%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + R   + ++RIYQ + S +   +CR+ P+CS Y   A+ R+G   GSWLT+ RL +C+P
Sbjct: 1   MIRAALVLLVRIYQRLVSPLLPPACRFYPSCSAYAVTALQRHGALRGSWLTVRRLCRCHP 60

Query: 114 LGSDGFDPVPDDLPPK 129
             + G DPVP+  P +
Sbjct: 61  FHAGGVDPVPELTPKR 76


>gi|89094054|ref|ZP_01166998.1| hypothetical protein MED92_02116 [Oceanospirillum sp. MED92]
 gi|89081728|gb|EAR60956.1| hypothetical protein MED92_02116 [Oceanospirillum sp. MED92]
          Length = 97

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 45/73 (61%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            K L   + IG++ IY+ + S V G  CR+ PTCS Y  EAI  +G + G+WL L RL +
Sbjct: 1   MKGLLSYLLIGLVNIYRYMISPVIGPRCRFHPTCSSYMIEAIKLHGPFKGTWLGLKRLGR 60

Query: 111 CNPLGSDGFDPVP 123
           C+P    G+DPVP
Sbjct: 61  CHPYNDGGYDPVP 73


>gi|325954339|ref|YP_004237999.1| UPF0161 protein yidD [Weeksella virosa DSM 16922]
 gi|323436957|gb|ADX67421.1| UPF0161 protein yidD [Weeksella virosa DSM 16922]
          Length = 75

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 47/75 (62%), Gaps = 4/75 (5%)

Query: 55  GRLIGI----GIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            R I I     ++R+YQ++ S + G++CR+ PTCS Y  +A+  +GL  G +L   R+++
Sbjct: 1   MRKILIYPFVFLVRLYQVMLSPLLGSNCRFQPTCSSYMIQALQMHGLLKGLYLGTKRILR 60

Query: 111 CNPLGSDGFDPVPDD 125
           C+P G  G+DPVP  
Sbjct: 61  CHPWGGSGYDPVPKK 75


>gi|292490139|ref|YP_003533034.1| hypothetical protein EAMY_3681 [Erwinia amylovora CFBP1430]
 gi|292901143|ref|YP_003540512.1| hypothetical protein EAM_3456 [Erwinia amylovora ATCC 49946]
 gi|291200991|emb|CBJ48130.1| conserved hypothetical protein [Erwinia amylovora ATCC 49946]
 gi|291555581|emb|CBA24179.1| UPF0161 protein in rnpA 3'region [Erwinia amylovora CFBP1430]
 gi|312174332|emb|CBX82585.1| UPF0161 protein in rnpA 3'region [Erwinia amylovora ATCC BAA-2158]
          Length = 80

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 34/75 (45%), Positives = 49/75 (65%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
           P + G  + I +IR+YQ + S + G  CR+ PTCS+YG EA+ R+G+  GSWL + R++K
Sbjct: 4   PLSPGSRLLIALIRVYQRVISPLSGPHCRFHPTCSQYGIEALRRFGMIKGSWLAMKRILK 63

Query: 111 CNPLGSDGFDPVPDD 125
           C+P    G DPVP  
Sbjct: 64  CHPFNPGGDDPVPPH 78


>gi|119475234|ref|ZP_01615587.1| hypothetical protein GP2143_15481 [marine gamma proteobacterium
           HTCC2143]
 gi|119451437|gb|EAW32670.1| hypothetical protein GP2143_15481 [marine gamma proteobacterium
           HTCC2143]
          Length = 81

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 47/71 (66%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R + I  I+ Y+ + S +  N CR+ P+CS Y  +AI +YG++ GSWLT+ RL++C+P 
Sbjct: 1   MRRLFISFIQCYRYLISPLMANHCRFHPSCSNYAIQAIEQYGVFKGSWLTVKRLLRCHPF 60

Query: 115 GSDGFDPVPDD 125
              G+DPVP+ 
Sbjct: 61  HPGGYDPVPEQ 71


>gi|317494664|ref|ZP_07953076.1| hypothetical protein HMPREF0864_03846 [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316917266|gb|EFV38613.1| hypothetical protein HMPREF0864_03846 [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 85

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 37/76 (48%), Positives = 50/76 (65%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            I I +IR YQL  S + G  CR+ PTCS+YG EA++R+G+  GSWLTL R++KC+PL  
Sbjct: 10  RILIKLIRGYQLFISPLLGPHCRFRPTCSQYGIEALSRFGMIKGSWLTLKRVLKCHPLNP 69

Query: 117 DGFDPVPDDLPPKKNN 132
            G DPVP      + +
Sbjct: 70  GGDDPVPPKTDDNREH 85


>gi|153009486|ref|YP_001370701.1| hypothetical protein Oant_2156 [Ochrobactrum anthropi ATCC 49188]
 gi|166227673|sp|A6X0W8|Y2156_OCHA4 RecName: Full=UPF0161 protein Oant_2156
 gi|151561374|gb|ABS14872.1| protein of unknown function DUF37 [Ochrobactrum anthropi ATCC
           49188]
          Length = 119

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 47/82 (57%), Positives = 61/82 (74%)

Query: 42  KSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGS 101
            SRN+   + KT GR+IG   +R YQ+  S++ GNSCR+LPTCSEY YEAIAR+GLW G 
Sbjct: 17  YSRNFTDPWRKTPGRVIGTSFVRFYQVTLSSLIGNSCRHLPTCSEYAYEAIARHGLWSGG 76

Query: 102 WLTLLRLIKCNPLGSDGFDPVP 123
           W+ L R+++C P G+ GFDPVP
Sbjct: 77  WMGLFRVVRCGPFGTHGFDPVP 98


>gi|91228355|ref|ZP_01262283.1| hypothetical protein V12G01_10146 [Vibrio alginolyticus 12G01]
 gi|262392789|ref|YP_003284643.1| YidD [Vibrio sp. Ex25]
 gi|91188115|gb|EAS74419.1| hypothetical protein V12G01_10146 [Vibrio alginolyticus 12G01]
 gi|262336383|gb|ACY50178.1| YidD [Vibrio sp. Ex25]
 gi|328471232|gb|EGF42134.1| YidD [Vibrio parahaemolyticus 10329]
          Length = 85

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 32/85 (37%), Positives = 47/85 (55%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
              P +    I IG++ +Y+   S + G  CR+ PTCS Y  EA+  +G   G WL+  R
Sbjct: 1   MATPVSPFTWIAIGLVYLYRWFISPLIGPRCRFTPTCSTYALEALRAHGFVKGCWLSGKR 60

Query: 108 LIKCNPLGSDGFDPVPDDLPPKKNN 132
           L+KC+PL   G+DPVP      ++N
Sbjct: 61  LLKCHPLNEGGYDPVPPVQKQDRDN 85


>gi|323493774|ref|ZP_08098892.1| hypothetical protein VIBR0546_08917 [Vibrio brasiliensis LMG 20546]
 gi|323311908|gb|EGA65054.1| hypothetical protein VIBR0546_08917 [Vibrio brasiliensis LMG 20546]
          Length = 84

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 32/84 (38%), Positives = 47/84 (55%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
              P +    + IG +R+YQ + S + G  CR+ PTCS Y  EA+  +G   G WL+  R
Sbjct: 1   MAAPVSPFTWLAIGFVRLYQGLISPLIGPRCRFTPTCSTYAIEALKAHGFVKGCWLSSKR 60

Query: 108 LIKCNPLGSDGFDPVPDDLPPKKN 131
           L+KC+PL   G+DPVP      ++
Sbjct: 61  LLKCHPLNEGGYDPVPPVQKQDRD 84


>gi|295402366|ref|ZP_06812321.1| protein of unknown function DUF37 [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|312109843|ref|YP_003988159.1| hypothetical protein GY4MC1_0732 [Geobacillus sp. Y4.1MC1]
 gi|294975639|gb|EFG51262.1| protein of unknown function DUF37 [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|311214944|gb|ADP73548.1| protein of unknown function DUF37 [Geobacillus sp. Y4.1MC1]
          Length = 76

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 47/76 (61%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + + I  IR YQ+  S +   +CR+ PTCS YG EA+ R+G   G WLT+ R++KC+P
Sbjct: 1   MAKKLLISFIRFYQIFISPLKPPTCRFYPTCSHYGLEAVKRFGAIKGGWLTIKRILKCHP 60

Query: 114 LGSDGFDPVPDDLPPK 129
               GFDPVP+    +
Sbjct: 61  FHPGGFDPVPEKQEKR 76


>gi|126668972|ref|ZP_01739911.1| hypothetical protein MELB17_00070 [Marinobacter sp. ELB17]
 gi|126626556|gb|EAZ97214.1| hypothetical protein MELB17_00070 [Marinobacter sp. ELB17]
          Length = 115

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 47/81 (58%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
              + R + +  IR YQ   S +  + CRY PTCS+Y  +AI ++G   GS L L RL++
Sbjct: 25  RNGIMRQLLLLPIRFYQYCLSPMLPSRCRYYPTCSDYAAQAITQHGAAKGSLLALKRLLR 84

Query: 111 CNPLGSDGFDPVPDDLPPKKN 131
           C+P GS G+DPVP     K +
Sbjct: 85  CHPWGSSGYDPVPGTCSAKHH 105


>gi|254302383|ref|ZP_04969741.1| possible alpha-hemolysin [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
 gi|148322575|gb|EDK87825.1| possible alpha-hemolysin [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
          Length = 82

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 34/85 (40%), Positives = 48/85 (56%), Gaps = 5/85 (5%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I +IR YQ   S +F   CR+ PTCS+Y  EAI  YG   G++L + R++KC+P 
Sbjct: 1   MKKILILLIRFYQKFISPMFPAKCRFYPTCSQYTLEAIKEYGAMKGTYLGIKRILKCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNNPKLLSKK 139
              G+DP+P     K+ N     KK
Sbjct: 61  HEGGYDPIP-----KRENKNSEGKK 80


>gi|17229103|ref|NP_485651.1| hypothetical protein asr1611 [Nostoc sp. PCC 7120]
 gi|25009620|sp|Q8YWK2|Y1611_ANASP RecName: Full=UPF0161 protein asr1611
 gi|17135431|dbj|BAB77977.1| asr1611 [Nostoc sp. PCC 7120]
          Length = 84

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 27/70 (38%), Positives = 47/70 (67%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I +I+ Y++  S ++  +CR+ PTCS Y  EAI R+G++ G W+ + R+++C+P 
Sbjct: 1   MKQIFIWLIKGYRMFISPLYPPTCRFRPTCSMYAIEAIERFGVFRGGWMAIRRILRCHPF 60

Query: 115 GSDGFDPVPD 124
              G+DPVP+
Sbjct: 61  HPGGYDPVPE 70


>gi|146284523|ref|YP_001174676.1| hypothetical protein PST_4212 [Pseudomonas stutzeri A1501]
 gi|166227236|sp|A4VS83|Y4212_PSEU5 RecName: Full=UPF0161 protein PST_4212
 gi|145572728|gb|ABP81834.1| conserved hypothetical protein [Pseudomonas stutzeri A1501]
          Length = 81

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 42/73 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R + I  IR+YQ   S +  + CR+ P+CS Y  EAI  +GL  G WL+L RL +C+P 
Sbjct: 1   MRKLAIASIRVYQYAISPMMASHCRFYPSCSCYALEAIETHGLLRGGWLSLRRLGRCHPW 60

Query: 115 GSDGFDPVPDDLP 127
              G+DPVP    
Sbjct: 61  NPGGYDPVPTHNT 73


>gi|23821237|emb|CAC86910.1| hypothetical protein [Pseudomonas putida]
          Length = 118

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 3/83 (3%)

Query: 44  RNWNGKFPKTLGRL---IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIG 100
           +NW     +   +L   + +G IR+YQ   S + G  CR+ P+CS Y  EAI  +G + G
Sbjct: 2   KNWLFAIKQVFLKLLTAVMVGCIRVYQYTISPLLGPRCRFWPSCSSYTIEAIQVHGPFKG 61

Query: 101 SWLTLLRLIKCNPLGSDGFDPVP 123
            W+ + R++KC+P    G DPVP
Sbjct: 62  GWMAVKRIVKCHPGSPGGMDPVP 84


>gi|117927032|ref|YP_867649.1| hypothetical protein Mmc1_3758 [Magnetococcus sp. MC-1]
 gi|166990898|sp|A0LE50|Y3758_MAGSM RecName: Full=UPF0161 protein Mmc1_3758
 gi|117610788|gb|ABK46243.1| protein of unknown function DUF37 [Magnetococcus sp. MC-1]
          Length = 69

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 1/70 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           +GRL+ + ++R YQL  S V   SCR+ PTCS+Y  EA+ ++G   GSWL   R+++CNP
Sbjct: 1   MGRLLVL-LVRFYQLFISPVLPPSCRHSPTCSQYAIEALQKHGAIKGSWLAFRRVLRCNP 59

Query: 114 LGSDGFDPVP 123
               G+DPVP
Sbjct: 60  WHPGGYDPVP 69


>gi|255038063|ref|YP_003088684.1| hypothetical protein Dfer_4317 [Dyadobacter fermentans DSM 18053]
 gi|254950819|gb|ACT95519.1| protein of unknown function DUF37 [Dyadobacter fermentans DSM
           18053]
          Length = 69

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 40/69 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I  +R YQ   S    NSCRY PTCS+Y  EA+ ++G   G W+ L R  +C+P 
Sbjct: 1   MKFLLIAFVRFYQAALSPYLPNSCRYTPTCSQYMIEAVQKHGPLKGGWMGLKRFARCHPW 60

Query: 115 GSDGFDPVP 123
           G  G DPVP
Sbjct: 61  GGHGHDPVP 69


>gi|222148632|ref|YP_002549589.1| hypothetical protein Avi_2209 [Agrobacterium vitis S4]
 gi|221735618|gb|ACM36581.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 128

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 49/85 (57%), Positives = 64/85 (75%)

Query: 42  KSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGS 101
           + RN++G F KT  RL+G+G+IR+YQL  S++ G+ CR+ PTCSEYGYEAIAR+GLW G 
Sbjct: 19  RGRNYHGPFRKTPDRLLGMGLIRLYQLTLSSLVGSHCRHSPTCSEYGYEAIARHGLWSGG 78

Query: 102 WLTLLRLIKCNPLGSDGFDPVPDDL 126
           WLTL R+ +C P G+ G D VP  L
Sbjct: 79  WLTLFRVGRCGPGGTWGVDDVPQTL 103


>gi|319404306|emb|CBI77899.1| conserved hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 114

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 51/91 (56%), Positives = 66/91 (72%)

Query: 36  LKNNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARY 95
           +K N   +RN+ G + KT GRL+GIG+IR YQ+  S+  G  CR+ PTCSEY YEAIAR+
Sbjct: 6   VKTNKKHTRNYTGPWQKTPGRLLGIGLIRFYQITLSSFIGIHCRHRPTCSEYTYEAIARH 65

Query: 96  GLWIGSWLTLLRLIKCNPLGSDGFDPVPDDL 126
           GLW G+W+ L RLI+C P G+ GFDPVP  +
Sbjct: 66  GLWAGAWMGLFRLIRCCPFGTTGFDPVPTSI 96


>gi|309790036|ref|ZP_07684610.1| protein of unknown function DUF37 [Oscillochloris trichoides DG6]
 gi|308227891|gb|EFO81545.1| protein of unknown function DUF37 [Oscillochloris trichoides DG6]
          Length = 83

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 34/70 (48%), Positives = 45/70 (64%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
             R I + +IR YQ+  S     SC Y PTCS+YG+EAI +YG + G WLTL R+++C+P
Sbjct: 14  PMRWIALKLIRFYQVAISPWTPPSCIYTPTCSQYGFEAITKYGFFKGGWLTLKRILRCHP 73

Query: 114 LGSDGFDPVP 123
               G DPVP
Sbjct: 74  WAHGGHDPVP 83


>gi|190151297|ref|YP_001969822.1| hypothetical protein APP7_2028 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|307264650|ref|ZP_07546230.1| hypothetical protein appser13_20350 [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|189916428|gb|ACE62680.1| hypothetical protein APP7_2028 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|306869962|gb|EFN01726.1| hypothetical protein appser13_20350 [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 101

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 43/82 (52%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           ++G  + +  I  Y+   S + G  CR+ PTCS Y  EAI  +G   G WL   R+ +C+
Sbjct: 19  SIGARLLLLPIYFYRYCISPLIGPRCRFYPTCSTYAVEAIKTHGAIKGGWLAAKRIARCH 78

Query: 113 PLGSDGFDPVPDDLPPKKNNPK 134
           P    G DPVP     K++N +
Sbjct: 79  PWNEGGEDPVPPCCNHKESNKE 100


>gi|217970731|ref|YP_002355965.1| hypothetical protein Tmz1t_2332 [Thauera sp. MZ1T]
 gi|217508058|gb|ACK55069.1| protein of unknown function DUF37 [Thauera sp. MZ1T]
          Length = 69

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 27/69 (39%), Positives = 42/69 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I ++R Y+   S + G +CR+ PTCSEY  EA+ R+G   G W+   R+ +C+P 
Sbjct: 1   MKTVLIALLRFYRYAISPMLGRNCRFHPTCSEYAIEAVQRHGALRGGWMAAKRVGRCHPF 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  NPGGYDPVP 69


>gi|86608052|ref|YP_476814.1| hypothetical protein CYB_0560 [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|116256253|sp|Q2JNV4|Y560_SYNJB RecName: Full=UPF0161 protein CYB_0560
 gi|86556594|gb|ABD01551.1| conserved hypothetical protein TIGR00278 [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 89

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 32/77 (41%), Positives = 41/77 (53%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
                       I +IR YQ+  S     +CRY PTCS+Y  EA+ RYG   G WL + R
Sbjct: 1   MPERSDPLTRSLIALIRGYQVGISPWLPPACRYYPTCSQYTLEAVRRYGALRGGWLGIRR 60

Query: 108 LIKCNPLGSDGFDPVPD 124
           L +C+P    G+DPVPD
Sbjct: 61  LCRCHPWHPGGYDPVPD 77


>gi|242243045|ref|ZP_04797490.1| alpha-hemolysin [Staphylococcus epidermidis W23144]
 gi|242233503|gb|EES35815.1| alpha-hemolysin [Staphylococcus epidermidis W23144]
          Length = 98

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 32/83 (38%), Positives = 49/83 (59%), Gaps = 2/83 (2%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
           P ++ + I + ++  YQ   S +   +CR+ PTCS+Y  EAI  +G   G +L + R++K
Sbjct: 13  PLSMLKKILLSLVVFYQRFISPLTPPTCRFYPTCSQYTREAIEYHGALKGLYLGVRRILK 72

Query: 111 CNPLGSDGFDPVPDDLPPKKNNP 133
           C+PL   GFDPVP  L   KN+ 
Sbjct: 73  CHPLHKGGFDPVP--LKKNKNSK 93


>gi|158341482|ref|YP_001522647.1| hypothetical protein AM1_G0153 [Acaryochloris marina MBIC11017]
 gi|158311723|gb|ABW33333.1| conserved hypothetical protein [Acaryochloris marina MBIC11017]
          Length = 99

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 31/69 (44%), Positives = 45/69 (65%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + IG+I+ Y+   S +F  SCR+ PTCS Y  EAI+ +G+  GSWL L R+ +C+P 
Sbjct: 1   MKTLLIGLIQFYRRFISPLFLPSCRFQPTCSAYAIEAISTWGVLKGSWLALKRISRCHPF 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  HPGGYDPVP 69


>gi|329118140|ref|ZP_08246852.1| alpha-hemolysin [Neisseria bacilliformis ATCC BAA-1200]
 gi|327465800|gb|EGF12073.1| alpha-hemolysin [Neisseria bacilliformis ATCC BAA-1200]
          Length = 72

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 40/71 (56%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
            +G  + + +IR YQ   S +    CRY PTCS+Y  EA+ RYG   G  L   R+ +C+
Sbjct: 2   NMGAKLLLALIRFYQYCISPLVPPRCRYTPTCSQYALEAVRRYGALKGGLLAAKRIARCH 61

Query: 113 PLGSDGFDPVP 123
           P G  G DPVP
Sbjct: 62  PWGGHGHDPVP 72


>gi|86160774|ref|YP_467559.1| hypothetical protein Adeh_4359 [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|116256245|sp|Q2IHR6|Y4359_ANADE RecName: Full=UPF0161 protein Adeh_4359
 gi|85777285|gb|ABC84122.1| protein of unknown function DUF37 [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 76

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 30/76 (39%), Positives = 46/76 (60%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + R   + ++RIYQ + S +   +CR+ P+CS Y   A+ R+G   GSWLT+ RL +C+P
Sbjct: 1   MIRRALVLLVRIYQRLVSPLLPPACRFYPSCSAYAVTALQRHGALRGSWLTVRRLCRCHP 60

Query: 114 LGSDGFDPVPDDLPPK 129
               G DPVP+  P +
Sbjct: 61  FHPGGVDPVPELTPKR 76


>gi|88811305|ref|ZP_01126561.1| hypothetical protein NB231_10893 [Nitrococcus mobilis Nb-231]
 gi|88791844|gb|EAR22955.1| hypothetical protein NB231_10893 [Nitrococcus mobilis Nb-231]
          Length = 82

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 45/69 (65%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R + IG++R YQ + S + G SCRY P+CS+Y  EAI  +G  +G +L   R+++C+P 
Sbjct: 8   MRTLLIGLLRCYQWLISPLIGPSCRYYPSCSQYAIEAIRMHGAALGGYLGTRRVLRCHPW 67

Query: 115 GSDGFDPVP 123
            + G DPVP
Sbjct: 68  HTGGLDPVP 76


>gi|323466853|gb|ADX70540.1| Hypothetical cytosolic protein [Lactobacillus helveticus H10]
 gi|328468727|gb|EGF39709.1| hypothetical protein AAULH_04560 [Lactobacillus helveticus MTCC
           5463]
          Length = 97

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 47/78 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R I I I+RIYQ + S +F  SCRY PTCS Y  +A+ ++G  +G  + + R ++CNP 
Sbjct: 1   MRKILIFIVRIYQTLISPLFPPSCRYYPTCSNYMIDALKKHGPILGLIMGISRTLRCNPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G DPVPD+    +N 
Sbjct: 61  VRGGVDPVPDNFTVFRNP 78


>gi|319407311|emb|CBI80952.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 114

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 51/91 (56%), Positives = 66/91 (72%)

Query: 36  LKNNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARY 95
           +K N   +RN+ G + KT GRL+GIG+IR YQ+  S+  G  CR+ PTCSEY YEAIAR+
Sbjct: 6   VKTNKKYTRNYTGPWQKTPGRLLGIGLIRFYQITLSSFIGIHCRHRPTCSEYTYEAIARH 65

Query: 96  GLWIGSWLTLLRLIKCNPLGSDGFDPVPDDL 126
           GLW G+W+ L RLI+C P G+ GFDPVP  +
Sbjct: 66  GLWAGAWMGLFRLIRCCPFGTTGFDPVPTSI 96


>gi|329297778|ref|ZP_08255114.1| hypothetical protein Pstas_16882 [Plautia stali symbiont]
          Length = 85

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 34/73 (46%), Positives = 48/73 (65%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           +    + I +IR+YQ   S + G  CR+ PTCS+YG EA+ R+G+  GSWLT+ R++KC+
Sbjct: 6   SPSARLLIALIRVYQRAISPLLGPHCRFHPTCSQYGVEAVRRFGMLKGSWLTIKRVLKCH 65

Query: 113 PLGSDGFDPVPDD 125
           PL   G DPVP  
Sbjct: 66  PLNPGGDDPVPPK 78


>gi|71909811|ref|YP_287398.1| hypothetical protein Daro_4202 [Dechloromonas aromatica RCB]
 gi|116256240|sp|Q477Q3|Y4202_DECAR RecName: Full=UPF0161 protein Daro_4202
 gi|71849432|gb|AAZ48928.1| Protein of unknown function DUF37 [Dechloromonas aromatica RCB]
          Length = 69

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 44/69 (63%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I ++R YQ   S   G SCRY+PTCSEY  +A+ ++G + G WL + R+ +C+P 
Sbjct: 1   MKYLLIALVRGYQYAISPFLGRSCRYVPTCSEYMVDAVQKHGAFRGGWLGVKRVCRCHPW 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  HPGGYDPVP 69


>gi|315038016|ref|YP_004031584.1| hypothetical protein LA2_04080 [Lactobacillus amylovorus GRL 1112]
 gi|325956469|ref|YP_004291881.1| hypothetical protein LAC30SC_03865 [Lactobacillus acidophilus 30SC]
 gi|312276149|gb|ADQ58789.1| hypothetical protein LA2_04080 [Lactobacillus amylovorus GRL 1112]
 gi|325333034|gb|ADZ06942.1| hypothetical protein LAC30SC_03865 [Lactobacillus acidophilus 30SC]
 gi|327183296|gb|AEA31743.1| hypothetical protein LAB52_03865 [Lactobacillus amylovorus GRL
           1118]
          Length = 97

 Score =  110 bits (275), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 49/78 (62%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R I IG++RIYQ + S +F  SCRY PTCS Y  +A+ ++G  +G  + + R+++CNP 
Sbjct: 1   MRKILIGLVRIYQTLISPLFPPSCRYYPTCSNYMIDALKKHGPILGLIMGICRILRCNPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G DPVPD+    +N 
Sbjct: 61  IRGGVDPVPDNFTIFRNP 78


>gi|255020155|ref|ZP_05292224.1| YidD [Acidithiobacillus caldus ATCC 51756]
 gi|254970297|gb|EET27790.1| YidD [Acidithiobacillus caldus ATCC 51756]
          Length = 72

 Score =  110 bits (275), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 37/68 (54%), Positives = 47/68 (69%)

Query: 56  RLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLG 115
           R   I +IR YQL+ S   G++CR+ P+CSEY  EAIARYGL  GSW+ + RL +C+P  
Sbjct: 5   RRGAILLIRAYQLLLSPFLGSNCRFHPSCSEYACEAIARYGLLRGSWMGIKRLGRCHPWH 64

Query: 116 SDGFDPVP 123
             GFDPVP
Sbjct: 65  PGGFDPVP 72


>gi|33591703|ref|NP_879347.1| hypothetical protein BP0494 [Bordetella pertussis Tohama I]
 gi|33598887|ref|NP_886530.1| hypothetical protein BPP4404 [Bordetella parapertussis 12822]
 gi|33603966|ref|NP_891526.1| hypothetical protein BB4992 [Bordetella bronchiseptica RB50]
 gi|47606130|sp|Q7VSD7|Y494_BORPE RecName: Full=UPF0161 protein BP0494
 gi|47606266|sp|Q7W2K2|Y4404_BORPA RecName: Full=UPF0161 protein BPP4404
 gi|47606267|sp|Q7WDJ6|Y4992_BORBR RecName: Full=UPF0161 protein BB4992
 gi|33568942|emb|CAE35356.1| conserved hypothetical protein [Bordetella bronchiseptica RB50]
 gi|33571346|emb|CAE44823.1| conserved hypothetical protein [Bordetella pertussis Tohama I]
 gi|33575017|emb|CAE39683.1| conserved hypothetical protein [Bordetella parapertussis]
 gi|332381122|gb|AEE65969.1| hypothetical protein BPTD_0506 [Bordetella pertussis CS]
          Length = 90

 Score =  110 bits (275), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 31/70 (44%), Positives = 40/70 (57%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + R + I  IR Y+   S   G  CR+ PTCS Y  EAI R+G W G WL   R+ +C+P
Sbjct: 1   MIRRLLIAPIRFYRYFLSPWVGRQCRFTPTCSAYAIEAIERHGAWRGLWLAARRIGRCHP 60

Query: 114 LGSDGFDPVP 123
               G+DPVP
Sbjct: 61  WSPGGYDPVP 70


>gi|311897304|dbj|BAJ29712.1| hypothetical protein KSE_39160 [Kitasatospora setae KM-6054]
          Length = 104

 Score =  110 bits (275), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 45/74 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + +G+IR+YQ   S + G  CRY P+CS YGYEA+  +G   G WLT+ R+++CNP 
Sbjct: 1   MKYLLMGLIRLYQWTISPLLGPVCRYYPSCSRYGYEAVRVHGAIKGGWLTVWRILRCNPW 60

Query: 115 GSDGFDPVPDDLPP 128
              G D VP    P
Sbjct: 61  SPGGVDHVPPRKHP 74


>gi|239828120|ref|YP_002950744.1| hypothetical protein GWCH70_2790 [Geobacillus sp. WCH70]
 gi|259646903|sp|C5D6T9|Y2790_GEOSW RecName: Full=UPF0161 protein GWCH70_2790
 gi|239808413|gb|ACS25478.1| protein of unknown function DUF37 [Geobacillus sp. WCH70]
          Length = 77

 Score =  110 bits (275), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 33/77 (42%), Positives = 47/77 (61%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I  IR YQ+  S +   +CR+ PTCS YG EA+ R+G   G WLT+ R++KC+P 
Sbjct: 1   MKKLLISFIRFYQIFISPLKPPTCRFYPTCSHYGLEAVKRFGAIKGGWLTIKRILKCHPF 60

Query: 115 GSDGFDPVPDDLPPKKN 131
              GFDPVP+     K+
Sbjct: 61  HPGGFDPVPEKQENGKS 77


>gi|212638247|ref|YP_002314767.1| hypothetical protein Aflv_0398 [Anoxybacillus flavithermus WK1]
 gi|226706093|sp|B7GK26|Y398_ANOFW RecName: Full=UPF0161 protein Aflv_0398
 gi|212559727|gb|ACJ32782.1| Uncharacterized conserved protein, HlyA family [Anoxybacillus
           flavithermus WK1]
          Length = 74

 Score =  110 bits (275), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 45/71 (63%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I +IR YQ   S +   +CR+ PTCS YG EAI R+G   G +LT+ R++KC+P 
Sbjct: 1   MKHIFILLIRFYQRFISPLKPPTCRFYPTCSHYGLEAIRRFGALKGGYLTIKRILKCHPF 60

Query: 115 GSDGFDPVPDD 125
              GFDPVP+ 
Sbjct: 61  HPGGFDPVPEK 71


>gi|190606498|ref|YP_001974783.1| hypothetical protein -pVEF3_p11 [Enterococcus faecium]
 gi|293552911|ref|ZP_06673567.1| conserved hypothetical protein [Enterococcus faecium E1039]
 gi|315642091|ref|ZP_07896953.1| alpha-hemolysin [Enterococcus italicus DSM 15952]
 gi|190350268|emb|CAP62617.1| hypothetical protein [Enterococcus faecium]
 gi|291602932|gb|EFF33128.1| conserved hypothetical protein [Enterococcus faecium E1039]
 gi|315482363|gb|EFU72909.1| alpha-hemolysin [Enterococcus italicus DSM 15952]
          Length = 94

 Score =  110 bits (275), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 45/78 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I +  I+ YQ   S +F  SCRY PTCS Y  +AI ++G   GS +   R+++C+P 
Sbjct: 1   MKNIILLSIKGYQKGISPLFPPSCRYYPTCSHYAVDAIEKHGAAKGSLMGAARIMRCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G+DPVP     K+NN
Sbjct: 61  VKGGYDPVPSTFSLKRNN 78


>gi|52081154|ref|YP_079945.1| hypothetical protein BL05278 [Bacillus licheniformis ATCC 14580]
 gi|52786537|ref|YP_092366.1| hypothetical protein BLi02802 [Bacillus licheniformis ATCC 14580]
 gi|319644878|ref|ZP_07999111.1| hypothetical protein HMPREF1012_00144 [Bacillus sp. BT1B_CT2]
 gi|81384981|sp|Q65GZ1|Y5278_BACLD RecName: Full=UPF0161 protein BLi02802/BL05278
 gi|52004365|gb|AAU24307.1| conserved protein YtjAA [Bacillus licheniformis ATCC 14580]
 gi|52349039|gb|AAU41673.1| conserved hypothetical protein [Bacillus licheniformis ATCC 14580]
 gi|317392687|gb|EFV73481.1| hypothetical protein HMPREF1012_00144 [Bacillus sp. BT1B_CT2]
          Length = 81

 Score =  110 bits (275), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 37/76 (48%), Positives = 47/76 (61%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   I  IR YQ   S +F  +CR+ PTCS YG EAI R+G   GS+L + RL+KC+PL
Sbjct: 1   MKRAAIIFIRFYQKAISPLFPPTCRFYPTCSNYGLEAIQRFGFIKGSYLLIKRLLKCHPL 60

Query: 115 GSDGFDPVPDDLPPKK 130
              GFDPVP+    KK
Sbjct: 61  HPGGFDPVPNQTDQKK 76


>gi|320547374|ref|ZP_08041663.1| alpha-hemolysin family protein [Streptococcus equinus ATCC 9812]
 gi|320447970|gb|EFW88724.1| alpha-hemolysin family protein [Streptococcus equinus ATCC 9812]
          Length = 87

 Score =  110 bits (275), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 32/86 (37%), Positives = 48/86 (55%), Gaps = 1/86 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + I I ++R YQ   S +   SCRY PTCS Y  EAI ++G   G  + + R+++C+P
Sbjct: 1   MMKKILIALVRWYQKRISPMTPPSCRYHPTCSNYMIEAIEKHG-IKGVLMGIARILRCHP 59

Query: 114 LGSDGFDPVPDDLPPKKNNPKLLSKK 139
           L   G DPVPD    ++N      K+
Sbjct: 60  LVEGGDDPVPDYFTLRRNKDFRKKKE 85


>gi|85712625|ref|ZP_01043672.1| alpha hemolysin-like protein [Idiomarina baltica OS145]
 gi|85693616|gb|EAQ31567.1| alpha hemolysin-like protein [Idiomarina baltica OS145]
          Length = 85

 Score =  110 bits (275), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 34/85 (40%), Positives = 46/85 (54%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I IG+I+ YQL+ S + G  CR+ P+CS Y  EAI ++G   G  L   RL +C+P 
Sbjct: 1   MQAIPIGLIKFYQLVISPLIGPRCRFYPSCSHYACEAIKKHGTIRGIGLAAKRLSRCHPG 60

Query: 115 GSDGFDPVPDDLPPKKNNPKLLSKK 139
              GFDPVP+            SKK
Sbjct: 61  SEGGFDPVPEVSSDNIEPNHSQSKK 85


>gi|116075051|ref|ZP_01472311.1| hypothetical protein RS9916_25864 [Synechococcus sp. RS9916]
 gi|116067248|gb|EAU73002.1| hypothetical protein RS9916_25864 [Synechococcus sp. RS9916]
          Length = 99

 Score =  110 bits (275), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 38/88 (43%), Positives = 51/88 (57%), Gaps = 3/88 (3%)

Query: 40  TPKSRNWNGKFPKTLGRLIG---IGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYG 96
           T +S   +G       RL+    + +I  Y+  FS   G  CR++P+CS YG EAI R+G
Sbjct: 12  THESTILSGGPLAAFNRLLAAVMLALINFYRRWFSPFLGPRCRFIPSCSAYGLEAIQRHG 71

Query: 97  LWIGSWLTLLRLIKCNPLGSDGFDPVPD 124
            W G WLTL RL++C+P    G DPVPD
Sbjct: 72  PWRGGWLTLRRLLRCHPFTPCGCDPVPD 99


>gi|311747675|ref|ZP_07721460.1| hypothetical protein ALPR1_15124 [Algoriphagus sp. PR1]
 gi|126575662|gb|EAZ79972.1| hypothetical protein ALPR1_15124 [Algoriphagus sp. PR1]
          Length = 75

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 35/72 (48%), Positives = 47/72 (65%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           KTL R I I  + +YQ   S +F +SCRY PTCS+Y  EAI ++G++ G WL + R+  C
Sbjct: 4   KTLIRKIAIFPVLVYQYTISPLFPSSCRYTPTCSQYTKEAIMKHGIFKGGWLGIKRIASC 63

Query: 112 NPLGSDGFDPVP 123
           +P G  G DPVP
Sbjct: 64  HPWGGHGHDPVP 75


>gi|313207353|ref|YP_004046530.1| hypothetical protein Riean_1871 [Riemerella anatipestifer DSM
           15868]
 gi|312446669|gb|ADQ83024.1| protein of unknown function DUF37 [Riemerella anatipestifer DSM
           15868]
 gi|325335188|gb|ADZ11462.1| hypothetical protein RIA_0281 [Riemerella anatipestifer RA-GD]
          Length = 84

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 28/64 (43%), Positives = 41/64 (64%)

Query: 62  IIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDP 121
           +I+ YQ   S   GN+CRY PTCS Y  +A+ ++G   G WL + R+ +C+P G  G+DP
Sbjct: 16  LIKFYQSAISPWLGNNCRYQPTCSHYMLQALRKHGFLSGFWLGIKRIGRCHPWGGSGYDP 75

Query: 122 VPDD 125
           VP+ 
Sbjct: 76  VPEK 79


>gi|224476877|ref|YP_002634483.1| hypothetical protein Sca_1393 [Staphylococcus carnosus subsp.
           carnosus TM300]
 gi|254800067|sp|B9DN23|Y1393_STACT RecName: Full=UPF0161 protein Sca_1393
 gi|222421484|emb|CAL28298.1| conserved hypothetical protein [Staphylococcus carnosus subsp.
           carnosus TM300]
          Length = 84

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 34/78 (43%), Positives = 47/78 (60%), Gaps = 4/78 (5%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + +G+I +YQ   S +   SCR+ PTCS Y  EAI  +G   G+WL + R+ KC+PL
Sbjct: 1   MKKLFLGLIWVYQRFISPLTPPSCRFYPTCSNYTKEAIEVHGPIKGAWLGIKRISKCHPL 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              GFDPVP     KK+N
Sbjct: 61  HKGGFDPVP----LKKDN 74


>gi|313679789|ref|YP_004057528.1| hypothetical protein Ocepr_0898 [Oceanithermus profundus DSM 14977]
 gi|313152504|gb|ADR36355.1| protein of unknown function DUF37 [Oceanithermus profundus DSM
           14977]
          Length = 89

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 44/73 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              + IG+IRIYQ   S     +CR+ PTCS Y  EA+  +G+  GS+L   R+++C+PL
Sbjct: 1   MSRLLIGLIRIYQRWISPFKPRTCRFYPTCSHYAAEALETHGVLYGSYLATRRILRCHPL 60

Query: 115 GSDGFDPVPDDLP 127
              G+DPVP   P
Sbjct: 61  HPGGYDPVPPKKP 73


>gi|120556800|ref|YP_961151.1| hypothetical protein Maqu_3896 [Marinobacter aquaeolei VT8]
 gi|166201480|sp|A1U7J5|Y3896_MARAV RecName: Full=UPF0161 protein Maqu_3896
 gi|120326649|gb|ABM20964.1| protein of unknown function DUF37 [Marinobacter aquaeolei VT8]
          Length = 97

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 28/69 (40%), Positives = 40/69 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R + +  IR YQ   S +  + CR+ PTCS+Y  EAI  +G   G +L   RL++C+P 
Sbjct: 1   MRQLLLLPIRFYQYAISPMMASHCRHYPTCSQYAVEAIQHHGPLKGGYLATARLLRCHPW 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  AEGGYDPVP 69


>gi|311112575|ref|YP_003983797.1| hypothetical protein HMPREF0733_10906 [Rothia dentocariosa ATCC
           17931]
 gi|310944069|gb|ADP40363.1| conserved hypothetical protein [Rothia dentocariosa ATCC 17931]
          Length = 148

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 48/71 (67%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           TL + I IG+I+ Y+ + S ++G+ CRY PTCS YG EA+  +G   G  LT+ R+++CN
Sbjct: 50  TLPQNILIGLIKAYRKVVSPLYGDVCRYYPTCSAYGLEAVTTHGALSGLSLTVWRILRCN 109

Query: 113 PLGSDGFDPVP 123
           P  + G DPVP
Sbjct: 110 PWATGGIDPVP 120


>gi|15924785|ref|NP_372319.1| hypothetical protein SAV1795 [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|15927369|ref|NP_374902.1| hypothetical protein SA1613 [Staphylococcus aureus subsp. aureus
           N315]
 gi|21283462|ref|NP_646550.1| hypothetical protein MW1733 [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49484036|ref|YP_041260.1| hypothetical protein SAR1875 [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|49486614|ref|YP_043835.1| hypothetical protein SAS1715 [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57650580|ref|YP_186673.1| hypothetical protein SACOL1842 [Staphylococcus aureus subsp. aureus
           COL]
 gi|82751376|ref|YP_417117.1| hypothetical protein SAB1649 [Staphylococcus aureus RF122]
 gi|87160573|ref|YP_494427.1| hypothetical protein SAUSA300_1736 [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|88195609|ref|YP_500415.1| hypothetical protein SAOUHSC_01914 [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|148268266|ref|YP_001247209.1| hypothetical protein SaurJH9_1845 [Staphylococcus aureus subsp.
           aureus JH9]
 gi|150394335|ref|YP_001317010.1| hypothetical protein SaurJH1_1881 [Staphylococcus aureus subsp.
           aureus JH1]
 gi|156980111|ref|YP_001442370.1| hypothetical protein SAHV_1780 [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|161510007|ref|YP_001575666.1| hypothetical protein USA300HOU_1782 [Staphylococcus aureus subsp.
           aureus USA300_TCH1516]
 gi|221140130|ref|ZP_03564623.1| hypothetical protein SauraJ_00674 [Staphylococcus aureus subsp.
           aureus str. JKD6009]
 gi|253315901|ref|ZP_04839114.1| hypothetical protein SauraC_07092 [Staphylococcus aureus subsp.
           aureus str. CF-Marseille]
 gi|253732444|ref|ZP_04866609.1| alpha-hemolysin [Staphylococcus aureus subsp. aureus USA300_TCH959]
 gi|253735352|ref|ZP_04869517.1| alpha-hemolysin [Staphylococcus aureus subsp. aureus TCH130]
 gi|255006580|ref|ZP_05145181.2| hypothetical protein SauraM_08925 [Staphylococcus aureus subsp.
           aureus Mu50-omega]
 gi|257425902|ref|ZP_05602326.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257428569|ref|ZP_05604967.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257431203|ref|ZP_05607580.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257433884|ref|ZP_05610242.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257436801|ref|ZP_05612845.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           M876]
 gi|257794173|ref|ZP_05643152.1| conserved hypothetical protein [Staphylococcus aureus A9781]
 gi|258415877|ref|ZP_05682148.1| conserved hypothetical protein [Staphylococcus aureus A9763]
 gi|258420706|ref|ZP_05683645.1| conserved hypothetical protein [Staphylococcus aureus A9719]
 gi|258438357|ref|ZP_05689641.1| conserved hypothetical protein [Staphylococcus aureus A9299]
 gi|258443815|ref|ZP_05692154.1| conserved hypothetical protein [Staphylococcus aureus A8115]
 gi|258446025|ref|ZP_05694201.1| UPF0161 protein [Staphylococcus aureus A6300]
 gi|258448247|ref|ZP_05696374.1| UPF0161 protein [Staphylococcus aureus A6224]
 gi|258451901|ref|ZP_05699919.1| conserved hypothetical protein [Staphylococcus aureus A5948]
 gi|258454225|ref|ZP_05702196.1| conserved hypothetical protein [Staphylococcus aureus A5937]
 gi|262050303|ref|ZP_06023149.1| hypothetical protein SAD30_1350 [Staphylococcus aureus D30]
 gi|262053212|ref|ZP_06025367.1| hypothetical protein SA930_1377 [Staphylococcus aureus 930918-3]
 gi|269203429|ref|YP_003282698.1| hypothetical protein SAAV_1804 [Staphylococcus aureus subsp. aureus
           ED98]
 gi|282893284|ref|ZP_06301518.1| conserved hypothetical protein [Staphylococcus aureus A8117]
 gi|282904364|ref|ZP_06312252.1| alpha-hemolysin [Staphylococcus aureus subsp. aureus C160]
 gi|282906189|ref|ZP_06314044.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282909106|ref|ZP_06316924.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282911414|ref|ZP_06319216.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282914583|ref|ZP_06322369.1| alpha-hemolysin [Staphylococcus aureus subsp. aureus M899]
 gi|282917049|ref|ZP_06324807.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           D139]
 gi|282919551|ref|ZP_06327286.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           C427]
 gi|282924930|ref|ZP_06332596.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           C101]
 gi|282928524|ref|ZP_06336123.1| conserved hypothetical protein [Staphylococcus aureus A10102]
 gi|282928769|ref|ZP_06336363.1| conserved hypothetical protein [Staphylococcus aureus A9765]
 gi|283770867|ref|ZP_06343759.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           H19]
 gi|283958544|ref|ZP_06375995.1| alpha-hemolysin [Staphylococcus aureus subsp. aureus A017934/97]
 gi|284024839|ref|ZP_06379237.1| hypothetical protein Saura13_09610 [Staphylococcus aureus subsp.
           aureus 132]
 gi|293503661|ref|ZP_06667508.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           58-424]
 gi|293510677|ref|ZP_06669382.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           M809]
 gi|293537218|ref|ZP_06671898.1| alpha-hemolysin [Staphylococcus aureus subsp. aureus M1015]
 gi|294850664|ref|ZP_06791386.1| hypothetical protein SKAG_02761 [Staphylococcus aureus A9754]
 gi|295406100|ref|ZP_06815908.1| hypothetical protein SMAG_01258 [Staphylococcus aureus A8819]
 gi|295428365|ref|ZP_06820994.1| hypothetical protein SIAG_01689 [Staphylococcus aureus subsp.
           aureus EMRSA16]
 gi|296276483|ref|ZP_06858990.1| hypothetical protein SauraMR_09039 [Staphylococcus aureus subsp.
           aureus MR1]
 gi|297207496|ref|ZP_06923932.1| alpha-hemolysin [Staphylococcus aureus subsp. aureus ATCC 51811]
 gi|297244975|ref|ZP_06928852.1| hypothetical protein SLAG_01068 [Staphylococcus aureus A8796]
 gi|297590671|ref|ZP_06949309.1| alpha-hemolysin [Staphylococcus aureus subsp. aureus MN8]
 gi|300911580|ref|ZP_07129024.1| alpha-hemolysin [Staphylococcus aureus subsp. aureus TCH70]
 gi|304380613|ref|ZP_07363287.1| alpha-hemolysin [Staphylococcus aureus subsp. aureus ATCC BAA-39]
 gi|54040213|sp|P67305|Y1613_STAAN RecName: Full=UPF0161 protein SA1613
 gi|54040276|sp|P67306|Y1733_STAAW RecName: Full=UPF0161 protein MW1733
 gi|54042708|sp|P67304|Y1795_STAAM RecName: Full=UPF0161 protein SAV1795
 gi|56749703|sp|Q6G8D8|Y1715_STAAS RecName: Full=UPF0161 protein SAS1715
 gi|56749732|sp|Q6GFR2|Y1875_STAAR RecName: Full=UPF0161 protein SAR1875
 gi|73921065|sp|Q5HEY4|Y1842_STAAC RecName: Full=UPF0161 protein SACOL1842
 gi|116256141|sp|Q2YTP2|Y1649_STAAB RecName: Full=UPF0161 protein SAB1649
 gi|116256143|sp|Q2FFV1|Y1736_STAA3 RecName: Full=UPF0161 protein SAUSA300_1736
 gi|116256148|sp|Q2G2V4|Y1914_STAA8 RecName: Full=UPF0161 protein SAOUHSC_01914
 gi|166201520|sp|A7X3N8|Y1780_STAA1 RecName: Full=UPF0161 protein SAHV_1780
 gi|189030109|sp|A6U2Q5|Y1881_STAA2 RecName: Full=UPF0161 protein SaurJH1_1881
 gi|189039012|sp|A8Z4L7|Y1782_STAAT RecName: Full=UPF0161 protein USA300HOU_1782
 gi|189039040|sp|A5ITW0|Y1845_STAA9 RecName: Full=UPF0161 protein SaurJH9_1845
 gi|13701588|dbj|BAB42881.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           N315]
 gi|14247567|dbj|BAB57957.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|21204903|dbj|BAB95598.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49242165|emb|CAG40865.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|49245057|emb|CAG43519.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57284766|gb|AAW36860.1| conserved hypothetical protein TIGR00278 [Staphylococcus aureus
           subsp. aureus COL]
 gi|82656907|emb|CAI81338.1| conserved hypothetical protein [Staphylococcus aureus RF122]
 gi|87126547|gb|ABD21061.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|87203167|gb|ABD30977.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           NCTC 8325]
 gi|147741335|gb|ABQ49633.1| protein of unknown function DUF37 [Staphylococcus aureus subsp.
           aureus JH9]
 gi|149946787|gb|ABR52723.1| protein of unknown function DUF37 [Staphylococcus aureus subsp.
           aureus JH1]
 gi|156722246|dbj|BAF78663.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|160368816|gb|ABX29787.1| hypothetical protein USA300HOU_1782 [Staphylococcus aureus subsp.
           aureus USA300_TCH1516]
 gi|253723834|gb|EES92563.1| alpha-hemolysin [Staphylococcus aureus subsp. aureus USA300_TCH959]
 gi|253726759|gb|EES95488.1| alpha-hemolysin [Staphylococcus aureus subsp. aureus TCH130]
 gi|257271596|gb|EEV03742.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257275410|gb|EEV06897.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257278151|gb|EEV08799.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257281977|gb|EEV12114.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257284152|gb|EEV14275.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           M876]
 gi|257788145|gb|EEV26485.1| conserved hypothetical protein [Staphylococcus aureus A9781]
 gi|257839470|gb|EEV63943.1| conserved hypothetical protein [Staphylococcus aureus A9763]
 gi|257843310|gb|EEV67720.1| conserved hypothetical protein [Staphylococcus aureus A9719]
 gi|257848401|gb|EEV72392.1| conserved hypothetical protein [Staphylococcus aureus A9299]
 gi|257851221|gb|EEV75164.1| conserved hypothetical protein [Staphylococcus aureus A8115]
 gi|257855267|gb|EEV78206.1| UPF0161 protein [Staphylococcus aureus A6300]
 gi|257858486|gb|EEV81362.1| UPF0161 protein [Staphylococcus aureus A6224]
 gi|257860411|gb|EEV83241.1| conserved hypothetical protein [Staphylococcus aureus A5948]
 gi|257863677|gb|EEV86434.1| conserved hypothetical protein [Staphylococcus aureus A5937]
 gi|259158889|gb|EEW43978.1| hypothetical protein SA930_1377 [Staphylococcus aureus 930918-3]
 gi|259161596|gb|EEW46192.1| hypothetical protein SAD30_1350 [Staphylococcus aureus D30]
 gi|262075719|gb|ACY11692.1| hypothetical protein SAAV_1804 [Staphylococcus aureus subsp. aureus
           ED98]
 gi|269941268|emb|CBI49658.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           TW20]
 gi|282313296|gb|EFB43692.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           C101]
 gi|282317361|gb|EFB47735.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           C427]
 gi|282319536|gb|EFB49888.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           D139]
 gi|282321764|gb|EFB52089.1| alpha-hemolysin [Staphylococcus aureus subsp. aureus M899]
 gi|282325109|gb|EFB55419.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282327370|gb|EFB57665.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282331481|gb|EFB60995.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282589733|gb|EFB94818.1| conserved hypothetical protein [Staphylococcus aureus A10102]
 gi|282591894|gb|EFB96932.1| conserved hypothetical protein [Staphylococcus aureus A9765]
 gi|282595982|gb|EFC00946.1| alpha-hemolysin [Staphylococcus aureus subsp. aureus C160]
 gi|282764602|gb|EFC04728.1| conserved hypothetical protein [Staphylococcus aureus A8117]
 gi|283461014|gb|EFC08104.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           H19]
 gi|283471055|emb|CAQ50266.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           ST398]
 gi|283790693|gb|EFC29510.1| alpha-hemolysin [Staphylococcus aureus subsp. aureus A017934/97]
 gi|285817474|gb|ADC37961.1| YidD [Staphylococcus aureus 04-02981]
 gi|290920063|gb|EFD97131.1| alpha-hemolysin [Staphylococcus aureus subsp. aureus M1015]
 gi|291095327|gb|EFE25592.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           58-424]
 gi|291466568|gb|EFF09089.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           M809]
 gi|294822462|gb|EFG38909.1| hypothetical protein SKAG_02761 [Staphylococcus aureus A9754]
 gi|294969097|gb|EFG45118.1| hypothetical protein SMAG_01258 [Staphylococcus aureus A8819]
 gi|295127765|gb|EFG57402.1| hypothetical protein SIAG_01689 [Staphylococcus aureus subsp.
           aureus EMRSA16]
 gi|296887832|gb|EFH26729.1| alpha-hemolysin [Staphylococcus aureus subsp. aureus ATCC 51811]
 gi|297178055|gb|EFH37303.1| hypothetical protein SLAG_01068 [Staphylococcus aureus A8796]
 gi|297575557|gb|EFH94273.1| alpha-hemolysin [Staphylococcus aureus subsp. aureus MN8]
 gi|298695057|gb|ADI98279.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           ED133]
 gi|300887001|gb|EFK82202.1| alpha-hemolysin [Staphylococcus aureus subsp. aureus TCH70]
 gi|302333453|gb|ADL23646.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           JKD6159]
 gi|302751623|gb|ADL65800.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           str. JKD6008]
 gi|304340862|gb|EFM06788.1| alpha-hemolysin [Staphylococcus aureus subsp. aureus ATCC BAA-39]
 gi|312437753|gb|ADQ76824.1| alpha-hemolysin [Staphylococcus aureus subsp. aureus TCH60]
 gi|312830167|emb|CBX35009.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           ECT-R 2]
 gi|315130568|gb|EFT86554.1| hypothetical protein CGSSa03_10005 [Staphylococcus aureus subsp.
           aureus CGS03]
 gi|315195702|gb|EFU26089.1| hypothetical protein CGSSa00_08565 [Staphylococcus aureus subsp.
           aureus CGS00]
 gi|315195963|gb|EFU26326.1| hypothetical protein CGSSa01_06622 [Staphylococcus aureus subsp.
           aureus CGS01]
 gi|320140671|gb|EFW32524.1| conserved hypothetical protein YidD [Staphylococcus aureus subsp.
           aureus MRSA131]
 gi|320143761|gb|EFW35537.1| conserved hypothetical protein YidD [Staphylococcus aureus subsp.
           aureus MRSA177]
 gi|323438955|gb|EGA96689.1| hypothetical protein SAO11_2198 [Staphylococcus aureus O11]
 gi|323441842|gb|EGA99483.1| hypothetical protein SAO46_2234 [Staphylococcus aureus O46]
 gi|329314471|gb|AEB88884.1| UPF0161 protein [Staphylococcus aureus subsp. aureus T0131]
 gi|329724479|gb|EGG60987.1| YidD family protein [Staphylococcus aureus subsp. aureus 21189]
 gi|329727476|gb|EGG63932.1| YidD family protein [Staphylococcus aureus subsp. aureus 21172]
 gi|329733084|gb|EGG69421.1| YidD family protein [Staphylococcus aureus subsp. aureus 21193]
          Length = 85

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 34/84 (40%), Positives = 48/84 (57%), Gaps = 2/84 (2%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I + +I  YQ   S +   +CR+ PTCSEY  EAI  +G + G +L + R++KC+PL
Sbjct: 1   MKKIFLAMIHFYQRFISPLTPPTCRFYPTCSEYTREAIQYHGAFKGLYLGIRRILKCHPL 60

Query: 115 GSDGFDPVPDDLPPKKNNPKLLSK 138
              GFDPVP  L   K+  K   K
Sbjct: 61  HKGGFDPVP--LKKDKSASKHSHK 82


>gi|56421399|ref|YP_148717.1| hypothetical protein GK2864 [Geobacillus kaustophilus HTA426]
 gi|81346613|sp|Q5KVY7|Y2864_GEOKA RecName: Full=UPF0161 protein GK2864
 gi|56381241|dbj|BAD77149.1| hypothetical conserved protein [Geobacillus kaustophilus HTA426]
          Length = 81

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 35/75 (46%), Positives = 43/75 (57%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            I  IR YQ   S +   +CR+ PTCS YG EAI R+G   G WLT  R++KC+P    G
Sbjct: 5   LIWCIRFYQRFLSPLKPPTCRFYPTCSNYGIEAIRRFGAIKGGWLTAKRILKCHPFHPGG 64

Query: 119 FDPVPDDLPPKKNNP 133
           FDPVP+     K N 
Sbjct: 65  FDPVPESSEHAKRNK 79


>gi|161507280|ref|YP_001577234.1| hypothetical protein lhv_2403 [Lactobacillus helveticus DPC 4571]
 gi|172048221|sp|A8YUK5|Y2403_LACH4 RecName: Full=UPF0161 protein lhv_2403
 gi|160348269|gb|ABX26943.1| hypothetical protein lhv_2403 [Lactobacillus helveticus DPC 4571]
          Length = 97

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 47/78 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R I I I+RIYQ + S +F  SCRY PTCS Y  +A+ ++G  +G  + + R ++CNP 
Sbjct: 1   MRKILIFIVRIYQTLISPLFPPSCRYYPTCSNYMIDALKKHGPILGLIMGISRTLRCNPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G DPVPD+    +N 
Sbjct: 61  VRGGVDPVPDNFTVFRNP 78


>gi|284049400|ref|YP_003399739.1| protein of unknown function DUF37 [Acidaminococcus fermentans DSM
           20731]
 gi|283953621|gb|ADB48424.1| protein of unknown function DUF37 [Acidaminococcus fermentans DSM
           20731]
          Length = 69

 Score =  109 bits (274), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 32/69 (46%), Positives = 46/69 (66%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I +IR YQ+  S  F   CR++PTCS+Y  EA+ +YG W GS+L + R++KC+P 
Sbjct: 1   MKTIAIALIRFYQVWISPCFPPRCRFIPTCSQYALEAVQKYGFWKGSYLAVKRILKCHPF 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  HKGGYDPVP 69


>gi|218781968|ref|YP_002433286.1| hypothetical protein Dalk_4134 [Desulfatibacillum alkenivorans
           AK-01]
 gi|218763352|gb|ACL05818.1| protein of unknown function DUF37 [Desulfatibacillum alkenivorans
           AK-01]
          Length = 69

 Score =  109 bits (274), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 31/69 (44%), Positives = 44/69 (63%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I  IRIYQ   S + G  CR+ P+CS+Y  EAI ++G   G WL + R+++C+PL
Sbjct: 1   MKRLLIIPIRIYQRFVSPILGPHCRFYPSCSQYAVEAIEKHGPVKGGWLAVRRILRCHPL 60

Query: 115 GSDGFDPVP 123
              GFDPVP
Sbjct: 61  NPGGFDPVP 69


>gi|307258045|ref|ZP_07539797.1| hypothetical protein appser10_20250 [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306863408|gb|EFM95339.1| hypothetical protein appser10_20250 [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
          Length = 100

 Score =  109 bits (274), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 43/82 (52%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           ++G  + +  I  Y+   S + G  CR+ PTCS Y  EAI  +G   G WL   R+ +C+
Sbjct: 18  SIGTRLLLLPIYFYRYCISPLIGPRCRFYPTCSTYAVEAIKTHGAIKGGWLAAKRIARCH 77

Query: 113 PLGSDGFDPVPDDLPPKKNNPK 134
           P    G DPVP     K++N +
Sbjct: 78  PWNEGGEDPVPPCCNHKESNKE 99


>gi|303251716|ref|ZP_07337887.1| hypothetical protein APP2_0035 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|307249016|ref|ZP_07531024.1| hypothetical protein appser2_19770 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|302649146|gb|EFL79331.1| hypothetical protein APP2_0035 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|306854474|gb|EFM86669.1| hypothetical protein appser2_19770 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
          Length = 100

 Score =  109 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 43/82 (52%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           ++G  + +  I  Y+   S + G  CR+ PTCS Y  EAI  +G   G WL   R+ +C+
Sbjct: 18  SIGARLLLLPIYFYRYCISPLIGPRCRFYPTCSTYAVEAIKTHGAIKGGWLAAKRIARCH 77

Query: 113 PLGSDGFDPVPDDLPPKKNNPK 134
           P    G DPVP     K++N +
Sbjct: 78  PWNEGGEDPVPPCCNHKESNKE 99


>gi|167834933|ref|ZP_02461816.1| hypothetical protein Bpse38_00485 [Burkholderia thailandensis
           MSMB43]
          Length = 101

 Score =  109 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 29/83 (34%), Positives = 46/83 (55%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
             T  + + I ++R Y+L  S + G+ CR+ P+CS+Y  EAI  +G   G++L   RL +
Sbjct: 9   AATAMQTVLIALLRFYKLAVSPLLGSRCRFYPSCSDYAREAIQYHGAARGTYLAARRLCR 68

Query: 111 CNPLGSDGFDPVPDDLPPKKNNP 133
           C+P  + G D VP      +N P
Sbjct: 69  CHPFSAGGIDLVPPPNSDARNAP 91


>gi|258422764|ref|ZP_05685668.1| conserved hypothetical protein [Staphylococcus aureus A9635]
 gi|257847039|gb|EEV71049.1| conserved hypothetical protein [Staphylococcus aureus A9635]
          Length = 85

 Score =  109 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 33/84 (39%), Positives = 48/84 (57%), Gaps = 2/84 (2%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I + +I +YQ   S +   +CR+ PTCSEY  EAI  +G + G +L + R++KC+P 
Sbjct: 1   MKKIFLAMIHLYQRFISPLTPPTCRFYPTCSEYTREAIQYHGAFKGLYLGIRRILKCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNNPKLLSK 138
              GFDPVP  L   K+  K   K
Sbjct: 61  HKGGFDPVP--LKKDKSASKHSHK 82


>gi|332533703|ref|ZP_08409562.1| YidD [Pseudoalteromonas haloplanktis ANT/505]
 gi|332036867|gb|EGI73328.1| YidD [Pseudoalteromonas haloplanktis ANT/505]
          Length = 91

 Score =  109 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 44/74 (59%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
             ++  +  IR YQ   S + G  CR+ P+CS Y  +AI  +G   GSWL L R++KC+P
Sbjct: 10  FPKICLVLFIRGYQKWISPLLGPHCRFNPSCSHYAIQAINLHGFIKGSWLALKRILKCHP 69

Query: 114 LGSDGFDPVPDDLP 127
           L S G DPVP+ L 
Sbjct: 70  LHSGGDDPVPEKLT 83


>gi|319651954|ref|ZP_08006076.1| hypothetical protein HMPREF1013_02688 [Bacillus sp. 2_A_57_CT2]
 gi|317396353|gb|EFV77069.1| hypothetical protein HMPREF1013_02688 [Bacillus sp. 2_A_57_CT2]
          Length = 79

 Score =  109 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 49/79 (62%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + I I I R YQ+  S +   +CR+ PTCS YG E++ R+G   G WLT+ R++KC+P
Sbjct: 1   MFKKIMISIFRFYQIAISPLKPPTCRFYPTCSHYGLESVKRFGALKGGWLTIKRILKCHP 60

Query: 114 LGSDGFDPVPDDLPPKKNN 132
               G D VP++ P KK N
Sbjct: 61  FHPGGVDLVPEEWPKKKKN 79


>gi|78187972|ref|YP_376015.1| hypothetical protein Plut_2130 [Chlorobium luteolum DSM 273]
 gi|116256151|sp|Q3B109|Y2130_PELLD RecName: Full=UPF0161 protein Plut_2130
 gi|78167874|gb|ABB24972.1| Protein of unknown function DUF37 [Chlorobium luteolum DSM 273]
          Length = 86

 Score =  109 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 33/83 (39%), Positives = 48/83 (57%), Gaps = 2/83 (2%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
             +     + +I+ Y+ I S +F  SCR+ PTCS Y  EA   +  +  SWL+L R+++C
Sbjct: 4   WKVVNKAPLALIKFYRAILSPMFPPSCRFYPTCSAYALEAFETHNFFKASWLSLWRILRC 63

Query: 112 NPLGSDGFDPVP--DDLPPKKNN 132
           NP    GFDPVP  D +P KK +
Sbjct: 64  NPFSKGGFDPVPPHDGVPGKKED 86


>gi|317484431|ref|ZP_07943345.1| hypothetical protein HMPREF0179_00696 [Bilophila wadsworthia 3_1_6]
 gi|316924319|gb|EFV45491.1| hypothetical protein HMPREF0179_00696 [Bilophila wadsworthia 3_1_6]
          Length = 92

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 33/68 (48%), Positives = 45/68 (66%)

Query: 56  RLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLG 115
           R + +  IR+YQ   S V   SCRY PTCS Y  EA+  +G++ GSWL L R+++C+P  
Sbjct: 7   RRLAVLPIRLYQWTLSPVLPPSCRYHPTCSAYAIEAVLTHGIFKGSWLALRRILRCHPWS 66

Query: 116 SDGFDPVP 123
           S G+DPVP
Sbjct: 67  SGGYDPVP 74


>gi|227498801|ref|ZP_03928941.1| alpha-hemolysin [Acidaminococcus sp. D21]
 gi|226904253|gb|EEH90171.1| alpha-hemolysin [Acidaminococcus sp. D21]
          Length = 69

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 43/69 (62%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I +IR YQ+  S +    CR+ PTCS+Y  EA+ +YG   G++L   RL+KC+P 
Sbjct: 1   MKTIAIFLIRFYQICISPLLAPRCRFYPTCSQYALEAVKKYGFLKGTYLATKRLLKCHPF 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  HKGGYDPVP 69


>gi|317401603|gb|EFV82229.1| hypothetical protein HMPREF0005_00765 [Achromobacter xylosoxidans
           C54]
          Length = 107

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 33/72 (45%), Positives = 43/72 (59%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           +++G  I I  IR Y+   S   G  CR+ PTCS Y  EAI R+G W G WL L R+ +C
Sbjct: 16  RSVGAAILIAPIRFYRFFLSPWIGRQCRFTPTCSAYAIEAIERHGPWRGFWLMLRRIGRC 75

Query: 112 NPLGSDGFDPVP 123
           +P    G+DPVP
Sbjct: 76  HPWSPGGWDPVP 87


>gi|53724899|ref|YP_104855.1| hypothetical protein BMA3398 [Burkholderia mallei ATCC 23344]
 gi|167717466|ref|ZP_02400702.1| hypothetical protein BpseD_00510 [Burkholderia pseudomallei DM98]
 gi|167736501|ref|ZP_02409275.1| hypothetical protein Bpse14_00480 [Burkholderia pseudomallei 14]
 gi|167813579|ref|ZP_02445259.1| hypothetical protein Bpse9_00485 [Burkholderia pseudomallei 91]
 gi|167822120|ref|ZP_02453591.1| hypothetical protein Bpseu9_00485 [Burkholderia pseudomallei 9]
 gi|167843725|ref|ZP_02469233.1| hypothetical protein BpseB_00445 [Burkholderia pseudomallei B7210]
 gi|167892204|ref|ZP_02479606.1| hypothetical protein Bpse7_00475 [Burkholderia pseudomallei 7894]
 gi|167900715|ref|ZP_02487920.1| hypothetical protein BpseN_00470 [Burkholderia pseudomallei NCTC
           13177]
 gi|167908933|ref|ZP_02496024.1| hypothetical protein Bpse112_00450 [Burkholderia pseudomallei 112]
 gi|167916974|ref|ZP_02504065.1| hypothetical protein BpseBC_00400 [Burkholderia pseudomallei
           BCC215]
 gi|52428322|gb|AAU48915.1| conserved hypothetical protein [Burkholderia mallei ATCC 23344]
          Length = 101

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 29/83 (34%), Positives = 46/83 (55%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
             T  + + I ++R Y+L  S + G+ CR+ P+CS+Y  EAI  +G   G++L   RL +
Sbjct: 9   AATAMQTVLIALLRFYKLAVSPLLGSRCRFYPSCSDYAREAIQYHGAARGTYLAARRLCR 68

Query: 111 CNPLGSDGFDPVPDDLPPKKNNP 133
           C+P  + G D VP      +N P
Sbjct: 69  CHPFSAGGVDLVPPPNSDARNAP 91


>gi|237747152|ref|ZP_04577632.1| conserved hypothetical protein [Oxalobacter formigenes HOxBLS]
 gi|229378503|gb|EEO28594.1| conserved hypothetical protein [Oxalobacter formigenes HOxBLS]
          Length = 92

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 33/77 (42%), Positives = 47/77 (61%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            K+  + + I +IR YQL  S   G +CR+ P+CS+Y  EAI+ +G   G +LTL+RL K
Sbjct: 1   MKSPLKWLFIVLIRGYQLCISPYLGQNCRFYPSCSQYALEAISVHGCLKGCFLTLIRLCK 60

Query: 111 CNPLGSDGFDPVPDDLP 127
           C+P    G DPVP+   
Sbjct: 61  CHPFHPGGLDPVPEKKS 77


>gi|323700638|ref|ZP_08112550.1| protein of unknown function DUF37 [Desulfovibrio sp. ND132]
 gi|323460570|gb|EGB16435.1| protein of unknown function DUF37 [Desulfovibrio desulfuricans
           ND132]
          Length = 92

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 48/81 (59%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R I + +I  YQ + S +   +CR+ PTCSEY  EA+ R+G + GS LTL RL++C PL
Sbjct: 1   MRSIFLALIWFYQKLISPLLPPACRFHPTCSEYAKEALIRHGAFKGSLLTLWRLLRCQPL 60

Query: 115 GSDGFDPVPDDLPPKKNNPKL 135
              GFDPVP   P  K   + 
Sbjct: 61  CRGGFDPVPAVWPDSKTKARF 81


>gi|146329657|ref|YP_001209839.1| hypothetical protein DNO_0950 [Dichelobacter nodosus VCS1703A]
 gi|146233127|gb|ABQ14105.1| conserved hypothetical protein [Dichelobacter nodosus VCS1703A]
          Length = 78

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 47/71 (66%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              I IG+I++Y+L  S   G  CR++P+CS Y  EAI R+G W GSWL + R+++C P 
Sbjct: 1   MSRILIGLIKLYRLTLSPYLGQQCRFVPSCSHYTEEAIRRHGSWRGSWLGIKRIMRCGPW 60

Query: 115 GSDGFDPVPDD 125
            S G+DPVP+ 
Sbjct: 61  CSGGYDPVPEK 71


>gi|27468380|ref|NP_765017.1| hypothetical protein SE1462 [Staphylococcus epidermidis ATCC 12228]
 gi|251811166|ref|ZP_04825639.1| alpha-hemolysin [Staphylococcus epidermidis BCM-HMP0060]
 gi|282875793|ref|ZP_06284660.1| conserved hypothetical protein YidD [Staphylococcus epidermidis
           SK135]
 gi|293366271|ref|ZP_06612953.1| conserved hypothetical protein [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|29428184|sp|Q8CS22|Y1462_STAES RecName: Full=UPF0161 protein SE_1462
 gi|27315927|gb|AAO05061.1|AE016749_7 conserved hypothetical protein [Staphylococcus epidermidis ATCC
           12228]
 gi|251805294|gb|EES57951.1| alpha-hemolysin [Staphylococcus epidermidis BCM-HMP0060]
 gi|281294818|gb|EFA87345.1| conserved hypothetical protein YidD [Staphylococcus epidermidis
           SK135]
 gi|291319606|gb|EFE59970.1| conserved hypothetical protein [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|329724880|gb|EGG61383.1| YidD family protein [Staphylococcus epidermidis VCU144]
 gi|329734276|gb|EGG70591.1| YidD family protein [Staphylococcus epidermidis VCU045]
 gi|329737314|gb|EGG73568.1| YidD family protein [Staphylococcus epidermidis VCU028]
          Length = 83

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 47/80 (58%), Gaps = 2/80 (2%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + I + ++  YQ   S +   +CR+ PTCS+Y  EAI  +G   G +L + R++KC+P
Sbjct: 1   MLKKILLSLVVFYQRFISPLTPPTCRFYPTCSQYTREAIEYHGALKGLYLGVRRILKCHP 60

Query: 114 LGSDGFDPVPDDLPPKKNNP 133
           L   GFDPVP  L   KN+ 
Sbjct: 61  LHKGGFDPVP--LKKDKNSK 78


>gi|32034082|ref|ZP_00134326.1| COG0759: Uncharacterized conserved protein [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126209398|ref|YP_001054623.1| hypothetical protein APL_1940 [Actinobacillus pleuropneumoniae L20]
 gi|303250323|ref|ZP_07336522.1| hypothetical protein APP6_1737 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307246878|ref|ZP_07528943.1| hypothetical protein appser1_20680 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307251213|ref|ZP_07533134.1| hypothetical protein appser4_19740 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|307253632|ref|ZP_07535499.1| hypothetical protein appser6_21220 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307255860|ref|ZP_07537661.1| hypothetical protein appser9_20810 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307260313|ref|ZP_07542020.1| hypothetical protein appser11_20940 [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|307262442|ref|ZP_07544087.1| hypothetical protein appser12_19820 [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|126098190|gb|ABN75018.1| hypothetical protein APL_1940 [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
 gi|302650793|gb|EFL80950.1| hypothetical protein APP6_1737 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306852163|gb|EFM84403.1| hypothetical protein appser1_20680 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306856729|gb|EFM88864.1| hypothetical protein appser4_19740 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306858868|gb|EFM90914.1| hypothetical protein appser6_21220 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306861128|gb|EFM93121.1| hypothetical protein appser9_20810 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306865564|gb|EFM97445.1| hypothetical protein appser11_20940 [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306867819|gb|EFM99650.1| hypothetical protein appser12_19820 [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
          Length = 100

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 43/82 (52%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           ++G  + +  I  Y+   S + G  CR+ PTCS Y  EAI  +G   G WL   R+ +C+
Sbjct: 18  SIGARLLLLPIYFYRYCISPLIGPRCRFYPTCSTYAVEAIKTHGAIKGGWLAAKRIARCH 77

Query: 113 PLGSDGFDPVPDDLPPKKNNPK 134
           P    G DPVP     K++N +
Sbjct: 78  PWNEGGEDPVPPCCNHKESNKE 99


>gi|331007968|ref|ZP_08331021.1| YidD [gamma proteobacterium IMCC1989]
 gi|330418223|gb|EGG92836.1| YidD [gamma proteobacterium IMCC1989]
          Length = 98

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 30/77 (38%), Positives = 45/77 (58%), Gaps = 3/77 (3%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            + + +I+ YQ I S + G  CR+ P+CS+Y   A  R+G + G+ L++ R+ KC+P   
Sbjct: 20  WLPLSLIKFYQYIISPLLGPRCRFYPSCSQYAETAYQRFGFFKGTLLSIKRIGKCHPWHE 79

Query: 117 DGFDPVPDDLPPKKNNP 133
            G D VPD    KKN P
Sbjct: 80  GGVDLVPD---KKKNTP 93


>gi|328956498|ref|YP_004373884.1| hypothetical protein CAR_c01170 [Carnobacterium sp. 17-4]
 gi|328672822|gb|AEB28868.1| hypothetical protein CAR_c01170 [Carnobacterium sp. 17-4]
          Length = 85

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 45/78 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I  I+ YQ   S +F  SCRY PTCS+Y  EAI ++G   G+ +   R+++C+P 
Sbjct: 1   MKKVIIASIKGYQKGISPLFQPSCRYYPTCSQYAIEAIEKHGAVKGTVMGTARILRCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G+DPVP     +KN 
Sbjct: 61  IKGGYDPVPKKFTLRKNR 78


>gi|322835123|ref|YP_004215150.1| hypothetical protein Rahaq_4437 [Rahnella sp. Y9602]
 gi|321170324|gb|ADW76023.1| protein of unknown function DUF37 [Rahnella sp. Y9602]
          Length = 85

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 38/78 (48%), Positives = 49/78 (62%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
           G  I I +IR YQL  S + G  CR+ PTCS+Y  EAI R+G+  GSWLTL R++KC+PL
Sbjct: 8   GSRILIKLIRGYQLFISPLLGPHCRFRPTCSQYSIEAIGRFGMLKGSWLTLKRVLKCHPL 67

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G DPVP      + +
Sbjct: 68  NPGGDDPVPPKTDNNREH 85


>gi|260432496|ref|ZP_05786467.1| conserved domain protein [Silicibacter lacuscaerulensis ITI-1157]
 gi|260416324|gb|EEX09583.1| conserved domain protein [Silicibacter lacuscaerulensis ITI-1157]
          Length = 79

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 37/75 (49%), Positives = 47/75 (62%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           T    I    IR Y+LIFS   G +CRY PTCS Y  EA+ ++G   G+WL   R+ +C+
Sbjct: 2   TPLAHILALPIRAYRLIFSPWVGFNCRYQPTCSAYALEALEKHGPIKGAWLAARRIGRCH 61

Query: 113 PLGSDGFDPVPDDLP 127
           P G DG+DPVPDD P
Sbjct: 62  PWGGDGYDPVPDDTP 76


>gi|317133707|ref|YP_004093021.1| protein of unknown function DUF37 [Ethanoligenens harbinense
           YUAN-3]
 gi|315471686|gb|ADU28290.1| protein of unknown function DUF37 [Ethanoligenens harbinense
           YUAN-3]
          Length = 81

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 45/81 (55%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + + +IR Y+   S +   SCRY PTCS+Y  +AI R+G   G WL + R+++C+P 
Sbjct: 1   MKQLLLALIRFYRRFVSPLKPPSCRYYPTCSQYAAQAIERFGALRGGWLAVRRILRCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNNPKL 135
              G DPVP+    +    K 
Sbjct: 61  NPGGIDPVPEQFSLRGARKKP 81


>gi|220914667|ref|YP_002489976.1| hypothetical protein Achl_3935 [Arthrobacter chlorophenolicus A6]
 gi|219861545|gb|ACL41887.1| protein of unknown function DUF37 [Arthrobacter chlorophenolicus
           A6]
          Length = 130

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 42/74 (56%)

Query: 50  FPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLI 109
           F     R I I +++ Y+ + S ++G  CR+ P+CS Y  EA+  +G   G+WL   RL 
Sbjct: 21  FLWNAPRNILILLLKAYRKVISPLYGQVCRFFPSCSAYALEAVTVHGAVKGTWLAARRLG 80

Query: 110 KCNPLGSDGFDPVP 123
           +C+P  + G D VP
Sbjct: 81  RCHPWNAGGVDHVP 94


>gi|319408459|emb|CBI82114.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 114

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 49/85 (57%), Positives = 65/85 (76%)

Query: 42  KSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGS 101
           ++RN+ G + KT GRL+G  +IR+YQ+  S++ GN CR+LPTCSEY YEAIARYGLW G+
Sbjct: 12  QTRNYTGPWRKTPGRLLGTTLIRLYQITLSSLIGNQCRHLPTCSEYAYEAIARYGLWAGA 71

Query: 102 WLTLLRLIKCNPLGSDGFDPVPDDL 126
           W+   R+I+C P G+ GFDPVP  L
Sbjct: 72  WMGFFRIIRCGPFGTYGFDPVPTSL 96


>gi|78185156|ref|YP_377591.1| hypothetical protein Syncc9902_1589 [Synechococcus sp. CC9902]
 gi|78169450|gb|ABB26547.1| Protein of unknown function DUF37 [Synechococcus sp. CC9902]
          Length = 104

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 36/103 (34%), Positives = 52/103 (50%), Gaps = 2/103 (1%)

Query: 22  SYALPIQKKGSPLLLKNNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYL 81
              +P         + +N  +   W G   +     + + +I  Y+   S + G  CR+ 
Sbjct: 4   PLQVPAHPSMHESPILSNGDQPNRWAGLNRRVAA--LLLALIGFYRTFISPLLGPRCRFT 61

Query: 82  PTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVPD 124
           PTCS YG EAI R+G W G WLTL R+++C+P    G DPVPD
Sbjct: 62  PTCSAYGLEAIQRHGPWRGGWLTLKRVLRCHPFTPCGCDPVPD 104


>gi|240950206|ref|ZP_04754493.1| hypothetical protein AM305_03128 [Actinobacillus minor NM305]
 gi|240295293|gb|EER46079.1| hypothetical protein AM305_03128 [Actinobacillus minor NM305]
          Length = 108

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 33/79 (41%), Positives = 43/79 (54%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           L   + +  I  YQ   S + G  CR+ PTCS Y  EAI  +G + G WL   R+++CNP
Sbjct: 27  LIAKLLLLPIYFYQYAISPLIGPRCRFYPTCSTYAVEAIKLHGAFKGGWLAFKRILRCNP 86

Query: 114 LGSDGFDPVPDDLPPKKNN 132
           L   G DPVP     KK+N
Sbjct: 87  LNEGGEDPVPPKCCAKKHN 105


>gi|15615392|ref|NP_243695.1| hypothetical protein BH2828 [Bacillus halodurans C-125]
 gi|14286088|sp|Q9K921|Y2828_BACHD RecName: Full=UPF0161 protein BH2828
 gi|10175450|dbj|BAB06548.1| alpha-hemolysin [Bacillus halodurans C-125]
          Length = 75

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 34/75 (45%), Positives = 45/75 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   IG IR+YQ   S +   +CR+ PTCS YG EAI R+G+  G WLT+ R+ KC+P 
Sbjct: 1   MKRFFIGCIRLYQKFISPLTPPTCRFYPTCSHYGIEAIQRFGVLKGGWLTIKRISKCHPF 60

Query: 115 GSDGFDPVPDDLPPK 129
              G DPVP+    K
Sbjct: 61  HRGGIDPVPEKKQEK 75


>gi|289524496|ref|ZP_06441350.1| putative alpha-hemolysin [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
 gi|289502265|gb|EFD23429.1| putative alpha-hemolysin [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
          Length = 76

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 31/68 (45%), Positives = 45/68 (66%)

Query: 56  RLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLG 115
           + + I  IR+YQ+  S + G +CR+ P+CS+Y  EAI ++G   GSWLT+ RL +C P  
Sbjct: 2   KRMLILSIRLYQIFLSPLLGRNCRFYPSCSQYALEAIEQWGAIRGSWLTVKRLCRCGPWH 61

Query: 116 SDGFDPVP 123
             G+DPVP
Sbjct: 62  PGGYDPVP 69


>gi|116072266|ref|ZP_01469533.1| hypothetical protein BL107_10781 [Synechococcus sp. BL107]
 gi|116064788|gb|EAU70547.1| hypothetical protein BL107_10781 [Synechococcus sp. BL107]
          Length = 92

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 35/89 (39%), Positives = 50/89 (56%), Gaps = 2/89 (2%)

Query: 36  LKNNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARY 95
           + +N  +   W G   +     + + +I  Y+   S + G  CR+ PTCS YG EAI R+
Sbjct: 6   ILSNEDQPTRWAGFNRRVAA--LFLALIGFYRAFISPLLGPRCRFTPTCSAYGLEAIQRH 63

Query: 96  GLWIGSWLTLLRLIKCNPLGSDGFDPVPD 124
           G W G WLTL R+++C+P    G DPVPD
Sbjct: 64  GPWRGGWLTLKRVLRCHPFTPCGCDPVPD 92


>gi|313902789|ref|ZP_07836186.1| protein of unknown function DUF37 [Thermaerobacter subterraneus DSM
           13965]
 gi|313466909|gb|EFR62426.1| protein of unknown function DUF37 [Thermaerobacter subterraneus DSM
           13965]
          Length = 100

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 28/76 (36%), Positives = 44/76 (57%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           +   + +  +R Y+   S +   +CRY PTCS Y  EA+ RYG+  G WL + R+++C+P
Sbjct: 4   VLTRVALAFLRFYRRWISPLKPPACRYTPTCSAYAMEAVERYGVLRGGWLVVRRVLRCHP 63

Query: 114 LGSDGFDPVPDDLPPK 129
               G+DPVP   P +
Sbjct: 64  WAPGGYDPVPQLAPLR 79


>gi|209525689|ref|ZP_03274226.1| protein of unknown function DUF37 [Arthrospira maxima CS-328]
 gi|209493858|gb|EDZ94176.1| protein of unknown function DUF37 [Arthrospira maxima CS-328]
          Length = 76

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 31/71 (43%), Positives = 48/71 (67%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I IG+I+ Y+ + S V   +CR+ PTCSEY  EAI R+G++ G W+ + R+++C+PL
Sbjct: 1   MKQILIGLIKGYKSLISPVLPPACRFYPTCSEYAMEAIDRFGIFRGGWMAIARILRCHPL 60

Query: 115 GSDGFDPVPDD 125
              G+DPVP  
Sbjct: 61  HPGGYDPVPPK 71


>gi|254494881|ref|ZP_01052220.2| protein of unknown function DUF37 [Polaribacter sp. MED152]
 gi|213690463|gb|EAQ41648.2| protein of unknown function DUF37 [Polaribacter sp. MED152]
          Length = 79

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 32/79 (40%), Positives = 46/79 (58%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            K +     I ++R YQ   S     +CRY PTCS Y  EA+ ++GL+ G WL+L R+  
Sbjct: 1   MKKILSYPFILLVRFYQTAISPFTPATCRYSPTCSHYTIEALQKHGLFSGGWLSLKRIFS 60

Query: 111 CNPLGSDGFDPVPDDLPPK 129
           C+P G  G+DPVP+ +  K
Sbjct: 61  CHPWGGSGYDPVPEKIKEK 79


>gi|91777107|ref|YP_546863.1| hypothetical protein Mfla_2759 [Methylobacillus flagellatus KT]
 gi|116256212|sp|Q1GXL5|Y2759_METFK RecName: Full=UPF0161 protein Mfla_2759
 gi|91711094|gb|ABE51022.1| protein of unknown function DUF37 [Methylobacillus flagellatus KT]
          Length = 70

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 30/70 (42%), Positives = 45/70 (64%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           +   + +G+I++YQ   S + G  CR+ PTCS+Y  EAI ++G W G++ T+ RL KC+P
Sbjct: 1   MLARLLVGLIKLYQWTLSPLLGQRCRFYPTCSQYAVEAIQKHGAWRGAFFTICRLSKCHP 60

Query: 114 LGSDGFDPVP 123
               G DPVP
Sbjct: 61  WHDGGHDPVP 70


>gi|323488371|ref|ZP_08093618.1| hypothetical protein GPDM_03475 [Planococcus donghaensis MPA1U2]
 gi|323397878|gb|EGA90677.1| hypothetical protein GPDM_03475 [Planococcus donghaensis MPA1U2]
          Length = 76

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 30/76 (39%), Positives = 43/76 (56%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   + I R YQ   S +   SCR+ PTCS YG EA+ ++G   G +L   R++ C+P 
Sbjct: 1   MKTALLKIFRFYQRFISPLSPPSCRFYPTCSHYGIEAVEKHGALKGGYLATKRILSCHPF 60

Query: 115 GSDGFDPVPDDLPPKK 130
              G D VP++ PPKK
Sbjct: 61  HKGGIDFVPEEWPPKK 76


>gi|312130790|ref|YP_003998130.1| hypothetical protein Lbys_2081 [Leadbetterella byssophila DSM
           17132]
 gi|311907336|gb|ADQ17777.1| protein of unknown function DUF37 [Leadbetterella byssophila DSM
           17132]
          Length = 83

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 44/80 (55%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
            +F         I ++RIYQ   S    N+CRY PTCS Y  ++I  +G+  G+WL L R
Sbjct: 1   MQFLNNTLGKFFILLVRIYQAGISPWLPNACRYDPTCSHYMIQSIKEWGVIKGTWLGLKR 60

Query: 108 LIKCNPLGSDGFDPVPDDLP 127
           + +C+P G  G+DPVP    
Sbjct: 61  IGRCHPWGGFGYDPVPKKDK 80


>gi|148238928|ref|YP_001224315.1| hypothetical protein SynWH7803_0592 [Synechococcus sp. WH 7803]
 gi|147847467|emb|CAK23018.1| Conserved hypothetical protein [Synechococcus sp. WH 7803]
          Length = 106

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 54/92 (58%), Gaps = 3/92 (3%)

Query: 36  LKNNTPKSRNWNGKFPKTLGR---LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAI 92
           ++ +T  S + N    + L R    + + +I  Y+  FS + G  CR++P+CS YG EAI
Sbjct: 15  MRESTIVSGDRNPSVQQALNRGLAQVMLALIGFYRRWFSPLLGPRCRFIPSCSAYGLEAI 74

Query: 93  ARYGLWIGSWLTLLRLIKCNPLGSDGFDPVPD 124
            R+G W G WLTL R+ +C+P    G DPVPD
Sbjct: 75  QRHGPWRGGWLTLRRISRCHPFTPCGCDPVPD 106


>gi|163791161|ref|ZP_02185579.1| hypothetical protein CAT7_04364 [Carnobacterium sp. AT7]
 gi|159873556|gb|EDP67642.1| hypothetical protein CAT7_04364 [Carnobacterium sp. AT7]
          Length = 85

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 46/78 (58%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I  I+ YQ   S +F  SCRY PTCS Y  EAI ++G+  G+ +   R+++C+P 
Sbjct: 1   MKKVLIAGIKGYQKGISPLFQPSCRYYPTCSHYAIEAIEKHGVVKGTVMGTARILRCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G+DPVP+    ++N 
Sbjct: 61  IKGGYDPVPNKFTLRRNK 78


>gi|57867275|ref|YP_188927.1| hypothetical protein SERP1356 [Staphylococcus epidermidis RP62A]
 gi|81674066|sp|Q5HNB4|Y1356_STAEQ RecName: Full=UPF0161 protein SERP1356
 gi|57637933|gb|AAW54721.1| conserved hypothetical protein TIGR00278 [Staphylococcus
           epidermidis RP62A]
 gi|319401091|gb|EFV89310.1| conserved hypothetical protein [Staphylococcus epidermidis FRI909]
          Length = 82

 Score =  109 bits (272), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 2/79 (2%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I + ++  YQ   S +   +CR+ PTCS+Y  EAI  +G   G +L + R++KC+PL
Sbjct: 1   MKKILLSLVVFYQRFISPLTPPTCRFYPTCSQYTREAIEYHGALKGLYLGVRRILKCHPL 60

Query: 115 GSDGFDPVPDDLPPKKNNP 133
              GFDPVP  L   KN+ 
Sbjct: 61  HKGGFDPVP--LKKDKNSK 77


>gi|281412769|ref|YP_003346848.1| protein of unknown function DUF37 [Thermotoga naphthophila RKU-10]
 gi|281373872|gb|ADA67434.1| protein of unknown function DUF37 [Thermotoga naphthophila RKU-10]
          Length = 81

 Score =  109 bits (272), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 47/75 (62%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I +IR YQ   S +   +CR+ PTCS Y  +A+ ++G   G++L L R+++CNPL
Sbjct: 1   MKKLLIMLIRFYQRYISPLKPPTCRFTPTCSNYFIQALEKHGFLKGTFLGLRRILRCNPL 60

Query: 115 GSDGFDPVPDDLPPK 129
              G+DPVP++   K
Sbjct: 61  SKGGYDPVPEEFSFK 75


>gi|88705403|ref|ZP_01103114.1| protein containing DUF37 [Congregibacter litoralis KT71]
 gi|88700493|gb|EAQ97601.1| protein containing DUF37 [Congregibacter litoralis KT71]
          Length = 80

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 29/73 (39%), Positives = 41/73 (56%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
              +   +   +IR YQL  S + G+ CRY P+CS Y  EAI  +G W G  L + R+++
Sbjct: 1   MNAVFTSLLRALIRGYQLFISPLLGHHCRYYPSCSSYAVEAIEEHGAWKGCGLAVRRVLR 60

Query: 111 CNPLGSDGFDPVP 123
           C+P    G DPVP
Sbjct: 61  CHPWHEGGADPVP 73


>gi|212704366|ref|ZP_03312494.1| hypothetical protein DESPIG_02421 [Desulfovibrio piger ATCC 29098]
 gi|212672225|gb|EEB32708.1| hypothetical protein DESPIG_02421 [Desulfovibrio piger ATCC 29098]
          Length = 76

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 43/70 (61%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + R + +  IR YQL  S V   +CR+ PTCS Y  EAI  +G+  G WL L RL +C+P
Sbjct: 1   MLRRLFVLPIRFYQLFISPVLPPACRFYPTCSAYALEAIMTHGVLRGGWLALRRLARCHP 60

Query: 114 LGSDGFDPVP 123
            G  G+DPVP
Sbjct: 61  WGGSGYDPVP 70


>gi|113955591|ref|YP_729848.1| hypothetical protein sync_0630 [Synechococcus sp. CC9311]
 gi|122945786|sp|Q0ICH4|Y630_SYNS3 RecName: Full=UPF0161 protein sync_0630
 gi|113882942|gb|ABI47900.1| conserved hypothetical protein TIGR00278 [Synechococcus sp. CC9311]
          Length = 88

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 36/89 (40%), Positives = 52/89 (58%), Gaps = 1/89 (1%)

Query: 36  LKNNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARY 95
           +  +T  S      F + +   + + +I +Y+   S + G  CR++PTCS YG EAI R+
Sbjct: 1   MHESTILSAGSTNPFNR-IVSAVMLALIELYRRWISPLIGPRCRFIPTCSAYGIEAIQRH 59

Query: 96  GLWIGSWLTLLRLIKCNPLGSDGFDPVPD 124
           G W G WLTL RL++C+P    G DPVPD
Sbjct: 60  GPWRGGWLTLRRLLRCHPFTPCGCDPVPD 88


>gi|167582767|ref|ZP_02375641.1| hypothetical protein BthaT_31781 [Burkholderia thailandensis TXDOH]
 gi|167620895|ref|ZP_02389526.1| hypothetical protein BthaB_31611 [Burkholderia thailandensis Bt4]
          Length = 101

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 29/83 (34%), Positives = 46/83 (55%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
             T  + + I ++R Y+L  S + G+ CR+ P+CS+Y  EAI  +G   G++L   RL +
Sbjct: 9   AATAMQTVLIALLRFYKLAVSPLLGSRCRFYPSCSDYAREAIQYHGAARGTYLAARRLCR 68

Query: 111 CNPLGSDGFDPVPDDLPPKKNNP 133
           C+P  + G D VP      +N P
Sbjct: 69  CHPFSAGGIDLVPPPNSDARNAP 91


>gi|315223142|ref|ZP_07865010.1| conserved hypothetical protein YidD [Streptococcus anginosus F0211]
 gi|315187831|gb|EFU21578.1| conserved hypothetical protein YidD [Streptococcus anginosus F0211]
          Length = 85

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 43/78 (55%), Gaps = 1/78 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + I I  +R YQ   S  F  SCRY PTCS Y  +AI ++G   G  +   R+++C+P
Sbjct: 1   MMKKIFIAPVRFYQKFISPAFPPSCRYQPTCSNYMIQAIEKHGA-KGVLMGTARILRCHP 59

Query: 114 LGSDGFDPVPDDLPPKKN 131
               G DPVPD    K+N
Sbjct: 60  WAEGGDDPVPDVFSLKRN 77


>gi|299535332|ref|ZP_07048654.1| hypothetical protein BFZC1_04898 [Lysinibacillus fusiformis ZC1]
 gi|298729093|gb|EFI69646.1| hypothetical protein BFZC1_04898 [Lysinibacillus fusiformis ZC1]
          Length = 77

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 32/77 (41%), Positives = 47/77 (61%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   I +I+ Y+   S +   +CR+ PTCS YG EA  ++G + G +LT+ R+ KC+P 
Sbjct: 1   MKYPFIWLIQFYRKFISPMTPPTCRFHPTCSSYGLEAFQKHGAFKGFFLTITRISKCHPF 60

Query: 115 GSDGFDPVPDDLPPKKN 131
              GFDPVP+  P KKN
Sbjct: 61  HPGGFDPVPEKWPSKKN 77


>gi|325281344|ref|YP_004253886.1| hypothetical protein Odosp_2728 [Odoribacter splanchnicus DSM
           20712]
 gi|324313153|gb|ADY33706.1| UPF0161 protein yidD [Odoribacter splanchnicus DSM 20712]
          Length = 76

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 30/76 (39%), Positives = 46/76 (60%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
               K +   + +  IR YQ   S +   +CR++PTCS+Y  EAI ++G + G WL + R
Sbjct: 1   MTLIKCIISHLLLLPIRFYQYCISPLKPPTCRFVPTCSQYAIEAIRKHGPFKGLWLAIKR 60

Query: 108 LIKCNPLGSDGFDPVP 123
           L++C+P G  G+DPVP
Sbjct: 61  LLRCHPWGGSGYDPVP 76


>gi|315023248|gb|EFT36258.1| hypothetical protein RAYM_08715 [Riemerella anatipestifer RA-YM]
          Length = 76

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 28/64 (43%), Positives = 41/64 (64%)

Query: 62  IIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDP 121
           +I+ YQ   S   GN+CRY PTCS Y  +A+ ++G   G WL + R+ +C+P G  G+DP
Sbjct: 8   LIKFYQSAISPWLGNNCRYQPTCSHYMLQALRKHGFLSGFWLGIKRIGRCHPWGGSGYDP 67

Query: 122 VPDD 125
           VP+ 
Sbjct: 68  VPEK 71


>gi|269468578|gb|EEZ80227.1| hypothetical protein Sup05_0698 [uncultured SUP05 cluster
           bacterium]
          Length = 74

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 29/71 (40%), Positives = 45/71 (63%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R + +  I+ YQL  S + G++CR+ PTCS+Y Y+A+  +G + G  L++ R+ KC+P 
Sbjct: 1   MRYLLLIPIKFYQLFISPILGSNCRFDPTCSQYSYDAVKEHGFFKGLNLSIKRIGKCHPW 60

Query: 115 GSDGFDPVPDD 125
              GFDPVP  
Sbjct: 61  HDGGFDPVPKK 71


>gi|319938700|ref|ZP_08013064.1| hypothetical protein HMPREF9459_00050 [Streptococcus anginosus
           1_2_62CV]
 gi|319811750|gb|EFW08016.1| hypothetical protein HMPREF9459_00050 [Streptococcus anginosus
           1_2_62CV]
          Length = 85

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 44/78 (56%), Gaps = 1/78 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + I I  +R YQ   S  F  SCRY PTCS Y  +AI ++G   G  + + R+++C+P
Sbjct: 1   MMKKIFIEPVRFYQKFISPAFPPSCRYQPTCSNYMIQAIEKHGA-KGVLMGIARILRCHP 59

Query: 114 LGSDGFDPVPDDLPPKKN 131
               G DPVPD    K+N
Sbjct: 60  WAEGGDDPVPDVFSLKRN 77


>gi|315128187|ref|YP_004070190.1| hypothetical protein PSM_A3125 [Pseudoalteromonas sp. SM9913]
 gi|315016700|gb|ADT70038.1| hypothetical protein PSM_A3125 [Pseudoalteromonas sp. SM9913]
          Length = 91

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 34/83 (40%), Positives = 45/83 (54%)

Query: 49  KFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRL 108
           K    L     +  IR YQ   S + G  CR+ PTCS Y  +AI  +G   GSWL + R+
Sbjct: 5   KPLAALPTRCLVLFIRGYQKWISPLLGPHCRFNPTCSSYAIQAINLHGAVKGSWLAVKRI 64

Query: 109 IKCNPLGSDGFDPVPDDLPPKKN 131
           +KC+PL S G DPVP+ L    +
Sbjct: 65  LKCHPLHSGGDDPVPEKLTRINH 87


>gi|270291017|ref|ZP_06197240.1| conserved hypothetical protein [Pediococcus acidilactici 7_4]
 gi|270280413|gb|EFA26248.1| conserved hypothetical protein [Pediococcus acidilactici 7_4]
          Length = 85

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 31/85 (36%), Positives = 49/85 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   + ++R YQ + S +F  SCRY PTCS Y   A+ R+G   G+ + + R+++CNP 
Sbjct: 1   MKSFLLMLVRGYQRVISPLFPPSCRYYPTCSNYMVGALKRFGALQGTLMGIARILRCNPF 60

Query: 115 GSDGFDPVPDDLPPKKNNPKLLSKK 139
              G+DPVPD    K+N+     +K
Sbjct: 61  VRGGYDPVPDQFSLKRNSKNSAERK 85


>gi|15644211|ref|NP_229261.1| hypothetical protein TM1462 [Thermotoga maritima MSB8]
 gi|148270462|ref|YP_001244922.1| hypothetical protein Tpet_1332 [Thermotoga petrophila RKU-1]
 gi|170289143|ref|YP_001739381.1| hypothetical protein TRQ2_1354 [Thermotoga sp. RQ2]
 gi|14286076|sp|Q9X1H3|Y1462_THEMA RecName: Full=UPF0161 protein TM_1462
 gi|166200366|sp|A5IMC3|Y1332_THEP1 RecName: Full=UPF0161 protein Tpet_1332
 gi|226734106|sp|B1LBK0|Y1354_THESQ RecName: Full=UPF0161 protein TRQ2_1354
 gi|4982027|gb|AAD36530.1|AE001797_10 conserved hypothetical protein [Thermotoga maritima MSB8]
 gi|147736006|gb|ABQ47346.1| protein of unknown function DUF37 [Thermotoga petrophila RKU-1]
 gi|170176646|gb|ACB09698.1| protein of unknown function DUF37 [Thermotoga sp. RQ2]
          Length = 81

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 48/75 (64%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I +IR YQ   S +   +CR+ PTCS Y  +A+ ++GL  G++L L R+++CNPL
Sbjct: 1   MKKLLIMLIRFYQRYISPLKPPTCRFTPTCSNYFIQALEKHGLLKGTFLGLRRILRCNPL 60

Query: 115 GSDGFDPVPDDLPPK 129
              G+DPVP++   K
Sbjct: 61  SKGGYDPVPEEFSFK 75


>gi|258544269|ref|ZP_05704503.1| toxin-antitoxin system, toxin component [Cardiobacterium hominis
           ATCC 15826]
 gi|258520507|gb|EEV89366.1| toxin-antitoxin system, toxin component [Cardiobacterium hominis
           ATCC 15826]
          Length = 80

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 32/75 (42%), Positives = 46/75 (61%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + IG IR+Y+   S   G  CR+ PTCS YG EAIA++G   G+ LT+ R+++C P 
Sbjct: 1   MKRLLIGAIRLYRKTLSPFIGQQCRFEPTCSHYGEEAIAKHGALRGTILTVWRILRCGPW 60

Query: 115 GSDGFDPVPDDLPPK 129
              G+DPVP+    K
Sbjct: 61  SKGGYDPVPETFLVK 75


>gi|159025939|emb|CAO86234.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 76

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 32/69 (46%), Positives = 46/69 (66%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I IG+I  Y+   S +F  SCR+ PTCS+Y  EAI R+G+  GSWL + R+++C+P 
Sbjct: 1   MKGIFIGLIEGYRRFISPLFPPSCRFQPTCSQYAIEAIDRFGVLRGSWLAIKRILRCHPF 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  HPGGYDPVP 69


>gi|46447002|ref|YP_008367.1| hypothetical protein pc1368 [Candidatus Protochlamydia amoebophila
           UWE25]
 gi|81626801|sp|Q6MBF7|Y1368_PARUW RecName: Full=UPF0161 protein pc1368
 gi|46400643|emb|CAF24092.1| conserved hypothetical protein [Candidatus Protochlamydia
           amoebophila UWE25]
          Length = 82

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 44/79 (55%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + + I  +R YQ   S + G +CR+ PTCSEY   A+ ++G   G++L + R+ +C+P
Sbjct: 1   MIKKLLIYFVRFYQYTLSPLLGLTCRFYPTCSEYMILALQKHGAMKGAYLGVKRICRCHP 60

Query: 114 LGSDGFDPVPDDLPPKKNN 132
               G DPVP+     K  
Sbjct: 61  WNPGGHDPVPESTILSKEK 79


>gi|21672846|ref|NP_660911.1| hypothetical protein CT0005 [Chlorobium tepidum TLS]
 gi|29428216|sp|Q8KGG3|Y005_CHLTE RecName: Full=UPF0161 protein CT0005
 gi|21645894|gb|AAM71253.1| conserved hypothetical protein [Chlorobium tepidum TLS]
          Length = 83

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 45/80 (56%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
             ++ I +IR YQ   S + G SC+Y PTCS Y  EA  ++  +  SWLT+ R+++CNP 
Sbjct: 1   MNIVPILLIRFYQSFISPLLGPSCKYHPTCSNYAIEAFRQHNFFYASWLTVWRVLRCNPF 60

Query: 115 GSDGFDPVPDDLPPKKNNPK 134
              G+DPVP        N K
Sbjct: 61  SKGGYDPVPPKSVKSAGNSK 80


>gi|152983020|ref|YP_001355385.1| alpha-hemolysin [Janthinobacterium sp. Marseille]
 gi|166990890|sp|A6T4D8|Y3695_JANMA RecName: Full=UPF0161 protein mma_3695
 gi|151283097|gb|ABR91507.1| alpha-hemolysin [Janthinobacterium sp. Marseille]
          Length = 86

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 40/69 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I   ++R YQL  S   G +CR+ P+CS Y  EA+  +G   GS+L   RL KC+P 
Sbjct: 1   MKTILQLLVRAYQLGISPFLGQNCRFYPSCSSYAIEALEEHGALKGSFLATKRLCKCHPW 60

Query: 115 GSDGFDPVP 123
            + G DPVP
Sbjct: 61  HAGGVDPVP 69


>gi|167907148|ref|ZP_02494353.1| hypothetical protein BpseN_33260 [Burkholderia pseudomallei NCTC
           13177]
          Length = 76

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 32/71 (45%), Positives = 43/71 (60%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            + ++R YQL  S + G  CR+ PTCS+Y  EA+  +G   G+WLTL RL +C+PL   G
Sbjct: 1   MVLLVRGYQLFTSPMLGPRCRFHPTCSQYAIEALRTHGALNGTWLTLRRLARCHPLHPGG 60

Query: 119 FDPVPDDLPPK 129
            DPVP     K
Sbjct: 61  HDPVPARHSDK 71


>gi|226229339|ref|YP_002763445.1| hypothetical protein GAU_3933 [Gemmatimonas aurantiaca T-27]
 gi|226092530|dbj|BAH40975.1| hypothetical protein [Gemmatimonas aurantiaca T-27]
          Length = 80

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 46/72 (63%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           +T  R + + ++R YQL  S +FG +CRY P+CS Y  EA+ ++G   G WL + R+ +C
Sbjct: 9   RTWPRTLLVLLVRGYQLTLSPIFGGACRYYPSCSAYAIEALEKHGALRGGWLAMRRIARC 68

Query: 112 NPLGSDGFDPVP 123
           +P    GFDPVP
Sbjct: 69  HPFRPGGFDPVP 80


>gi|254410287|ref|ZP_05024067.1| conserved hypothetical protein TIGR00278 [Microcoleus
           chthonoplastes PCC 7420]
 gi|196183323|gb|EDX78307.1| conserved hypothetical protein TIGR00278 [Microcoleus
           chthonoplastes PCC 7420]
          Length = 85

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 49/75 (65%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + +++ I +IR Y+ + S +F  +CR+ PTCS Y  +AI R+G W GS L L R+++C+P
Sbjct: 1   MMKILLIWLIRAYKTLISPIFPPTCRFHPTCSTYALQAIERFGPWRGSILALRRILRCHP 60

Query: 114 LGSDGFDPVPDDLPP 128
               G+DP+PD  P 
Sbjct: 61  FHPGGYDPIPDATPK 75


>gi|297528977|ref|YP_003670252.1| hypothetical protein GC56T3_0626 [Geobacillus sp. C56-T3]
 gi|297252229|gb|ADI25675.1| protein of unknown function DUF37 [Geobacillus sp. C56-T3]
          Length = 80

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 35/76 (46%), Positives = 46/76 (60%), Gaps = 2/76 (2%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            I  IR YQ   S +   +CR+ PTCS YG EAI R+G   G WLT+ R++KC+P    G
Sbjct: 5   LIWCIRFYQRFLSPLKPPTCRFYPTCSNYGIEAIRRFGAIKGGWLTVKRILKCHPFHPGG 64

Query: 119 FDPVPDDLP--PKKNN 132
            DPVP+ +    +KNN
Sbjct: 65  LDPVPELIHHLKRKNN 80


>gi|312882241|ref|ZP_07741987.1| hypothetical protein VIBC2010_13271 [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309370085|gb|EFP97591.1| hypothetical protein VIBC2010_13271 [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 85

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 32/73 (43%), Positives = 45/73 (61%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
           P +    + IG++R+Y+ + S + G  CR+ PTCSEY  EA   +G   G WLT  RL+K
Sbjct: 4   PFSPLTWLAIGLVRLYRGLISPLIGPRCRFTPTCSEYAIEAFKLHGFIKGCWLTSKRLLK 63

Query: 111 CNPLGSDGFDPVP 123
           C+P    G+DPVP
Sbjct: 64  CHPCNKGGYDPVP 76


>gi|289209760|ref|YP_003461826.1| hypothetical protein TK90_2601 [Thioalkalivibrio sp. K90mix]
 gi|288945391|gb|ADC73090.1| protein of unknown function DUF37 [Thioalkalivibrio sp. K90mix]
          Length = 85

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 30/72 (41%), Positives = 43/72 (59%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           TL R I +  +R YQ   S      CR+ PTCS Y  EA+ ++G+  G WL L R+++C+
Sbjct: 2   TLVRKIALLPVRAYQYGISPFMAPHCRHYPTCSAYTVEAVEKHGVTRGFWLGLRRILRCH 61

Query: 113 PLGSDGFDPVPD 124
           P    G+DPVP+
Sbjct: 62  PWSPGGYDPVPE 73


>gi|110834998|ref|YP_693857.1| hypothetical protein ABO_2137 [Alcanivorax borkumensis SK2]
 gi|110648109|emb|CAL17585.1| conserved hypothetical protein [Alcanivorax borkumensis SK2]
          Length = 184

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 42/77 (54%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
                + + +G I +YQ + S   GN CR+ PTCSEY  +A+  +G   GS L   RL K
Sbjct: 84  SAVPVKSLLLGAIWLYQKVLSPWIGNQCRFYPTCSEYARQAVETHGSLRGSALAAKRLCK 143

Query: 111 CNPLGSDGFDPVPDDLP 127
           C+P    GFD VP  +P
Sbjct: 144 CHPWHPGGFDYVPGAVP 160


>gi|317051003|ref|YP_004112119.1| hypothetical protein Selin_0823 [Desulfurispirillum indicum S5]
 gi|316946087|gb|ADU65563.1| protein of unknown function DUF37 [Desulfurispirillum indicum S5]
          Length = 70

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 45/70 (64%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I IIR Y+ I S +   SCR+ PTCS Y  EA  R+G + G +LTL RL++C+P 
Sbjct: 1   MKHVMILIIRFYRYIISPMLPPSCRFTPTCSSYALEAFTRHGFFKGFYLTLWRLLRCHPF 60

Query: 115 GSDGFDPVPD 124
              G+DPVPD
Sbjct: 61  CKGGYDPVPD 70


>gi|253752381|ref|YP_003025522.1| hypothetical protein SSUSC84_1535 [Streptococcus suis SC84]
 gi|253754207|ref|YP_003027348.1| hypothetical protein SSU1509 [Streptococcus suis P1/7]
 gi|253756141|ref|YP_003029281.1| hypothetical protein SSUBM407_1583 [Streptococcus suis BM407]
 gi|251816670|emb|CAZ52311.1| conserved hypothetical protein [Streptococcus suis SC84]
 gi|251818605|emb|CAZ56439.1| conserved hypothetical protein [Streptococcus suis BM407]
 gi|251820453|emb|CAR47151.1| conserved hypothetical protein [Streptococcus suis P1/7]
 gi|319758786|gb|ADV70728.1| hypothetical protein SSUJS14_1668 [Streptococcus suis JS14]
          Length = 79

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 34/80 (42%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              + IG++R YQ   S +F  SCRY PTCS Y  EA+ ++G   G  + L R+ +C+PL
Sbjct: 1   MTRLLIGLVRFYQKFISPLFPPSCRYRPTCSAYMIEALQKHG-LKGFLMGLARIGRCHPL 59

Query: 115 GSDGFDPVPDDLPPKKNNPK 134
              G DPVPD    K+N  K
Sbjct: 60  VEGGEDPVPDRFSLKRNKQK 79


>gi|94501617|ref|ZP_01308134.1| hypothetical protein RED65_08544 [Oceanobacter sp. RED65]
 gi|94426300|gb|EAT11291.1| hypothetical protein RED65_08544 [Oceanobacter sp. RED65]
          Length = 76

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 31/69 (44%), Positives = 48/69 (69%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           IR Y++  S +  N CR++PTCSEY  EA+ ++G   G WL++ R+ +C+P G+ G+DPV
Sbjct: 8   IRFYRIAISPMLPNRCRHIPTCSEYALEALQKHGPITGLWLSIKRIGRCHPWGTHGYDPV 67

Query: 123 PDDLPPKKN 131
           PD+   KK+
Sbjct: 68  PDNHDIKKS 76


>gi|78357438|ref|YP_388887.1| hypothetical protein Dde_2395 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|116256201|sp|Q30YQ4|Y2395_DESDG RecName: Full=UPF0161 protein Dde_2395
 gi|78219843|gb|ABB39192.1| Protein of unknown function DUF37 [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 86

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 34/69 (49%), Positives = 47/69 (68%)

Query: 56  RLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLG 115
           R I I  IR YQ   S +F  SCR++PTCS Y  EA+ R+G+  G +L L R+++CNPL 
Sbjct: 6   RKIAILPIRFYQRFISPLFPPSCRFVPTCSAYAAEAVLRHGIIKGGFLALRRILRCNPLC 65

Query: 116 SDGFDPVPD 124
           + G+DPVP+
Sbjct: 66  AGGYDPVPE 74


>gi|256842848|ref|ZP_05548336.1| conserved hypothetical protein [Lactobacillus crispatus 125-2-CHN]
 gi|256848788|ref|ZP_05554222.1| conserved hypothetical protein [Lactobacillus crispatus MV-1A-US]
 gi|262045814|ref|ZP_06018778.1| conserved hypothetical protein [Lactobacillus crispatus MV-3A-US]
 gi|312977632|ref|ZP_07789379.1| putative toxin-antitoxin system, toxin component [Lactobacillus
           crispatus CTV-05]
 gi|256614268|gb|EEU19469.1| conserved hypothetical protein [Lactobacillus crispatus 125-2-CHN]
 gi|256714327|gb|EEU29314.1| conserved hypothetical protein [Lactobacillus crispatus MV-1A-US]
 gi|260573773|gb|EEX30329.1| conserved hypothetical protein [Lactobacillus crispatus MV-3A-US]
 gi|310895371|gb|EFQ44438.1| putative toxin-antitoxin system, toxin component [Lactobacillus
           crispatus CTV-05]
          Length = 97

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 47/78 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R I I I+RIYQ + S +   SCRY PTCS Y  +A+ ++G  +G  + + R+++CNP 
Sbjct: 1   MRKILIFIVRIYQTVISPLLPPSCRYYPTCSNYMIDALKKHGPILGLIMGICRILRCNPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G DPVPD+    +N 
Sbjct: 61  IKGGVDPVPDNFTIFRNP 78


>gi|220936474|ref|YP_002515373.1| hypothetical protein Tgr7_3319 [Thioalkalivibrio sp. HL-EbGR7]
 gi|219997784|gb|ACL74386.1| conserved hypothetical protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 82

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R   I +I+ Y+L+ S   G  CR+ P+CS Y  EAI R+G   G+WLT+ RL +C+P 
Sbjct: 1   MRKPLILLIQAYRLLLSPFIGQHCRFTPSCSCYAIEAIERHGALRGTWLTVTRLGRCHPW 60

Query: 115 GSDGFDPVPD-DLPPKKNNPK 134
              G+DPVPD D PP K + K
Sbjct: 61  CEGGYDPVPDTDTPPSKTHTK 81


>gi|152997015|ref|YP_001341850.1| hypothetical protein Mmwyl1_3004 [Marinomonas sp. MWYL1]
 gi|189039803|sp|A6VZN6|Y3004_MARMS RecName: Full=UPF0161 protein Mmwyl1_3004
 gi|150837939|gb|ABR71915.1| protein of unknown function DUF37 [Marinomonas sp. MWYL1]
          Length = 93

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 33/80 (41%), Positives = 47/80 (58%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I I++ YQ + S + GN+CR+ P+CS Y  +AI RYG++ G +L L RL KC+P 
Sbjct: 1   MKRIFILIVKSYQFLISPLLGNNCRFYPSCSHYMIQAIERYGIFKGMYLGLKRLSKCHPW 60

Query: 115 GSDGFDPVPDDLPPKKNNPK 134
              G DPVP     K    +
Sbjct: 61  HEGGMDPVPSSCHCKDEKNR 80


>gi|284050791|ref|ZP_06381001.1| hypothetical protein AplaP_04884 [Arthrospira platensis str.
           Paraca]
 gi|291566645|dbj|BAI88917.1| hypothetical protein [Arthrospira platensis NIES-39]
          Length = 76

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 32/71 (45%), Positives = 48/71 (67%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I IG+IR Y+ + S V   +CR+ PTCSEY  EAI R+G++ G W+ + R+++C+PL
Sbjct: 1   MKRILIGLIRGYKSLISPVLPPACRFYPTCSEYAMEAIDRFGIFRGGWMAIARILRCHPL 60

Query: 115 GSDGFDPVPDD 125
              G+DPVP  
Sbjct: 61  HPGGYDPVPPK 71


>gi|327402624|ref|YP_004343462.1| hypothetical protein Fluta_0620 [Fluviicola taffensis DSM 16823]
 gi|327318132|gb|AEA42624.1| UPF0161 protein yidD [Fluviicola taffensis DSM 16823]
          Length = 90

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 35/87 (40%), Positives = 49/87 (56%), Gaps = 2/87 (2%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
            K+ K     + I  ++IYQ I S +  N+CRY PTCS Y  EA+  +G   G WL   R
Sbjct: 1   MKYIKQFFVSLLIVPVKIYQWIISPILPNACRYDPTCSAYMIEALKIHGPIKGLWLGTRR 60

Query: 108 LIKCNPLGSDGFDPVPDDL--PPKKNN 132
           + +C+P G  G+DPVP+      K+NN
Sbjct: 61  ISRCHPWGGFGYDPVPEKKCGCKKENN 87


>gi|158341163|ref|YP_001522474.1| hypothetical protein AM1_F0170 [Acaryochloris marina MBIC11017]
 gi|158311404|gb|ABW33015.1| conserved domain protein [Acaryochloris marina MBIC11017]
          Length = 100

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 31/69 (44%), Positives = 45/69 (65%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + IG+I+ Y+   S +F  SCR+ PTCS Y  EAI+ +G+  GSWL L R+ +C+P 
Sbjct: 1   MKTLLIGLIQFYRRFISPLFLPSCRFQPTCSAYAIEAISTWGVLKGSWLALKRICRCHPF 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  HPGGYDPVP 69


>gi|237749311|ref|ZP_04579791.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13]
 gi|229380673|gb|EEO30764.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13]
          Length = 92

 Score =  108 bits (270), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 32/73 (43%), Positives = 46/73 (63%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            ++  + + I +IR YQL  S   G +CR+ P+CS+Y  EAI+ +G   G +LT +RL K
Sbjct: 1   MQSPLKWLLIVLIRGYQLCISPFIGQNCRFYPSCSQYAIEAISVHGCLKGCYLTFIRLCK 60

Query: 111 CNPLGSDGFDPVP 123
           C+PL   G DPVP
Sbjct: 61  CHPLHPGGVDPVP 73


>gi|332308617|ref|YP_004436468.1| hypothetical protein Glaag_4277 [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332175946|gb|AEE25200.1| protein of unknown function DUF37 [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 70

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 48/70 (68%)

Query: 62  IIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDP 121
           +IR+YQL  S + G +CR+ PTCS Y  EAI ++G+ IG WL++ R++KC+PL S G D 
Sbjct: 1   MIRLYQLWLSPLLGQNCRFHPTCSYYAIEAIKQHGIIIGGWLSIKRILKCHPLHSGGIDL 60

Query: 122 VPDDLPPKKN 131
           VP+     K+
Sbjct: 61  VPEKKKQNKH 70


>gi|268316375|ref|YP_003290094.1| hypothetical protein Rmar_0809 [Rhodothermus marinus DSM 4252]
 gi|262333909|gb|ACY47706.1| protein of unknown function DUF37 [Rhodothermus marinus DSM 4252]
          Length = 98

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 36/74 (48%), Positives = 47/74 (63%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
           G+F  TL R + IG++R YQLI S    ++CRY P+CS Y  EA  +YG   G  LTL R
Sbjct: 8   GRFLWTLPRRLLIGLVRGYQLIISPHLPDTCRYTPSCSHYAIEAFQKYGAVRGLILTLWR 67

Query: 108 LIKCNPLGSDGFDP 121
           L +C+P G  G+DP
Sbjct: 68  LARCHPWGGYGYDP 81


>gi|119900279|ref|YP_935492.1| hypothetical protein azo3990 [Azoarcus sp. BH72]
 gi|166227214|sp|A1KCQ0|Y3990_AZOSB RecName: Full=UPF0161 protein azo3990
 gi|119672692|emb|CAL96606.1| conserved hypothetical protein [Azoarcus sp. BH72]
          Length = 69

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 27/69 (39%), Positives = 43/69 (62%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I ++R Y+   S + G +CR+ P+CSEY  EA+ R+G   G+WL   R+ +C+P 
Sbjct: 1   MKTVLIVLLRFYRYAISPMLGRNCRFHPSCSEYAIEAVQRHGAVRGAWLAARRVARCHPF 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  HPGGYDPVP 69


>gi|255534678|ref|YP_003095049.1| protein containing DUF37 [Flavobacteriaceae bacterium 3519-10]
 gi|255340874|gb|ACU06987.1| protein containing DUF37 [Flavobacteriaceae bacterium 3519-10]
          Length = 81

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 43/74 (58%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
             +     + +I+IYQ   S +F  +CR+ PTCS Y  EA+  +G   G WL   R+ +C
Sbjct: 3   NKIITFPLVALIKIYQWFISPLFPKNCRFEPTCSSYMVEALRVHGPVKGLWLGTKRIARC 62

Query: 112 NPLGSDGFDPVPDD 125
           +P GS+G+DPVP  
Sbjct: 63  HPWGSEGYDPVPPK 76


>gi|116256139|sp|Q3AWW6|Y1589_SYNS9 RecName: Full=UPF0161 protein Syncc9902_1589
          Length = 92

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 35/89 (39%), Positives = 50/89 (56%), Gaps = 2/89 (2%)

Query: 36  LKNNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARY 95
           + +N  +   W G   +     + + +I  Y+   S + G  CR+ PTCS YG EAI R+
Sbjct: 6   ILSNGDQPNRWAGLNRRVAA--LLLALIGFYRTFISPLLGPRCRFTPTCSAYGLEAIQRH 63

Query: 96  GLWIGSWLTLLRLIKCNPLGSDGFDPVPD 124
           G W G WLTL R+++C+P    G DPVPD
Sbjct: 64  GPWRGGWLTLKRVLRCHPFTPCGCDPVPD 92


>gi|223043542|ref|ZP_03613587.1| conserved hypothetical protein [Staphylococcus capitis SK14]
 gi|314933937|ref|ZP_07841302.1| putative toxin-antitoxin system, toxin component [Staphylococcus
           caprae C87]
 gi|222443030|gb|EEE49130.1| conserved hypothetical protein [Staphylococcus capitis SK14]
 gi|313654087|gb|EFS17844.1| putative toxin-antitoxin system, toxin component [Staphylococcus
           caprae C87]
          Length = 83

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 43/70 (61%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + I + ++  YQ   S +   +CR+ PTCSEY  EAI  +G + G +L + R++KC+P
Sbjct: 1   MIKKIFLALVVFYQRFISPLTPPTCRFYPTCSEYTREAIQYHGAFKGLYLGIRRILKCHP 60

Query: 114 LGSDGFDPVP 123
               GFDPVP
Sbjct: 61  FHKGGFDPVP 70


>gi|167626217|ref|YP_001676511.1| hypothetical protein Shal_4312 [Shewanella halifaxensis HAW-EB4]
 gi|189040184|sp|B0TQH2|Y4312_SHEHH RecName: Full=UPF0161 protein Shal_4312
 gi|167356239|gb|ABZ78852.1| protein of unknown function DUF37 [Shewanella halifaxensis HAW-EB4]
          Length = 84

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 43/75 (57%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            ++  + +   IIR YQL+ S + G  CR+ PTCS Y  EAI  +G   G W    R+++
Sbjct: 4   TQSPLQWLATTIIRGYQLLISPMLGPRCRFNPTCSHYAIEAIRLHGFVKGCWFAAKRILR 63

Query: 111 CNPLGSDGFDPVPDD 125
           C+PL   G DPVP+ 
Sbjct: 64  CHPLHPGGEDPVPNK 78


>gi|149181428|ref|ZP_01859924.1| hypothetical protein BSG1_14719 [Bacillus sp. SG-1]
 gi|148850829|gb|EDL64983.1| hypothetical protein BSG1_14719 [Bacillus sp. SG-1]
          Length = 78

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 50/78 (64%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   + +IR+YQ++ S +   +CR+ PTCS YG E+I R+G   G WLT+ R++KC+P 
Sbjct: 1   MQKFFLALIRLYQVVISPLKPPTCRFYPTCSHYGLESIKRFGAVRGGWLTIKRIVKCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G D VP++ P +K +
Sbjct: 61  HPGGIDHVPEEWPSRKKS 78


>gi|187479884|ref|YP_787909.1| hypothetical protein BAV3415 [Bordetella avium 197N]
 gi|116256229|sp|Q2KTI6|Y3415_BORA1 RecName: Full=UPF0161 protein BAV3415
 gi|115424471|emb|CAJ51025.1| conserved hypothetical protein [Bordetella avium 197N]
          Length = 94

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 43/79 (54%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + + I  IR Y+   S   G  CR+ P+CS Y  EAI R+G   G WL   R+ +C+P
Sbjct: 1   MIKTLLIAPIRFYRFFLSPWIGRQCRFTPSCSAYAIEAIERHGALRGLWLASRRIGRCHP 60

Query: 114 LGSDGFDPVPDDLPPKKNN 132
               G DPVPD   P++ N
Sbjct: 61  WSPGGLDPVPDPARPQQKN 79


>gi|228470765|ref|ZP_04055613.1| ribonuclease P [Porphyromonas uenonis 60-3]
 gi|228307438|gb|EEK16443.1| ribonuclease P [Porphyromonas uenonis 60-3]
          Length = 252

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 33/104 (31%), Positives = 49/104 (47%), Gaps = 3/104 (2%)

Query: 21  SSYALPIQKKGSPLLLKNNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRY 80
           SS A     +  P           N       +L   +    ++ Y+   S +   SCR+
Sbjct: 148 SSVAKASPDR--PEQTAKAPSVQANQANSQQLSLAIRLLSYPVKFYRACISPLLPPSCRF 205

Query: 81  LPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD-GFDPVP 123
            PTCS+Y  EA+  +G   G+WLT+ RL++CNP     G+DPVP
Sbjct: 206 TPTCSQYALEALRVHGALKGTWLTIWRLLRCNPFNRHVGYDPVP 249


>gi|300742659|ref|ZP_07072680.1| alpha-hemolysin [Rothia dentocariosa M567]
 gi|300381844|gb|EFJ78406.1| alpha-hemolysin [Rothia dentocariosa M567]
          Length = 148

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 48/71 (67%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           TL + I IG+I+ Y+ + S ++G+ CRY PTCS YG EA+  +G   G  LT+ R+++CN
Sbjct: 50  TLPQNILIGLIKAYRKVVSPLYGDVCRYYPTCSAYGLEAVTTHGALGGLSLTVRRILRCN 109

Query: 113 PLGSDGFDPVP 123
           P  + G DPVP
Sbjct: 110 PWATGGVDPVP 120


>gi|166366143|ref|YP_001658416.1| hypothetical protein MAE_34020 [Microcystis aeruginosa NIES-843]
 gi|226703812|sp|B0JMD9|Y3402_MICAN RecName: Full=UPF0161 protein MAE_34020
 gi|166088516|dbj|BAG03224.1| hypothetical protein MAE_34020 [Microcystis aeruginosa NIES-843]
          Length = 76

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 32/69 (46%), Positives = 46/69 (66%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I IG+I  Y+   S +F  SCR+ PTCS+Y  EAI R+G+  GSWL + R+++C+P 
Sbjct: 1   MKGIFIGLIEGYRRFISPLFPPSCRFQPTCSQYAMEAIDRFGVLRGSWLAIKRILRCHPF 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  HPGGYDPVP 69


>gi|126653325|ref|ZP_01725432.1| hypothetical protein BB14905_11787 [Bacillus sp. B14905]
 gi|126589922|gb|EAZ84052.1| hypothetical protein BB14905_11787 [Bacillus sp. B14905]
          Length = 77

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 32/77 (41%), Positives = 45/77 (58%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   I +I+ Y+   S +   +CR+ PTCS YG EA  ++G   G  LT+ R+ KC+P 
Sbjct: 1   MKYPFIWLIKFYRKYISPMTPPTCRFHPTCSSYGLEAFQKHGALKGFILTITRISKCHPF 60

Query: 115 GSDGFDPVPDDLPPKKN 131
              GFDPVP+  P KKN
Sbjct: 61  HPGGFDPVPEKWPSKKN 77


>gi|67458954|ref|YP_246578.1| hypothetical protein RF_0562 [Rickettsia felis URRWXCal2]
 gi|75536608|sp|Q4UM10|Y562_RICFE RecName: Full=UPF0161 protein RF_0562
 gi|67004487|gb|AAY61413.1| Conserved hypothetical protein [Rickettsia felis URRWXCal2]
          Length = 82

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 37/85 (43%), Positives = 49/85 (57%), Gaps = 4/85 (4%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              I + ++R YQ   S + GN+CR+ PTCSEY  EAI  +G   G WLT  R+IKC P 
Sbjct: 1   MTRILLLLLRFYQYFISPLLGNNCRFHPTCSEYAKEAITTHGTLKGLWLTFKRIIKCQPF 60

Query: 115 GSDGFDPVPDDLPPKKNNPKLLSKK 139
            + G+D VP  +     N KL +KK
Sbjct: 61  CNGGYDAVPLSIK----NSKLFNKK 81


>gi|33239862|ref|NP_874804.1| hypothetical protein Pro0410 [Prochlorococcus marinus subsp.
           marinus str. CCMP1375]
 gi|47606128|sp|Q7VDG6|Y410_PROMA RecName: Full=UPF0161 protein Pro_0410
 gi|33237388|gb|AAP99456.1| Uncharacterized conserved protein [Prochlorococcus marinus subsp.
           marinus str. CCMP1375]
          Length = 79

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 37/69 (53%), Positives = 49/69 (71%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            + + +IR Y+   S + G SCR++PTCSEYG EAI ++G W G WLTL RL++CNPL  
Sbjct: 11  NLFLTLIRFYRSWISPLLGPSCRFVPTCSEYGVEAIEKHGPWKGGWLTLKRLLRCNPLTP 70

Query: 117 DGFDPVPDD 125
            G+DPVPD 
Sbjct: 71  CGYDPVPDK 79


>gi|85374955|ref|YP_459017.1| hypothetical protein ELI_10640 [Erythrobacter litoralis HTCC2594]
 gi|84788038|gb|ABC64220.1| hypothetical protein ELI_10640 [Erythrobacter litoralis HTCC2594]
          Length = 69

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 31/69 (44%), Positives = 43/69 (62%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I I R +QL  S +   SCRY PTCS+Y  EA+ ++G   G W+ + R+ +C+P 
Sbjct: 1   MKQILIWIARGWQLGPSRILPPSCRYQPTCSQYAIEAVEKHGAIKGGWMAVKRIGRCHPW 60

Query: 115 GSDGFDPVP 123
           G  GFDPVP
Sbjct: 61  GGHGFDPVP 69


>gi|33862501|ref|NP_894061.1| hypothetical protein PMT0228 [Prochlorococcus marinus str. MIT
           9313]
 gi|124023808|ref|YP_001018115.1| hypothetical protein P9303_21151 [Prochlorococcus marinus str. MIT
           9303]
 gi|47606123|sp|Q7V8U8|Y228_PROMM RecName: Full=UPF0161 protein PMT_0228
 gi|166227523|sp|A2CBJ0|Y2115_PROM3 RecName: Full=UPF0161 protein P9303_21151
 gi|33640614|emb|CAE20403.1| conserved hypothetical protein [Prochlorococcus marinus str. MIT
           9313]
 gi|123964094|gb|ABM78850.1| Uncharacterized conserved protein [Prochlorococcus marinus str. MIT
           9303]
          Length = 88

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 38/85 (44%), Positives = 49/85 (57%), Gaps = 3/85 (3%)

Query: 43  SRNWNGKFPKTLGRLIG---IGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWI 99
           S   +G     L R IG   + +I  Y+   S + G  CR++P+CS YG EAI R+G W 
Sbjct: 4   SNTLSGGIFALLNRAIGSVLLALIGFYRTWLSPLLGPHCRFIPSCSAYGLEAIQRHGPWR 63

Query: 100 GSWLTLLRLIKCNPLGSDGFDPVPD 124
           G WLTL RL +C+P    G DPVPD
Sbjct: 64  GGWLTLRRLSRCHPFTPCGCDPVPD 88


>gi|333029511|ref|ZP_08457572.1| UPF0161 protein yidD [Bacteroides coprosuis DSM 18011]
 gi|332740108|gb|EGJ70590.1| UPF0161 protein yidD [Bacteroides coprosuis DSM 18011]
          Length = 80

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 27/66 (40%), Positives = 43/66 (65%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
           I +  I  Y+   S + G SCR+ PTCS+Y  +A+ ++G   G +LT+ R+++C+P G  
Sbjct: 15  ILLLPIYFYRAAISPLLGPSCRFTPTCSQYAIQALKKHGPIKGLYLTIKRILRCHPWGGS 74

Query: 118 GFDPVP 123
           G+DPVP
Sbjct: 75  GYDPVP 80


>gi|332882694|ref|ZP_08450306.1| conserved hypothetical protein YidD [Capnocytophaga sp. oral taxon
           329 str. F0087]
 gi|332679494|gb|EGJ52479.1| conserved hypothetical protein YidD [Capnocytophaga sp. oral taxon
           329 str. F0087]
          Length = 69

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 31/69 (44%), Positives = 47/69 (68%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I ++R YQ++ S +   +CRY PTCS+Y  EA+ +YG + GSWL L R+ +C+P 
Sbjct: 1   MKYLFIFLVRFYQVVVSPLKPPTCRYTPTCSQYALEALKKYGAFKGSWLALKRIARCHPW 60

Query: 115 GSDGFDPVP 123
           G  G+DPVP
Sbjct: 61  GGCGYDPVP 69


>gi|325568957|ref|ZP_08145250.1| alpha-hemolysin family protein [Enterococcus casseliflavus ATCC
           12755]
 gi|325157995|gb|EGC70151.1| alpha-hemolysin family protein [Enterococcus casseliflavus ATCC
           12755]
          Length = 114

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 29/77 (37%), Positives = 41/77 (53%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              + IG +R YQ   S +F  SCRY PTCS Y  +AI  +G   G  + + R+++C+P 
Sbjct: 24  MSKLLIGFVRFYQRFISPLFPPSCRYYPTCSGYMIQAIQVHGAAKGGLMGVARILRCHPF 83

Query: 115 GSDGFDPVPDDLPPKKN 131
              G D VP     K+N
Sbjct: 84  VKGGIDYVPQTFTLKRN 100


>gi|56461738|ref|YP_157019.1| alpha hemolysin-like protein [Idiomarina loihiensis L2TR]
 gi|81363272|sp|Q5QZJ3|Y2638_IDILO RecName: Full=UPF0161 protein IL2638
 gi|56180748|gb|AAV83470.1| alpha hemolysin-like protein [Idiomarina loihiensis L2TR]
          Length = 103

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 32/84 (38%), Positives = 45/84 (53%), Gaps = 2/84 (2%)

Query: 56  RLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLG 115
           R I I  I++YQ   S + G  CR+ P+CS Y  EAI ++G   G  L  +R+ KC+P  
Sbjct: 9   RTIPIAFIKVYQWFISPLLGPRCRFYPSCSHYACEAIQKHGTIRGIGLAAVRISKCHPAH 68

Query: 116 SDGFDPVP--DDLPPKKNNPKLLS 137
             G+DPVP        +NN +  S
Sbjct: 69  EGGYDPVPLAKQDAKPENNSESES 92


>gi|220905230|ref|YP_002480542.1| hypothetical protein Ddes_1968 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|254801509|sp|B8J2U5|Y1968_DESDA RecName: Full=UPF0161 protein Ddes_1968
 gi|219869529|gb|ACL49864.1| protein of unknown function DUF37 [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
          Length = 87

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 34/80 (42%), Positives = 46/80 (57%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + R+I +  IR+YQ   S V   +CRY PTCS Y  EA+  +G+  G WL L RL +C+P
Sbjct: 4   MLRVICVFPIRVYQRCISPVLPPACRYYPTCSAYAAEAVMTHGVLRGGWLALKRLARCHP 63

Query: 114 LGSDGFDPVPDDLPPKKNNP 133
            G  G+DPVP     +   P
Sbjct: 64  WGGSGYDPVPPSRRRRDVPP 83


>gi|15903730|ref|NP_359280.1| hypothetical protein spr1688 [Streptococcus pneumoniae R6]
 gi|116516197|ref|YP_817103.1| hypothetical protein SPD_1653 [Streptococcus pneumoniae D39]
 gi|225861666|ref|YP_002743175.1| hypothetical protein SPT_1790 [Streptococcus pneumoniae
           Taiwan19F-14]
 gi|298230347|ref|ZP_06964028.1| hypothetical protein SpneCMD_06737 [Streptococcus pneumoniae str.
           Canada MDR_19F]
 gi|298254731|ref|ZP_06978317.1| hypothetical protein SpneCM_03830 [Streptococcus pneumoniae str.
           Canada MDR_19A]
 gi|29428191|sp|Q8DNJ1|Y1688_STRR6 RecName: Full=UPF0161 protein spr1688
 gi|122278051|sp|Q04IT5|Y1653_STRP2 RecName: Full=UPF0161 protein SPD_1653
 gi|254800632|sp|C1CTA3|Y1790_STRZT RecName: Full=UPF0161 protein SPT_1790
 gi|15459363|gb|AAL00491.1| Conserved hypothetical protein [Streptococcus pneumoniae R6]
 gi|116076773|gb|ABJ54493.1| conserved hypothetical protein TIGR00278 [Streptococcus pneumoniae
           D39]
 gi|225727796|gb|ACO23647.1| conserved hypothetical protein [Streptococcus pneumoniae
           Taiwan19F-14]
 gi|327390034|gb|EGE88379.1| hypothetical protein SPAR5_1726 [Streptococcus pneumoniae GA04375]
          Length = 80

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 45/77 (58%), Gaps = 1/77 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I ++R YQ   S VF  SCR+  TCS Y  +AI ++G + G  + L R+++C+P 
Sbjct: 1   MKRILIALVRFYQRFISPVFPPSCRFELTCSNYMIQAIEKHG-FKGVLMGLARILRCHPW 59

Query: 115 GSDGFDPVPDDLPPKKN 131
              G DPVPD    K+N
Sbjct: 60  SKTGKDPVPDHFSLKRN 76


>gi|260062015|ref|YP_003195095.1| hypothetical protein RB2501_10497 [Robiginitalea biformata
           HTCC2501]
 gi|88783577|gb|EAR14748.1| hypothetical protein RB2501_10497 [Robiginitalea biformata
           HTCC2501]
          Length = 73

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 32/73 (43%), Positives = 44/73 (60%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            K    L  I ++R YQ   S +   SCRY PTCS+Y  EA+ ++G++ G WL L R+  
Sbjct: 1   MKNKLALPLIWLVRGYQRYVSPLTPPSCRYSPTCSQYTLEALKKHGVFKGGWLALKRIAS 60

Query: 111 CNPLGSDGFDPVP 123
           C+P G  G+DPVP
Sbjct: 61  CHPWGGSGYDPVP 73


>gi|327482912|gb|AEA86222.1| conserved hypothetical protein [Pseudomonas stutzeri DSM 4166]
          Length = 78

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 30/70 (42%), Positives = 41/70 (58%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
           + I  IR+YQ   S +  + CR+ P+CS Y  EAI  +GL  G WL+L RL +C+P    
Sbjct: 1   MAIASIRVYQYAISPMMASHCRFYPSCSCYALEAIETHGLLRGGWLSLRRLGRCHPWNPG 60

Query: 118 GFDPVPDDLP 127
           G+DPVP    
Sbjct: 61  GYDPVPTHNT 70


>gi|253575850|ref|ZP_04853185.1| conserved hypothetical protein [Paenibacillus sp. oral taxon 786
           str. D14]
 gi|251844893|gb|EES72906.1| conserved hypothetical protein [Paenibacillus sp. oral taxon 786
           str. D14]
          Length = 121

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 30/77 (38%), Positives = 41/77 (53%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           L R      I +Y+   S +   +CR+ PTCS Y  EAI  +G   GSWL   R++KC P
Sbjct: 31  LVRKTFQAPIHVYRKFISPLKPPTCRFYPTCSAYALEAIEVHGPLKGSWLAAKRIVKCQP 90

Query: 114 LGSDGFDPVPDDLPPKK 130
               G+DPVP  +  K+
Sbjct: 91  FHPGGYDPVPPKVEKKR 107


>gi|293376141|ref|ZP_06622387.1| conserved hypothetical protein YidD [Turicibacter sanguinis PC909]
 gi|292645214|gb|EFF63278.1| conserved hypothetical protein YidD [Turicibacter sanguinis PC909]
          Length = 81

 Score =  108 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 44/73 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I  I+ YQ   S +   +CRY PTCS Y  EAI ++G+  G +L   R+++CNP 
Sbjct: 1   MKKLMIKFIQFYQKYISPLSPPNCRYYPTCSHYAIEAIEKHGVLKGGYLAFKRILRCNPW 60

Query: 115 GSDGFDPVPDDLP 127
           GS G+DPVP+   
Sbjct: 61  GSLGYDPVPEKKS 73


>gi|53802853|ref|YP_115423.1| hypothetical protein MCA3036 [Methylococcus capsulatus str. Bath]
 gi|81680703|sp|Q602M7|Y3036_METCA RecName: Full=UPF0161 protein MCA3036
 gi|53756614|gb|AAU90905.1| conserved hypothetical protein TIGR00278 [Methylococcus capsulatus
           str. Bath]
          Length = 75

 Score =  108 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 47/72 (65%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I +IR+YQ + S   G+ CR+ PTCS Y  +AI R+G   G++LT+ RL++C+P 
Sbjct: 1   MQRLLITLIRLYQYLLSPWLGHHCRFFPTCSNYAMDAIGRFGAMRGAYLTIRRLMRCHPW 60

Query: 115 GSDGFDPVPDDL 126
              G DPVP+ L
Sbjct: 61  HPGGIDPVPEKL 72


>gi|291165950|gb|EFE27997.1| alpha-hemolysin [Filifactor alocis ATCC 35896]
          Length = 78

 Score =  108 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 49/77 (63%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
              L + I I +IR YQL  S +   +C++ PTCS+Y  EAI R+G+  G++L++ R++K
Sbjct: 1   MTKLLKKIIIALIRFYQLALSPLKQPTCQFSPTCSQYSIEAIERFGVIKGTYLSVRRILK 60

Query: 111 CNPLGSDGFDPVPDDLP 127
           C+P    G+DPVP+   
Sbjct: 61  CHPFHEGGYDPVPEKWK 77


>gi|328950559|ref|YP_004367894.1| UPF0161 protein yidD [Marinithermus hydrothermalis DSM 14884]
 gi|328450883|gb|AEB11784.1| UPF0161 protein yidD [Marinithermus hydrothermalis DSM 14884]
          Length = 78

 Score =  108 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 33/69 (47%), Positives = 45/69 (65%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R + IG+IR YQ   S +   SCR+ PTCS Y  EAI  +G  +GS+L + R+++C+PL
Sbjct: 1   MRTLLIGLIRGYQRFISPLKPPSCRFHPTCSHYAVEAIRIHGAVLGSYLAVRRILRCHPL 60

Query: 115 GSDGFDPVP 123
              GFDPVP
Sbjct: 61  NPGGFDPVP 69


>gi|149369776|ref|ZP_01889627.1| hypothetical protein SCB49_01844 [unidentified eubacterium SCB49]
 gi|149356267|gb|EDM44823.1| hypothetical protein SCB49_01844 [unidentified eubacterium SCB49]
          Length = 73

 Score =  108 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 31/67 (46%), Positives = 40/67 (59%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            I +IR+YQ + S +   +CRY PTCS Y  EA+  +GL  G WL + R+  CNP G  G
Sbjct: 4   FIFLIRVYQHVLSPLIPPTCRYTPTCSHYTVEALQTHGLIKGGWLGIKRIASCNPWGGHG 63

Query: 119 FDPVPDD 125
            DPVP  
Sbjct: 64  HDPVPPK 70


>gi|313159034|gb|EFR58409.1| conserved hypothetical protein [Alistipes sp. HGB5]
          Length = 86

 Score =  108 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 34/77 (44%), Positives = 47/77 (61%)

Query: 47  NGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLL 106
           +    K +  L  I +++ YQL  S     SCR+ PTCS+Y  EA+ ++G   GSWLTL 
Sbjct: 10  SRSIFKRICALPLIALVKFYQLCISPFTPPSCRFTPTCSQYALEALRKHGPLKGSWLTLR 69

Query: 107 RLIKCNPLGSDGFDPVP 123
           RL +C+P G  G+DPVP
Sbjct: 70  RLSRCHPWGGSGYDPVP 86


>gi|294668106|ref|ZP_06733213.1| putative toxin-antitoxin system, toxin component [Neisseria
           elongata subsp. glycolytica ATCC 29315]
 gi|291309814|gb|EFE51057.1| putative toxin-antitoxin system, toxin component [Neisseria
           elongata subsp. glycolytica ATCC 29315]
          Length = 70

 Score =  108 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 28/67 (41%), Positives = 40/67 (59%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            +   +I+ YQ   S +    CRY PTCS+Y  EA+ +YG + G WL + R+ +C+P G 
Sbjct: 4   KLLQWLIKFYQYCISPMIPPRCRYTPTCSQYALEAVRKYGAFKGGWLAVKRIARCHPWGG 63

Query: 117 DGFDPVP 123
            G DPVP
Sbjct: 64  HGHDPVP 70


>gi|88860619|ref|ZP_01135256.1| hypothetical protein PTD2_05160 [Pseudoalteromonas tunicata D2]
 gi|88817214|gb|EAR27032.1| hypothetical protein PTD2_05160 [Pseudoalteromonas tunicata D2]
          Length = 88

 Score =  108 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 43/80 (53%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
            + + I + +I  YQ   S   G  CR+ PTCS Y   AI  +G   G WL L R++KC+
Sbjct: 6   KIPQAILLLLITGYQKWISPFLGPHCRFNPTCSSYAMGAIKNHGAIKGGWLALKRILKCH 65

Query: 113 PLGSDGFDPVPDDLPPKKNN 132
           PL S G DPVP+   P  + 
Sbjct: 66  PLHSGGDDPVPEIKHPINHK 85


>gi|257877540|ref|ZP_05657193.1| conserved hypothetical protein [Enterococcus casseliflavus EC20]
 gi|257811706|gb|EEV40526.1| conserved hypothetical protein [Enterococcus casseliflavus EC20]
          Length = 91

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 41/79 (51%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              + IG +R YQ   S +F  SCRY PTCS Y  +AI  +G   G  + + R+++C+P 
Sbjct: 1   MSKLLIGFVRFYQRFISPLFPPSCRYYPTCSGYMIQAIQVHGAAKGGLMGVARILRCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNNP 133
              G D VP     K+N  
Sbjct: 61  VKGGIDYVPQTFTLKRNTK 79


>gi|146276126|ref|YP_001166285.1| hypothetical protein Rsph17025_0068 [Rhodobacter sphaeroides ATCC
           17025]
 gi|166227792|sp|A4WNL6|Y068_RHOS5 RecName: Full=UPF0161 protein Rsph17025_0068
 gi|145554367|gb|ABP68980.1| protein of unknown function DUF37 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 84

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 45/82 (54%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           +    I    +R Y+L+ S   G+ CRY PTCS Y  EA+ R+G   G WL   R+++C+
Sbjct: 2   SPLAQIFALPVRAYRLLLSPWVGHGCRYQPTCSVYALEALERHGALKGGWLAARRILRCH 61

Query: 113 PLGSDGFDPVPDDLPPKKNNPK 134
           P G  G+DPVP   P     P+
Sbjct: 62  PWGGSGYDPVPGADPEHDRRPR 83


>gi|295692637|ref|YP_003601247.1| hypothetical protein LCRIS_00775 [Lactobacillus crispatus ST1]
 gi|295030743|emb|CBL50222.1| UPF0161 protein [Lactobacillus crispatus ST1]
          Length = 97

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 47/78 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R I I I+RIYQ + S +   SCRY PTCS Y  +A+ ++G  +G  + + R+++CNP 
Sbjct: 1   MRKILIFIVRIYQTVISPLLPPSCRYYPTCSNYMIDALKKHGPILGLIMGICRILRCNPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G DPVPD+    +N 
Sbjct: 61  IRGGVDPVPDNFTIFRNP 78


>gi|297585591|ref|YP_003701371.1| hypothetical protein Bsel_3324 [Bacillus selenitireducens MLS10]
 gi|297144048|gb|ADI00806.1| protein of unknown function DUF37 [Bacillus selenitireducens MLS10]
          Length = 81

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 51/79 (64%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + +   IG+IR+YQ   S     SCR+ PTCS+YG E+I R+G   G  +T++R++KCNP
Sbjct: 1   MFKKAAIGLIRLYQRYISRYTPPSCRFYPTCSQYGAESIERFGFLKGGLMTVIRILKCNP 60

Query: 114 LGSDGFDPVPDDLPPKKNN 132
               GFDPVP+    KK++
Sbjct: 61  FHPGGFDPVPEKKSRKKDH 79


>gi|83591338|ref|YP_431347.1| hypothetical protein Moth_2522 [Moorella thermoacetica ATCC 39073]
 gi|116256205|sp|Q2RFI5|Y2522_MOOTA RecName: Full=UPF0161 protein Moth_2522
 gi|83574252|gb|ABC20804.1| Protein of unknown function DUF37 [Moorella thermoacetica ATCC
           39073]
          Length = 70

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 39/64 (60%)

Query: 60  IGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGF 119
           I  IR YQ   S + G  CR+ PTCS+Y  EAI +YGL  G  L   RL+ C+P  + G+
Sbjct: 7   ILAIRFYQRYISPLLGRHCRFYPTCSQYALEAITKYGLLRGGLLATRRLLHCHPWDAGGY 66

Query: 120 DPVP 123
           DPVP
Sbjct: 67  DPVP 70


>gi|52424537|ref|YP_087674.1| hypothetical protein MS0482 [Mannheimia succiniciproducens MBEL55E]
 gi|52306589|gb|AAU37089.1| unknown [Mannheimia succiniciproducens MBEL55E]
          Length = 72

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 35/65 (53%), Positives = 44/65 (67%)

Query: 62  IIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDP 121
           +IR YQL  S + G  CR+ PTCS YG EAI  +G   GSWLTL R++KC+PL   G+DP
Sbjct: 1   MIRFYQLAISPMIGPRCRFTPTCSCYGIEAIKTHGALKGSWLTLKRILKCHPLSKGGYDP 60

Query: 122 VPDDL 126
           VP  +
Sbjct: 61  VPPKI 65


>gi|73662281|ref|YP_301062.1| hypothetical protein SSP0972 [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|82582374|sp|Q49YM0|Y972_STAS1 RecName: Full=UPF0161 protein SSP0972
 gi|72494796|dbj|BAE18117.1| conserved hypothetical protein [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 83

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 34/69 (49%), Positives = 45/69 (65%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I +G+I IYQ   S +   +CR+ PTCSEY  EAI  YG + G+WL + R+ KC+PL
Sbjct: 1   MKTIFLGLIHIYQRFISPLTPATCRFYPTCSEYTREAIVVYGPFKGTWLGIKRISKCHPL 60

Query: 115 GSDGFDPVP 123
              GFDPVP
Sbjct: 61  HKGGFDPVP 69


>gi|116672712|ref|YP_833645.1| hypothetical protein Arth_4170 [Arthrobacter sp. FB24]
 gi|116612821|gb|ABK05545.1| protein of unknown function DUF37 [Arthrobacter sp. FB24]
          Length = 131

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 29/76 (38%), Positives = 43/76 (56%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
           G+    L R   I ++  Y+ + S ++G  CR+ P+CS Y  EAI  +G   GSWL   R
Sbjct: 20  GRTLWNLPRNFLILLLMTYRKVISPLYGQVCRFFPSCSAYALEAITVHGAVKGSWLAARR 79

Query: 108 LIKCNPLGSDGFDPVP 123
           L++C+P  + G D VP
Sbjct: 80  LVRCHPWNAGGVDHVP 95


>gi|153007344|ref|YP_001381669.1| hypothetical protein Anae109_4507 [Anaeromyxobacter sp. Fw109-5]
 gi|166227263|sp|A7HIY9|Y4507_ANADF RecName: Full=UPF0161 protein Anae109_4507
 gi|152030917|gb|ABS28685.1| protein of unknown function DUF37 [Anaeromyxobacter sp. Fw109-5]
          Length = 74

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 26/71 (36%), Positives = 42/71 (59%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + R   + ++R+YQ + S +   +CR+ P+CS Y   A+ R+G   GS L   RL++C+P
Sbjct: 1   MIRRALVFLVRVYQRLVSPLLPPACRFYPSCSAYAATALERHGALKGSALAARRLLRCHP 60

Query: 114 LGSDGFDPVPD 124
               G DPVP+
Sbjct: 61  FHPGGIDPVPE 71


>gi|304414290|ref|ZP_07395658.1| hypothetical protein REG_1375 [Candidatus Regiella insecticola
           LSR1]
 gi|304283504|gb|EFL91900.1| hypothetical protein REG_1375 [Candidatus Regiella insecticola
           LSR1]
          Length = 95

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 33/68 (48%), Positives = 44/68 (64%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
           + IG+I+ YQ I S   G  CR+ PTCS+Y  EA+ ++GL  GS LTL R++KC+PL   
Sbjct: 14  VLIGLIKGYQRIISPFLGPRCRFYPTCSDYAIEALIKFGLLKGSGLTLKRVLKCHPLNPG 73

Query: 118 GFDPVPDD 125
           G D VP  
Sbjct: 74  GTDLVPPK 81


>gi|298206749|ref|YP_003714928.1| hypothetical protein CA2559_00795 [Croceibacter atlanticus
           HTCC2559]
 gi|83849380|gb|EAP87248.1| hypothetical protein CA2559_00795 [Croceibacter atlanticus
           HTCC2559]
          Length = 70

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 32/70 (45%), Positives = 43/70 (61%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + R   I +IR YQ   S +   +CRY PTCS+Y  EA+ ++G   GSWL + R+  CNP
Sbjct: 1   MLRRFFIILIRGYQRYISPLTPKTCRYEPTCSQYTVEALQKHGAIKGSWLGIKRIFSCNP 60

Query: 114 LGSDGFDPVP 123
            G  G+DPVP
Sbjct: 61  FGGSGYDPVP 70


>gi|72163514|ref|YP_291171.1| hypothetical protein Tfu_3115 [Thermobifida fusca YX]
 gi|116256220|sp|Q47K74|Y3115_THEFY RecName: Full=UPF0161 protein Tfu_3115
 gi|71917246|gb|AAZ57148.1| Protein of unknown function DUF37 [Thermobifida fusca YX]
          Length = 105

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 44/79 (55%), Gaps = 4/79 (5%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           TL   + I  IR YQ   S +F   CR+ P+CS Y  EA+  +G   G WLT+ RL KC+
Sbjct: 7   TLLARVLILPIRGYQRWISPLFPPVCRFYPSCSSYAVEALRVHGAGRGLWLTIRRLGKCH 66

Query: 113 PLGSDGFDPVPDDLPPKKN 131
           P    G DPVP    P++N
Sbjct: 67  PFHPGGLDPVP----PRRN 81


>gi|297627571|ref|YP_003689334.1| hypothetical protein PFREUD_24200 [Propionibacterium freudenreichii
           subsp. shermanii CIRM-BIA1]
 gi|296923336|emb|CBL57937.1| Hypothetical protein PFREUD_24200 [Propionibacterium freudenreichii
           subsp. shermanii CIRM-BIA1]
          Length = 116

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 27/69 (39%), Positives = 43/69 (62%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + IG ++ ++   S ++G+ C+Y P+CS YG EA+  +G   GSWL + RL +C+P 
Sbjct: 1   MKFLLIGFVKAWRKFISPLYGDVCKYYPSCSAYGLEALQLHGAVRGSWLIMRRLARCHPW 60

Query: 115 GSDGFDPVP 123
              G DPVP
Sbjct: 61  SMGGVDPVP 69


>gi|242374076|ref|ZP_04819650.1| alpha-hemolysin [Staphylococcus epidermidis M23864:W1]
 gi|242348201|gb|EES39803.1| alpha-hemolysin [Staphylococcus epidermidis M23864:W1]
          Length = 83

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 48/79 (60%), Gaps = 2/79 (2%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + + + ++  YQ   S +   +CR+ PTCSEY  EAI  +G + G +L + R++KC+P
Sbjct: 1   MMKKLFLAMVVFYQRFISPLTPPTCRFYPTCSEYTREAIQYHGAFKGLYLGIRRILKCHP 60

Query: 114 LGSDGFDPVPDDLPPKKNN 132
               GFDPVP  L  +K++
Sbjct: 61  FHKGGFDPVP--LKKEKHS 77


>gi|119358505|ref|YP_913149.1| hypothetical protein Cpha266_2741 [Chlorobium phaeobacteroides DSM
           266]
 gi|119355854|gb|ABL66725.1| protein of unknown function DUF37 [Chlorobium phaeobacteroides DSM
           266]
          Length = 92

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 36/92 (39%), Positives = 52/92 (56%), Gaps = 4/92 (4%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
             F + L   + I +IR Y++  S + G SC+Y PTCS Y  EA  +Y ++  SWLTL R
Sbjct: 1   MTFSRKLFNAVPILLIRFYRVFLSPLMGPSCKYYPTCSAYALEAYQQYNIFYASWLTLWR 60

Query: 108 LIKCNPLGSDGFDPVPDDLPPKKNNPKLLSKK 139
           +++CNP    G+DPVP     K  N +   K+
Sbjct: 61  VLRCNPFSKGGYDPVP----LKTGNSERKQKE 88


>gi|282900964|ref|ZP_06308897.1| protein of unknown function DUF37 [Cylindrospermopsis raciborskii
           CS-505]
 gi|281194055|gb|EFA69019.1| protein of unknown function DUF37 [Cylindrospermopsis raciborskii
           CS-505]
          Length = 76

 Score =  107 bits (267), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 31/74 (41%), Positives = 48/74 (64%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I +I+ Y+L  S +F  SCR+ PTCS Y  EAI R+G++ GSW+ L R+++C+P 
Sbjct: 1   MKKLFIWLIQGYRLFISPLFPPSCRFQPTCSMYAMEAIERFGVFRGSWMALGRILRCHPF 60

Query: 115 GSDGFDPVPDDLPP 128
              G+DPVP+    
Sbjct: 61  HPGGYDPVPEKTEK 74


>gi|47606259|sp|Q7NPT7|Y4405_CHRVO RecName: Full=UPF0161 protein CV_4405
          Length = 69

 Score =  107 bits (267), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 39/69 (56%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              I I +IR YQL  S      CR+ PTCS Y  EA++++G   G  L   R+ +C+P 
Sbjct: 1   MSRILILLIRFYQLAISPWLAPRCRFQPTCSGYAIEAVSKHGALKGGCLAARRICRCHPW 60

Query: 115 GSDGFDPVP 123
           G  G+DPVP
Sbjct: 61  GGSGYDPVP 69


>gi|119491601|ref|ZP_01623473.1| hypothetical protein L8106_03439 [Lyngbya sp. PCC 8106]
 gi|119453330|gb|EAW34494.1| hypothetical protein L8106_03439 [Lyngbya sp. PCC 8106]
          Length = 79

 Score =  107 bits (267), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 49/79 (62%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + I + +I+ Y+++ S +   SCRY PTCS Y  EA+ R+G+  G WL + R+++C+P
Sbjct: 1   MIKKIVVTLIKGYKMLISPLLPPSCRYQPTCSTYAIEAVERFGVLQGGWLAIKRILRCHP 60

Query: 114 LGSDGFDPVPDDLPPKKNN 132
               G+DPVP    PK+  
Sbjct: 61  FHPGGYDPVPHKHSPKRKK 79


>gi|319952073|ref|YP_004163340.1| hypothetical protein Celal_0503 [Cellulophaga algicola DSM 14237]
 gi|319420733|gb|ADV47842.1| UPF0161 protein yidD [Cellulophaga algicola DSM 14237]
          Length = 73

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 32/65 (49%), Positives = 44/65 (67%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            I ++R YQL+ S +   SCRY PTCS+Y  EA+ ++GL+ G WL L R+  C+P G  G
Sbjct: 9   FIFLVRFYQLVISPLTPASCRYSPTCSQYTLEALKKHGLFKGGWLALKRIFSCHPWGGKG 68

Query: 119 FDPVP 123
           +DPVP
Sbjct: 69  YDPVP 73


>gi|325267552|ref|ZP_08134204.1| alpha-hemolysin [Kingella denitrificans ATCC 33394]
 gi|324980902|gb|EGC16562.1| alpha-hemolysin [Kingella denitrificans ATCC 33394]
          Length = 70

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 32/70 (45%), Positives = 47/70 (67%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + R + +G++R YQL  S +F   CRY+PTCS+Y  EA+ ++G   G+ LT  RL +C+P
Sbjct: 1   MLRTVLLGLVRFYQLAISPLFPPRCRYVPTCSQYAVEALRKHGACRGACLTAKRLCRCHP 60

Query: 114 LGSDGFDPVP 123
            G  G+DPVP
Sbjct: 61  WGGSGYDPVP 70


>gi|298528959|ref|ZP_07016362.1| protein of unknown function DUF37 [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298510395|gb|EFI34298.1| protein of unknown function DUF37 [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 87

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 36/75 (48%), Positives = 49/75 (65%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R I IG+IR+YQ I S +F  +CR+LP+CSEY  E+I  +G   G+ LT  RL++CNP 
Sbjct: 1   MRNILIGLIRVYQRILSPLFPPACRFLPSCSEYARESIVMHGPGKGTVLTFFRLLRCNPF 60

Query: 115 GSDGFDPVPDDLPPK 129
            + G DPVP+    K
Sbjct: 61  FAAGLDPVPEKFSLK 75


>gi|310779692|ref|YP_003968025.1| protein of unknown function DUF37 [Ilyobacter polytropus DSM 2926]
 gi|309749015|gb|ADO83677.1| protein of unknown function DUF37 [Ilyobacter polytropus DSM 2926]
          Length = 80

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 48/78 (61%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + + +I+IYQ   S + G +CR+ PTCS Y Y AI  +G +IG +L + R++KC+P 
Sbjct: 1   MKKLLLFLIKIYQKFISKLLGKNCRFYPTCSSYTYHAIEEHGCFIGIFLGIRRILKCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G+DPVP     +KN 
Sbjct: 61  HPGGYDPVPPSRKKQKNK 78


>gi|167855252|ref|ZP_02478021.1| hypothetical protein HPS_05228 [Haemophilus parasuis 29755]
 gi|167853616|gb|EDS24861.1| hypothetical protein HPS_05228 [Haemophilus parasuis 29755]
          Length = 79

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 28/76 (36%), Positives = 42/76 (55%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
           + + ++  Y+ + S + G  CR+ PTCS Y  EA+  +G   G WL L R+++CNPL   
Sbjct: 4   VMLALVHFYRYVISPLIGPRCRFYPTCSTYALEAVKIHGAIKGGWLALKRILRCNPLNEG 63

Query: 118 GFDPVPDDLPPKKNNP 133
           G DPVP      K + 
Sbjct: 64  GEDPVPPKCNCGKKHK 79


>gi|77361919|ref|YP_341494.1| hypothetical protein PSHAa3023 [Pseudoalteromonas haloplanktis
           TAC125]
 gi|116256215|sp|Q3IK54|Y3023_PSEHT RecName: Full=UPF0161 protein PSHAa3023
 gi|76876830|emb|CAI88052.1| conserved protein of unknown function [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 91

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 33/74 (44%), Positives = 43/74 (58%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           L     +  IR YQ   S + G  CR+ PTCS Y  +AI  +G   GSWL + R++KC+P
Sbjct: 10  LPTYCLVLFIRGYQKWISPLLGPHCRFNPTCSSYAIQAINLHGSVKGSWLAVKRILKCHP 69

Query: 114 LGSDGFDPVPDDLP 127
           L S G DPVP+ L 
Sbjct: 70  LHSGGNDPVPEKLT 83


>gi|149914928|ref|ZP_01903457.1| hypothetical protein RAZWK3B_16190 [Roseobacter sp. AzwK-3b]
 gi|149811116|gb|EDM70953.1| hypothetical protein RAZWK3B_16190 [Roseobacter sp. AzwK-3b]
          Length = 85

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 48/81 (59%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           T    I    ++ Y+LIFS   G++CRY PTCS+Y  EA+  +G   G WL L R+++CN
Sbjct: 2   TPLARILSWPVKAYRLIFSPWVGHNCRYQPTCSQYALEALETHGGIKGGWLALRRILRCN 61

Query: 113 PLGSDGFDPVPDDLPPKKNNP 133
           P G  G+DPVP+     +  P
Sbjct: 62  PWGGCGYDPVPEGRDKDRAAP 82


>gi|322513807|ref|ZP_08066893.1| alpha-hemolysin [Actinobacillus ureae ATCC 25976]
 gi|322120375|gb|EFX92305.1| alpha-hemolysin [Actinobacillus ureae ATCC 25976]
          Length = 101

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 30/84 (35%), Positives = 42/84 (50%)

Query: 40  TPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWI 99
            P  +    K   ++G  + +  I  Y+   S + G  CR+ PTCS Y  EAI R+G   
Sbjct: 6   PPGEKAAGVKVTPSIGARLLLLPIYFYRYCISPLIGPRCRFYPTCSTYAVEAIKRHGAVK 65

Query: 100 GSWLTLLRLIKCNPLGSDGFDPVP 123
           G WL   R+ +C+P    G DPVP
Sbjct: 66  GGWLATKRIARCHPWNEGGEDPVP 89


>gi|83721157|ref|YP_443730.1| hypothetical protein BTH_I3236 [Burkholderia thailandensis E264]
 gi|116256225|sp|Q2STL9|Y3236_BURTA RecName: Full=UPF0161 protein BTH_I3236
 gi|83654982|gb|ABC39045.1| conserved hypothetical protein TIGR00278 [Burkholderia
           thailandensis E264]
          Length = 89

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 45/79 (56%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I ++R Y+L  S + G+ CR+ P+CS+Y  EAI  +G   G++L   RL +C+P 
Sbjct: 1   MQTVLIALLRFYKLAVSPLLGSRCRFYPSCSDYAREAIQYHGAARGTYLAARRLCRCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNNP 133
            + G D VP      +N P
Sbjct: 61  SAGGIDLVPPPNSDARNAP 79


>gi|90961581|ref|YP_535497.1| hypothetical protein LSL_0605 [Lactobacillus salivarius UCC118]
 gi|301299293|ref|ZP_07205579.1| conserved hypothetical protein [Lactobacillus salivarius
           ACS-116-V-Col5a]
 gi|116256257|sp|Q1WUC1|Y605_LACS1 RecName: Full=UPF0161 protein LSL_0605
 gi|90820775|gb|ABD99414.1| Conserved hypothetical protein [Lactobacillus salivarius UCC118]
 gi|300853137|gb|EFK80735.1| conserved hypothetical protein [Lactobacillus salivarius
           ACS-116-V-Col5a]
          Length = 87

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 44/75 (58%)

Query: 60  IGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGF 119
           I +IR YQ   S +F  +CRY PTCS Y  +AI ++G+  G  + + R+++CNP    G 
Sbjct: 13  IFLIRCYQKYISPMFPPTCRYYPTCSNYAIDAIKKHGIVKGIIMGIFRILRCNPFVEGGV 72

Query: 120 DPVPDDLPPKKNNPK 134
           D VP+     +N+ K
Sbjct: 73  DVVPEKFTIFRNDDK 87


>gi|257870218|ref|ZP_05649871.1| conserved hypothetical protein [Enterococcus gallinarum EG2]
 gi|257804382|gb|EEV33204.1| conserved hypothetical protein [Enterococcus gallinarum EG2]
          Length = 91

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 30/77 (38%), Positives = 43/77 (55%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              + IG +R+YQ   S +F  SCRY PTCS Y  +AI  +G   GS + + R+++C+P 
Sbjct: 1   MSKLLIGFVRLYQRFISPLFPPSCRYYPTCSSYMIQAIQVHGAGKGSLMGISRILRCHPF 60

Query: 115 GSDGFDPVPDDLPPKKN 131
              G D VP     K+N
Sbjct: 61  VKGGIDYVPQRFTLKRN 77


>gi|289167212|ref|YP_003445479.1| hypothetical protein smi_0340 [Streptococcus mitis B6]
 gi|288906777|emb|CBJ21611.1| conserved hypothetical protein [Streptococcus mitis B6]
          Length = 78

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 32/79 (40%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I  +R YQ   S  F  SCR+ PTCS Y  EAI ++G + G  + L R+++C+P 
Sbjct: 1   MKRILIAPVRFYQRFISPAFPPSCRFEPTCSNYMIEAIEKHG-FKGVLMGLARILRCHPW 59

Query: 115 GSDGFDPVPDDLPPKKNNP 133
              G DPVPD    K+N+ 
Sbjct: 60  SKTGKDPVPDHFSLKRNSK 78


>gi|256420103|ref|YP_003120756.1| hypothetical protein Cpin_1057 [Chitinophaga pinensis DSM 2588]
 gi|256035011|gb|ACU58555.1| protein of unknown function DUF37 [Chitinophaga pinensis DSM 2588]
          Length = 76

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 34/66 (51%), Positives = 46/66 (69%), Gaps = 1/66 (1%)

Query: 59  GIGIIRIYQLIFSNVFGNS-CRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
            I +IRIYQ   S + G + CRY PTCS+YG EA+ ++GL+ G +LT+ R++ CNP G  
Sbjct: 11  FIWLIRIYQWGISPLLGANKCRYTPTCSQYGVEALQKHGLFKGGYLTIKRILSCNPWGGH 70

Query: 118 GFDPVP 123
           G DPVP
Sbjct: 71  GHDPVP 76


>gi|297539959|ref|YP_003675728.1| hypothetical protein M301_2799 [Methylotenera sp. 301]
 gi|297259306|gb|ADI31151.1| protein of unknown function DUF37 [Methylotenera sp. 301]
          Length = 73

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 46/71 (64%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
            +   I I +I+ YQ++ S  FG  CR+ PTCS Y  EAI+++G  +GS+ T+ RL +C+
Sbjct: 3   NIMARILIWLIKAYQVLLSPFFGQQCRFYPTCSHYSIEAISKHGAIVGSYYTVRRLSRCH 62

Query: 113 PLGSDGFDPVP 123
           P  + G DP+P
Sbjct: 63  PWHAGGHDPIP 73


>gi|193213718|ref|YP_001999671.1| hypothetical protein Cpar_2086 [Chlorobaculum parvum NCIB 8327]
 gi|193087195|gb|ACF12471.1| protein of unknown function DUF37 [Chlorobaculum parvum NCIB 8327]
          Length = 80

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 32/77 (41%), Positives = 44/77 (57%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
           + I +IR YQ   S + G SCR+ PTCS Y  EA  ++  +  SWLT+ R+++CNP    
Sbjct: 1   MPILLIRFYQTFISPLLGPSCRFQPTCSRYAIEAYRQHNFFYASWLTVWRVLRCNPFSKG 60

Query: 118 GFDPVPDDLPPKKNNPK 134
           G+DPVP        N K
Sbjct: 61  GYDPVPPRAGKSAANTK 77


>gi|70726135|ref|YP_253049.1| hypothetical protein SH1134 [Staphylococcus haemolyticus JCSC1435]
 gi|82582347|sp|Q4L7D2|Y1134_STAHJ RecName: Full=UPF0161 protein SH1134
 gi|68446859|dbj|BAE04443.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435]
          Length = 78

 Score =  106 bits (266), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 48/78 (61%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + + +GII IYQ   S +   +CR+ PTCSEY  EAI  YG + G ++ + R++KC+P
Sbjct: 1   MLKKLFLGIIHIYQRYISPMTPPTCRFYPTCSEYTREAIEVYGPFKGGYMGIRRILKCHP 60

Query: 114 LGSDGFDPVPDDLPPKKN 131
           L   GFDPVP      ++
Sbjct: 61  LHKGGFDPVPLKKDKHRH 78


>gi|53717717|ref|YP_106703.1| hypothetical protein BPSL0077 [Burkholderia pseudomallei K96243]
 gi|76809015|ref|YP_331719.1| hypothetical protein BURPS1710b_0303 [Burkholderia pseudomallei
           1710b]
 gi|121599209|ref|YP_994139.1| hypothetical protein BMASAVP1_A2845 [Burkholderia mallei SAVP1]
 gi|124386581|ref|YP_001028204.1| hypothetical protein BMA10229_A2240 [Burkholderia mallei NCTC
           10229]
 gi|126440704|ref|YP_001057147.1| hypothetical protein BURPS668_0092 [Burkholderia pseudomallei 668]
 gi|126448892|ref|YP_001083057.1| hypothetical protein BMA10247_3551 [Burkholderia mallei NCTC 10247]
 gi|126452931|ref|YP_001064391.1| hypothetical protein BURPS1106A_0106 [Burkholderia pseudomallei
           1106a]
 gi|134281601|ref|ZP_01768309.1| conserved hypothetical protein TIGR00278 [Burkholderia pseudomallei
           305]
 gi|217423879|ref|ZP_03455379.1| conserved hypothetical protein TIGR00278 [Burkholderia pseudomallei
           576]
 gi|226193017|ref|ZP_03788627.1| conserved hypothetical protein TIGR00278 [Burkholderia pseudomallei
           Pakistan 9]
 gi|237810282|ref|YP_002894733.1| hypothetical protein GBP346_A0004 [Burkholderia pseudomallei
           MSHR346]
 gi|238563704|ref|ZP_04610692.1| conserved hypothetical protein [Burkholderia mallei GB8 horse 4]
 gi|242314957|ref|ZP_04813973.1| conserved hypothetical protein TIGR00278 [Burkholderia pseudomallei
           1106b]
 gi|251767368|ref|ZP_02266976.2| conserved hypothetical protein [Burkholderia mallei PRL-20]
 gi|254184151|ref|ZP_04890742.1| conserved hypothetical protein TIGR00278 [Burkholderia pseudomallei
           1655]
 gi|254186622|ref|ZP_04893139.1| conserved hypothetical protein TIGR00278 [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254194652|ref|ZP_04901083.1| conserved hypothetical protein TIGR00278 [Burkholderia pseudomallei
           S13]
 gi|254201965|ref|ZP_04908329.1| conserved hypothetical protein [Burkholderia mallei FMH]
 gi|254207297|ref|ZP_04913648.1| conserved hypothetical protein [Burkholderia mallei JHU]
 gi|254258178|ref|ZP_04949232.1| conserved hypothetical protein TIGR00278 [Burkholderia pseudomallei
           1710a]
 gi|254298583|ref|ZP_04966034.1| conserved hypothetical protein TIGR00278 [Burkholderia pseudomallei
           406e]
 gi|81380767|sp|Q63YW2|Y077_BURPS RecName: Full=UPF0161 protein BPSL0077
 gi|116256216|sp|Q3JXI4|Y303_BURP1 RecName: Full=UPF0161 protein BURPS1710b_0303
 gi|116256228|sp|Q62EM3|Y3398_BURMA RecName: Full=UPF0161 protein BMA3398
 gi|166227265|sp|A2S8D5|Y4540_BURM9 RecName: Full=UPF0161 protein BMA10229_A2240
 gi|166227274|sp|A1V7D6|Y4645_BURMS RecName: Full=UPF0161 protein BMASAVP1_A2845
 gi|166227798|sp|A3N476|Y092_BURP6 RecName: Full=UPF0161 protein BURPS668_0092
 gi|166228139|sp|A3NPX0|Y106_BURP0 RecName: Full=UPF0161 protein BURPS1106A_0106
 gi|166228788|sp|A3MS21|Y6051_BURM7 RecName: Full=UPF0161 protein BMA10247_3551
 gi|52208131|emb|CAH34061.1| conserved hypothetical protein [Burkholderia pseudomallei K96243]
 gi|76578468|gb|ABA47943.1| conserved hypothetical protein TIGR00278 [Burkholderia pseudomallei
           1710b]
 gi|121228019|gb|ABM50537.1| conserved hypothetical protein [Burkholderia mallei SAVP1]
 gi|124294601|gb|ABN03870.1| conserved hypothetical protein [Burkholderia mallei NCTC 10229]
 gi|126220197|gb|ABN83703.1| conserved hypothetical protein TIGR00278 [Burkholderia pseudomallei
           668]
 gi|126226573|gb|ABN90113.1| conserved hypothetical protein TIGR00278 [Burkholderia pseudomallei
           1106a]
 gi|126241762|gb|ABO04855.1| conserved hypothetical protein [Burkholderia mallei NCTC 10247]
 gi|134247268|gb|EBA47354.1| conserved hypothetical protein TIGR00278 [Burkholderia pseudomallei
           305]
 gi|147747859|gb|EDK54935.1| conserved hypothetical protein [Burkholderia mallei FMH]
 gi|147752839|gb|EDK59905.1| conserved hypothetical protein [Burkholderia mallei JHU]
 gi|157808508|gb|EDO85678.1| conserved hypothetical protein TIGR00278 [Burkholderia pseudomallei
           406e]
 gi|157934307|gb|EDO89977.1| conserved hypothetical protein TIGR00278 [Burkholderia pseudomallei
           Pasteur 52237]
 gi|169651402|gb|EDS84095.1| conserved hypothetical protein TIGR00278 [Burkholderia pseudomallei
           S13]
 gi|184214683|gb|EDU11726.1| conserved hypothetical protein TIGR00278 [Burkholderia pseudomallei
           1655]
 gi|217392942|gb|EEC32964.1| conserved hypothetical protein TIGR00278 [Burkholderia pseudomallei
           576]
 gi|225934617|gb|EEH30594.1| conserved hypothetical protein TIGR00278 [Burkholderia pseudomallei
           Pakistan 9]
 gi|237504306|gb|ACQ96624.1| conserved hypothetical protein [Burkholderia pseudomallei MSHR346]
 gi|238520166|gb|EEP83628.1| conserved hypothetical protein [Burkholderia mallei GB8 horse 4]
 gi|242138196|gb|EES24598.1| conserved hypothetical protein TIGR00278 [Burkholderia pseudomallei
           1106b]
 gi|243063004|gb|EES45190.1| conserved hypothetical protein [Burkholderia mallei PRL-20]
 gi|254216867|gb|EET06251.1| conserved hypothetical protein TIGR00278 [Burkholderia pseudomallei
           1710a]
          Length = 89

 Score =  106 bits (266), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 45/79 (56%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I ++R Y+L  S + G+ CR+ P+CS+Y  EAI  +G   G++L   RL +C+P 
Sbjct: 1   MQTVLIALLRFYKLAVSPLLGSRCRFYPSCSDYAREAIQYHGAARGTYLAARRLCRCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNNP 133
            + G D VP      +N P
Sbjct: 61  SAGGVDLVPPPNSDARNAP 79


>gi|308051502|ref|YP_003915068.1| hypothetical protein Fbal_3801 [Ferrimonas balearica DSM 9799]
 gi|307633692|gb|ADN77994.1| protein of unknown function DUF37 [Ferrimonas balearica DSM 9799]
          Length = 84

 Score =  106 bits (266), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 28/76 (36%), Positives = 45/76 (59%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
                +  + + I +++ YQ   S + G SCR+ P+CS Y  +AI+ +G+  G WL + R
Sbjct: 1   MAQALSPLQRVLILLVKGYQKGISPLLGPSCRFSPSCSHYAIQAISCHGVLYGCWLAIRR 60

Query: 108 LIKCNPLGSDGFDPVP 123
           ++KC+PL   G DPVP
Sbjct: 61  ILKCHPLHPGGIDPVP 76


>gi|331011890|gb|EGH91946.1| hypothetical protein PSYTB_19846 [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 81

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 46/78 (58%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R + +  I+ Y+   S +  + CR+ P+CS Y YEAI  +GL  G WL++ RL +C+P 
Sbjct: 1   MRKLALVPIQFYRYAISPLMASHCRFYPSCSCYAYEAIENHGLLRGGWLSIRRLGRCHPW 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G+DPVP    P+ ++
Sbjct: 61  NPGGYDPVPAVPTPRSSS 78


>gi|229495241|ref|ZP_04388976.1| conserved hypothetical protein [Porphyromonas endodontalis ATCC
           35406]
 gi|229317684|gb|EEN83582.1| conserved hypothetical protein [Porphyromonas endodontalis ATCC
           35406]
          Length = 83

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 49/80 (61%), Gaps = 3/80 (3%)

Query: 47  NGKFPKTLGRLIGIGI---IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWL 103
             +F K + R + + +   I  Y+   S +F  SCR+ PTCS+Y  EA+ ++G   G+WL
Sbjct: 4   KNRFRKGVRRWLVVLLSAPIHFYRGAISPLFPPSCRFTPTCSQYALEALRKHGPIKGAWL 63

Query: 104 TLLRLIKCNPLGSDGFDPVP 123
            + R+++CNP G  G+DPVP
Sbjct: 64  AIWRILRCNPWGGSGYDPVP 83


>gi|163755874|ref|ZP_02162991.1| cysteinyl-tRNA synthetase [Kordia algicida OT-1]
 gi|161324045|gb|EDP95377.1| cysteinyl-tRNA synthetase [Kordia algicida OT-1]
          Length = 83

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 34/73 (46%), Positives = 45/73 (61%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            + IIR YQ   S     +CRY PTCS Y  EA+ ++GL+ G  L + R+  C+P G  G
Sbjct: 11  FLLIIRFYQAAISPYTPATCRYTPTCSHYTAEALKKHGLFRGGKLAIKRIFSCHPFGGSG 70

Query: 119 FDPVPDDLPPKKN 131
           +DPVPD+LP KK 
Sbjct: 71  YDPVPDELPKKKR 83


>gi|294674940|ref|YP_003575556.1| hypothetical protein PRU_2298 [Prevotella ruminicola 23]
 gi|294474068|gb|ADE83457.1| conserved hypothetical protein TIGR00278 [Prevotella ruminicola 23]
          Length = 76

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 31/70 (44%), Positives = 44/70 (62%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           L   + +  IR YQ+  S + G SCR+ PTCSEY  +AI ++G   G  L + R+++CNP
Sbjct: 7   LISWLLVLPIRFYQMAISPLLGPSCRFTPTCSEYAKQAIMKHGPIKGLGLAIWRILRCNP 66

Query: 114 LGSDGFDPVP 123
            G  G+DPVP
Sbjct: 67  WGGSGYDPVP 76


>gi|228475901|ref|ZP_04060611.1| conserved hypothetical protein [Staphylococcus hominis SK119]
 gi|314936119|ref|ZP_07843466.1| alpha-hemolysin [Staphylococcus hominis subsp. hominis C80]
 gi|228270056|gb|EEK11526.1| conserved hypothetical protein [Staphylococcus hominis SK119]
 gi|313654738|gb|EFS18483.1| alpha-hemolysin [Staphylococcus hominis subsp. hominis C80]
          Length = 81

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 45/79 (56%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + +   + IIR YQ   S +   +CR+ PTCSEY  EAI  YG + G ++ + R++KC+P
Sbjct: 1   MLKKSFLSIIRFYQRFISPMTPPTCRFYPTCSEYTKEAIEVYGAFKGGYMGVKRILKCHP 60

Query: 114 LGSDGFDPVPDDLPPKKNN 132
               GFDPVP       ++
Sbjct: 61  FHEGGFDPVPLKKDKHTHH 79


>gi|213963519|ref|ZP_03391772.1| conserved hypothetical protein [Capnocytophaga sputigena Capno]
 gi|256820324|ref|YP_003141603.1| hypothetical protein Coch_1496 [Capnocytophaga ochracea DSM 7271]
 gi|213953799|gb|EEB65128.1| conserved hypothetical protein [Capnocytophaga sputigena Capno]
 gi|256581907|gb|ACU93042.1| protein of unknown function DUF37 [Capnocytophaga ochracea DSM
           7271]
          Length = 69

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 44/69 (63%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I ++R YQ+  S +   +CRY PTCS+Y  EA+ +YG + G WL + R+  C+P 
Sbjct: 1   MKYLFIYLVRFYQVAISPLKPPTCRYTPTCSQYTLEALQKYGFFKGGWLAIKRICSCHPW 60

Query: 115 GSDGFDPVP 123
           G  G+DPVP
Sbjct: 61  GGSGYDPVP 69


>gi|227890667|ref|ZP_04008472.1| alpha-hemolysin [Lactobacillus salivarius ATCC 11741]
 gi|227867605|gb|EEJ75026.1| alpha-hemolysin [Lactobacillus salivarius ATCC 11741]
          Length = 84

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 44/75 (58%)

Query: 60  IGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGF 119
           I +IR YQ   S +F  +CRY PTCS Y  +AI ++G+  G  + + R+++CNP    G 
Sbjct: 10  IFLIRCYQKYISPMFPPTCRYYPTCSNYAIDAIKKHGVVKGIIMGIFRILRCNPFVEGGV 69

Query: 120 DPVPDDLPPKKNNPK 134
           D VP+     +N+ K
Sbjct: 70  DVVPEKFTIFRNDDK 84


>gi|256850905|ref|ZP_05556294.1| conserved hypothetical protein [Lactobacillus jensenii 27-2-CHN]
 gi|260661119|ref|ZP_05862033.1| UPF0161 protein [Lactobacillus jensenii 115-3-CHN]
 gi|282934183|ref|ZP_06339461.1| conserved hypothetical protein YidD [Lactobacillus jensenii 208-1]
 gi|297205782|ref|ZP_06923177.1| alpha-hemolysin family protein [Lactobacillus jensenii JV-V16]
 gi|256615967|gb|EEU21155.1| conserved hypothetical protein [Lactobacillus jensenii 27-2-CHN]
 gi|260548056|gb|EEX24032.1| UPF0161 protein [Lactobacillus jensenii 115-3-CHN]
 gi|281301797|gb|EFA94063.1| conserved hypothetical protein YidD [Lactobacillus jensenii 208-1]
 gi|297148908|gb|EFH29206.1| alpha-hemolysin family protein [Lactobacillus jensenii JV-V16]
          Length = 95

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 43/75 (57%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
           + I ++R YQ   S +   +CRY PTCS Y  +++ ++G   G  + + R+I+CNP    
Sbjct: 4   LLIFLVRAYQKFISPILPPTCRYYPTCSSYMIDSLRKHGPLKGLIMGIARIIRCNPFVRG 63

Query: 118 GFDPVPDDLPPKKNN 132
           G DPVPD    ++N 
Sbjct: 64  GVDPVPDHFTLRRNP 78


>gi|302024331|ref|ZP_07249542.1| hypothetical protein Ssui0_07164 [Streptococcus suis 05HAS68]
          Length = 79

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 33/80 (41%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              + IG++R YQ   S +F  SCRY PTCS Y  EA+ ++G   G  + L R+ +C+P 
Sbjct: 1   MTRLLIGLVRFYQKFISPLFQPSCRYRPTCSAYMIEALQKHG-LRGFLMGLARIGRCHPF 59

Query: 115 GSDGFDPVPDDLPPKKNNPK 134
              G DPVPD    K+N  K
Sbjct: 60  VEGGEDPVPDRFSLKRNKQK 79


>gi|307243398|ref|ZP_07525555.1| conserved hypothetical protein YidD [Peptostreptococcus stomatis
           DSM 17678]
 gi|306493208|gb|EFM65204.1| conserved hypothetical protein YidD [Peptostreptococcus stomatis
           DSM 17678]
          Length = 87

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 45/70 (64%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
            ++  +  IG++R YQ++ S + G +CR+ PTCS+Y  +A  +YG   G WLTL R+ KC
Sbjct: 16  SSILAMACIGLVRFYQVVISPLKGPTCRFYPTCSQYSIQAFKKYGFLKGLWLTLRRVSKC 75

Query: 112 NPLGSDGFDP 121
           +P    G+DP
Sbjct: 76  HPFHPGGYDP 85


>gi|298489682|ref|YP_003719859.1| hypothetical protein Aazo_0083 ['Nostoc azollae' 0708]
 gi|298231600|gb|ADI62736.1| protein of unknown function DUF37 ['Nostoc azollae' 0708]
          Length = 81

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 46/69 (66%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +++ I II+ Y+L  S +F  +CR+ PTCS Y  +AI R+GL  G W+  LR+++C+P 
Sbjct: 1   MKILLIWIIKGYRLFVSPLFPPTCRFQPTCSMYAIQAIERFGLLRGGWMATLRILRCHPF 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  HPGGYDPVP 69


>gi|91795121|ref|YP_564772.1| hypothetical protein Sden_3776 [Shewanella denitrificans OS217]
 gi|123356327|sp|Q12HM7|Y3776_SHEDO RecName: Full=UPF0161 protein Sden_3776
 gi|91717123|gb|ABE57049.1| protein of unknown function DUF37 [Shewanella denitrificans OS217]
          Length = 84

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 43/78 (55%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
               ++  + +   +IR YQL  S + G  CR+ PTCS Y  EAI  +G   GSW  L R
Sbjct: 1   MAQAQSPLQWLATTVIRGYQLFISPLMGPRCRFNPTCSHYAIEAIKLHGTAKGSWFALKR 60

Query: 108 LIKCNPLGSDGFDPVPDD 125
           +++C+PL   G DPVP  
Sbjct: 61  ILRCHPLHPGGSDPVPPK 78


>gi|117929366|ref|YP_873917.1| hypothetical protein Acel_2159 [Acidothermus cellulolyticus 11B]
 gi|117649829|gb|ABK53931.1| protein of unknown function DUF37 [Acidothermus cellulolyticus 11B]
          Length = 110

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 46/78 (58%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           +     + +  IR YQ++ S + G  CR++P+CS Y  EAI R+G+  G WL+  RL++C
Sbjct: 14  RRPLTALVVLPIRGYQIVISPLLGPRCRFVPSCSAYAVEAIIRHGVLRGGWLSTRRLLRC 73

Query: 112 NPLGSDGFDPVPDDLPPK 129
           +P    GFDPVP     K
Sbjct: 74  HPWHPGGFDPVPPRRTTK 91


>gi|297563781|ref|YP_003682755.1| hypothetical protein Ndas_4866 [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
 gi|296848229|gb|ADH70249.1| protein of unknown function DUF37 [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
          Length = 107

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 30/80 (37%), Positives = 41/80 (51%), Gaps = 2/80 (2%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           T+   + I  IR YQ   S +F   CR+ P+CS Y  EA+  +G   G WL   R+ +C+
Sbjct: 10  TVFARVLILPIRGYQRFISPLFPPVCRFYPSCSAYAVEALRVHGALYGLWLGARRIARCH 69

Query: 113 PLGSDGFDPVPDDLPPKKNN 132
           P    G DPVP   P  + N
Sbjct: 70  PFNPGGLDPVPP--PRGRRN 87


>gi|165933062|ref|YP_001649851.1| hypothetical protein RrIowa_0574 [Rickettsia rickettsii str. Iowa]
 gi|189040552|sp|B0BX69|Y574_RICRO RecName: Full=UPF0161 protein RrIowa_0574
 gi|165908149|gb|ABY72445.1| hypothetical cytosolic protein [Rickettsia rickettsii str. Iowa]
          Length = 82

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 36/85 (42%), Positives = 48/85 (56%), Gaps = 4/85 (4%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              I + ++R YQ   S + GN+CR+ PTCSEY  EAI+ +G   G W T  R+IKC P 
Sbjct: 1   MTRILLLLLRFYQYFISPLLGNNCRFHPTCSEYAKEAISMHGSIKGLWFTFKRIIKCQPF 60

Query: 115 GSDGFDPVPDDLPPKKNNPKLLSKK 139
              G+D VP  +     N K L+KK
Sbjct: 61  CDGGYDTVPISIK----NSKPLNKK 81


>gi|116256277|sp|Q0VML3|YL37_ALCBS RecName: Full=UPF0161 protein ABO_2137
          Length = 97

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 42/73 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + +G I +YQ + S   GN CR+ PTCSEY  +A+  +G   GS L   RL KC+P 
Sbjct: 1   MKSLLLGAIWLYQKVLSPWIGNQCRFYPTCSEYARQAVETHGSLRGSALAAKRLCKCHPW 60

Query: 115 GSDGFDPVPDDLP 127
              GFD VP  +P
Sbjct: 61  HPGGFDYVPGAVP 73


>gi|92114007|ref|YP_573935.1| hypothetical protein Csal_1884 [Chromohalobacter salexigens DSM
           3043]
 gi|116256146|sp|Q1QWC2|Y1884_CHRSD RecName: Full=UPF0161 protein Csal_1884
 gi|91797097|gb|ABE59236.1| protein of unknown function DUF37 [Chromohalobacter salexigens DSM
           3043]
          Length = 105

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 34/83 (40%), Positives = 47/83 (56%)

Query: 41  PKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIG 100
           P  R    + P  L     IG++R+YQ   S + G  CR+ P+CS+Y  EAI  +G   G
Sbjct: 3   PGKRRPLTRLPFALLSWGMIGLLRVYQYGISPLLGPRCRFWPSCSQYAVEAIQVHGPLKG 62

Query: 101 SWLTLLRLIKCNPLGSDGFDPVP 123
           +WL L R++KC+P    G DPVP
Sbjct: 63  AWLALKRIVKCHPGHPGGVDPVP 85


>gi|308535403|ref|YP_003933759.1| hypothetical protein Gbem_4147 [Geobacter bemidjiensis Bem]
 gi|308052748|gb|ADO00847.1| protein of unknown function DUF37 [Geobacter bemidjiensis Bem]
          Length = 90

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 48/82 (58%)

Query: 42  KSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGS 101
            S+  +G   K++ + I IG++  YQ   S +   SCR+ PTCS Y  +A+ +YG   G 
Sbjct: 9   SSQPPSGGCEKSMLKEIFIGLVVFYQRFISPLKAPSCRFYPTCSHYSLQALEKYGPVKGL 68

Query: 102 WLTLLRLIKCNPLGSDGFDPVP 123
           WLT  R++KC+P    G+DPV 
Sbjct: 69  WLTAARVLKCHPFHPGGYDPVK 90


>gi|149375640|ref|ZP_01893409.1| hypothetical protein MDG893_18182 [Marinobacter algicola DG893]
 gi|149360042|gb|EDM48497.1| hypothetical protein MDG893_18182 [Marinobacter algicola DG893]
          Length = 94

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 27/66 (40%), Positives = 42/66 (63%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
           + +  IR+YQ   S +  + CR+ PTCS+Y  EAI  +G   G +L++ RL++C+P    
Sbjct: 1   MLLLPIRVYQYAISPMMASHCRHYPTCSQYAVEAITAHGAIRGLFLSVKRLMRCHPWAKG 60

Query: 118 GFDPVP 123
           G+DPVP
Sbjct: 61  GYDPVP 66


>gi|323496921|ref|ZP_08101949.1| hypothetical protein VISI1226_17010 [Vibrio sinaloensis DSM 21326]
 gi|323317995|gb|EGA70978.1| hypothetical protein VISI1226_17010 [Vibrio sinaloensis DSM 21326]
          Length = 87

 Score =  106 bits (265), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 47/82 (57%), Gaps = 2/82 (2%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           +    + IG++R+YQ   S + G  CR+ PTCS Y  EA+  +G   G WL+  RL+KCN
Sbjct: 6   SPLSRLAIGLVRLYQGFISPLLGPRCRFSPTCSTYAIEALKAHGFVKGCWLSSKRLLKCN 65

Query: 113 PLGSDG--FDPVPDDLPPKKNN 132
           PL   G  +DPVP      ++N
Sbjct: 66  PLNKKGWTYDPVPPVQKQDRDN 87


>gi|296534912|ref|ZP_06897226.1| alpha-hemolysin [Roseomonas cervicalis ATCC 49957]
 gi|296264760|gb|EFH11071.1| alpha-hemolysin [Roseomonas cervicalis ATCC 49957]
          Length = 112

 Score =  106 bits (265), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 30/87 (34%), Positives = 45/87 (51%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
             + +    L+  G +R YQL    V G+ CR+ P CS Y  EA+  +G   G+WL   R
Sbjct: 6   NGWRRDPAALLLKGAVRGYQLTLRGVIGSHCRFYPHCSAYAIEALDTHGAARGAWLAARR 65

Query: 108 LIKCNPLGSDGFDPVPDDLPPKKNNPK 134
           +++C+P    G+DPVP    P    P+
Sbjct: 66  ILRCHPWHPGGYDPVPPAETPATRFPE 92


>gi|157363657|ref|YP_001470424.1| hypothetical protein Tlet_0794 [Thermotoga lettingae TMO]
 gi|157314261|gb|ABV33360.1| protein of unknown function DUF37 [Thermotoga lettingae TMO]
          Length = 80

 Score =  106 bits (265), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 47/78 (60%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + I + +IR YQ   S +   +CR+ PTCS Y  +AI R+GL  G +L + R+I+CNP
Sbjct: 1   MMKKIVVLMIRFYQKYISPLKPPTCRFTPTCSSYAIQAIERFGLLKGGYLAVKRIIRCNP 60

Query: 114 LGSDGFDPVPDDLPPKKN 131
           L   G DPVP+    ++ 
Sbjct: 61  LNPGGHDPVPEKFTTRRR 78


>gi|119773152|ref|YP_925892.1| hypothetical protein Sama_0010 [Shewanella amazonensis SB2B]
 gi|166227756|sp|A1S1G6|Y010_SHEAM RecName: Full=UPF0161 protein Sama_0010
 gi|119765652|gb|ABL98222.1| conserved hypothetical protein [Shewanella amazonensis SB2B]
          Length = 84

 Score =  106 bits (265), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 43/78 (55%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
               ++  + +   +IR YQ+  S + G  CR+ PTCS Y  EAI  +G+  GSW    R
Sbjct: 1   MAQTQSPFQWLATKLIRGYQIFISPILGPKCRFQPTCSHYAIEAIQLHGVIKGSWFAAKR 60

Query: 108 LIKCNPLGSDGFDPVPDD 125
           ++KC+PL   G DPVP  
Sbjct: 61  ILKCHPLHPGGNDPVPPK 78


>gi|121596422|ref|YP_988318.1| hypothetical protein Ajs_4141 [Acidovorax sp. JS42]
 gi|120608502|gb|ABM44242.1| protein of unknown function DUF37 [Acidovorax sp. JS42]
          Length = 98

 Score =  106 bits (265), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 31/74 (41%), Positives = 50/74 (67%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + R + +G++R Y+L+ S   G++CR+ PTCS Y  +A+ ++G   GS+LT+ RL +C+P
Sbjct: 1   MMRALLMGLVRGYRLLLSPWIGSACRFEPTCSVYSLQALEQHGAAAGSYLTVRRLARCHP 60

Query: 114 LGSDGFDPVPDDLP 127
               G DPVP +LP
Sbjct: 61  WCEGGLDPVPQELP 74


>gi|332686392|ref|YP_004456166.1| YidD [Melissococcus plutonius ATCC 35311]
 gi|332370401|dbj|BAK21357.1| YidD [Melissococcus plutonius ATCC 35311]
          Length = 90

 Score =  106 bits (265), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 38/77 (49%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I +I  YQ   S      CRY PTCS+Y  +AI  +G   G+ + + R+  C+P 
Sbjct: 1   MKKLLIHLIHFYQRYISPGIPPRCRYYPTCSQYMIDAINIHGWIKGTIMGVARIFCCHPF 60

Query: 115 GSDGFDPVPDDLPPKKN 131
              G D VP     ++N
Sbjct: 61  VKGGIDYVPKKFTIRRN 77


>gi|319405748|emb|CBI79371.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 98

 Score =  106 bits (265), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 47/80 (58%), Positives = 59/80 (73%)

Query: 47  NGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLL 106
            G + KT GRLIGIG+IR YQ+  S+  G  CR+ PTCSEY YEAIAR+GLW G+W+   
Sbjct: 1   MGPWQKTPGRLIGIGLIRFYQITLSSFIGIHCRHRPTCSEYAYEAIARHGLWAGAWMGFF 60

Query: 107 RLIKCNPLGSDGFDPVPDDL 126
           RLI+C P G++GFDPVP  +
Sbjct: 61  RLIRCCPFGTNGFDPVPTSI 80


>gi|119503570|ref|ZP_01625653.1| hypothetical protein MGP2080_03485 [marine gamma proteobacterium
           HTCC2080]
 gi|119460632|gb|EAW41724.1| hypothetical protein MGP2080_03485 [marine gamma proteobacterium
           HTCC2080]
          Length = 71

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 31/65 (47%), Positives = 42/65 (64%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            I +I +Y+LI S   G +CR+ PTCS Y  EAI R+G + G WL + RL +C+P    G
Sbjct: 5   AIKLIHLYRLILSPWIGRACRFEPTCSNYTEEAITRHGFFKGCWLGVRRLSRCHPWCEGG 64

Query: 119 FDPVP 123
           +DPVP
Sbjct: 65  YDPVP 69


>gi|194337887|ref|YP_002019681.1| protein of unknown function DUF37 [Pelodictyon phaeoclathratiforme
           BU-1]
 gi|194310364|gb|ACF45064.1| protein of unknown function DUF37 [Pelodictyon phaeoclathratiforme
           BU-1]
          Length = 97

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/88 (38%), Positives = 46/88 (52%), Gaps = 3/88 (3%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
                  + I +I+ Y+   S + G SC+Y PTCS Y  EA  R+  +  SWLT+ R+++
Sbjct: 6   SWKFFNQVPIVLIKFYRAFLSPLLGPSCKYFPTCSSYALEAFQRHNFFYASWLTVWRVLR 65

Query: 111 CNPLGSDGFDPVPDDLPPKKNNPKLLSK 138
           CNP    GFDPVP   P   N  K   K
Sbjct: 66  CNPFSKGGFDPVP---PVSVNKNKFSGK 90


>gi|257465188|ref|ZP_05629559.1| hypothetical protein AM202_01665 [Actinobacillus minor 202]
 gi|257450848|gb|EEV24891.1| hypothetical protein AM202_01665 [Actinobacillus minor 202]
          Length = 83

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 40/79 (50%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           L   + +  I  YQ   S + G  CR+ PTCS Y  EAI  +G   G +L L R+ +C+P
Sbjct: 3   LVAKLLLLPIYFYQYAISPLIGPRCRFYPTCSTYAVEAIKIHGAIKGGYLALRRIARCHP 62

Query: 114 LGSDGFDPVPDDLPPKKNN 132
               G DPVP      K+N
Sbjct: 63  FSEGGDDPVPPKCECSKHN 81


>gi|89898665|ref|YP_515775.1| hypothetical protein CF0858 [Chlamydophila felis Fe/C-56]
 gi|116256263|sp|Q253A8|Y858_CHLFF RecName: Full=UPF0161 protein CF0858
 gi|89332037|dbj|BAE81630.1| conserved hypothetical protein [Chlamydophila felis Fe/C-56]
          Length = 103

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 40/75 (53%)

Query: 49  KFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRL 108
              K L +   +G+I IY+   S + G+ CR+ PTCS+Y  +A+  +G   G   T+ R+
Sbjct: 5   SLLKNLPKFFFLGLIHIYRWTISPLLGSPCRFFPTCSQYALQALKHHGCIKGLGFTIKRI 64

Query: 109 IKCNPLGSDGFDPVP 123
            KC P    G D VP
Sbjct: 65  GKCGPWHPGGVDLVP 79


>gi|307707613|ref|ZP_07644094.1| conserved hypothetical protein [Streptococcus mitis NCTC 12261]
 gi|322377640|ref|ZP_08052130.1| putative toxin-antitoxin system, toxin component [Streptococcus sp.
           M334]
 gi|307616326|gb|EFN95518.1| conserved hypothetical protein [Streptococcus mitis NCTC 12261]
 gi|321281405|gb|EFX58415.1| putative toxin-antitoxin system, toxin component [Streptococcus sp.
           M334]
          Length = 80

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 44/77 (57%), Gaps = 1/77 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I  +R YQ   S  F  SCR+ PTCS Y  +AI ++G + G  + L R+++C+P 
Sbjct: 1   MKRILIAPVRFYQRFISPAFPPSCRFEPTCSNYMIQAIEKHG-FKGVLMGLARILRCHPW 59

Query: 115 GSDGFDPVPDDLPPKKN 131
              G DPVPD    K+N
Sbjct: 60  SKTGKDPVPDHFSLKRN 76


>gi|260664660|ref|ZP_05865512.1| conserved hypothetical protein [Lactobacillus jensenii SJ-7A-US]
 gi|260561725|gb|EEX27697.1| conserved hypothetical protein [Lactobacillus jensenii SJ-7A-US]
          Length = 98

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 46/79 (58%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           +   + I ++R+YQ   S +F  +CRY P+CS Y  +++ ++G   G  + + R+I+CNP
Sbjct: 3   ILSKLLIFLVRVYQKFISPIFPPTCRYYPSCSSYMIDSLRKHGPLKGLIMGIARIIRCNP 62

Query: 114 LGSDGFDPVPDDLPPKKNN 132
               G DPVPD    ++N 
Sbjct: 63  FVRGGVDPVPDHFTLRRNP 81


>gi|254522664|ref|ZP_05134719.1| conserved hypothetical protein TIGR00278 [Stenotrophomonas sp.
           SKA14]
 gi|219720255|gb|EED38780.1| conserved hypothetical protein TIGR00278 [Stenotrophomonas sp.
           SKA14]
          Length = 84

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 30/68 (44%), Positives = 43/68 (63%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            + I ++R Y+   S + G  CR++P+CSEY  EAI+ +G   GSWL   RL +C+P   
Sbjct: 4   RLLIALLRFYKRFISPLLGPRCRFVPSCSEYAMEAISLHGPLRGSWLAARRLGRCHPFHP 63

Query: 117 DGFDPVPD 124
            GFDPVP+
Sbjct: 64  GGFDPVPE 71


>gi|311110495|ref|ZP_07711892.1| LOW QUALITY PROTEIN: alpha-hemolysin [Lactobacillus gasseri MV-22]
 gi|311065649|gb|EFQ45989.1| LOW QUALITY PROTEIN: alpha-hemolysin [Lactobacillus gasseri MV-22]
          Length = 96

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 45/78 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              + IG++ +Y+   S V   +CRY PTCS Y  +A+ ++G  +G  + + R+I+CNP 
Sbjct: 1   MNKLLIGLVNVYKKFISPVLPPTCRYYPTCSTYMIDALKKHGAILGLIMGISRIIRCNPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G DPVPD    ++N 
Sbjct: 61  IKGGVDPVPDYFTLRRNP 78


>gi|226947218|ref|YP_002802291.1| hypothetical protein Avin_52460 [Azotobacter vinelandii DJ]
 gi|259647074|sp|C1DNF8|Y5246_AZOVD RecName: Full=UPF0161 protein Avin_52460
 gi|226722145|gb|ACO81316.1| conserved hypothetical protein [Azotobacter vinelandii DJ]
          Length = 81

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 46/78 (58%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R + +  I+ Y+   S +  N CR+ P+CS Y +EAI+ +GL  G WL+L RL +C+P 
Sbjct: 1   MRKLALAAIQFYRYAISPLMANHCRFHPSCSCYAHEAISTHGLLRGGWLSLRRLGRCHPW 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G+DPVP     + ++
Sbjct: 61  NPGGYDPVPPIKTSRSSS 78


>gi|84685370|ref|ZP_01013268.1| hypothetical protein 1099457000258_RB2654_10893 [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84666527|gb|EAQ12999.1| hypothetical protein RB2654_10893 [Rhodobacterales bacterium
           HTCC2654]
          Length = 81

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 50/80 (62%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           T    I    +R Y+L+FS   G+SCRY PTCS Y  EA+ ++G + G WLT+ R+ +C+
Sbjct: 2   TPLAHIVALPVRFYRLVFSPWVGHSCRYQPTCSAYALEALEKHGAFKGGWLTIRRIGRCH 61

Query: 113 PLGSDGFDPVPDDLPPKKNN 132
           PLG  GFDPVPD    +K  
Sbjct: 62  PLGGMGFDPVPDPGDKRKKP 81


>gi|322391363|ref|ZP_08064833.1| alpha-hemolysin [Streptococcus peroris ATCC 700780]
 gi|321145789|gb|EFX41180.1| alpha-hemolysin [Streptococcus peroris ATCC 700780]
          Length = 84

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I  +R YQ   S  F  SCR+ PTCS Y  +AI ++G   G  + L R+++C+P 
Sbjct: 1   MKKILIAPVRFYQRFISPAFPPSCRFEPTCSNYMIQAIEKHG-LKGVLMGLARILRCHPW 59

Query: 115 GSDGFDPVPDDLPPKKNNPK 134
              G DPVPD    K+N  +
Sbjct: 60  SKTGKDPVPDHFSLKRNQKE 79


>gi|288553372|ref|YP_003425307.1| hypothetical protein BpOF4_01735 [Bacillus pseudofirmus OF4]
 gi|288544532|gb|ADC48415.1| hypothetical protein BpOF4_01735 [Bacillus pseudofirmus OF4]
          Length = 80

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 33/76 (43%), Positives = 45/76 (59%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I +  IR YQ   S +   +CR+ PTCS YG E+I R+G + GSWLT+ RL KC+P 
Sbjct: 1   MQKILVLFIRGYQKFISPLKPPTCRFYPTCSHYGIESIKRFGAFKGSWLTIKRLSKCHPF 60

Query: 115 GSDGFDPVPDDLPPKK 130
              G D VP+    K+
Sbjct: 61  HPGGIDLVPEKENEKE 76


>gi|224827184|ref|ZP_03700279.1| protein of unknown function DUF37 [Lutiella nitroferrum 2002]
 gi|224600577|gb|EEG06765.1| protein of unknown function DUF37 [Lutiella nitroferrum 2002]
          Length = 69

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 41/69 (59%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              + I +IR YQ+  S      CRY+PTCS Y  EA+ ++G   G WL + R+ +C+P 
Sbjct: 1   MSRLFIFLIRCYQVAISPWLAPRCRYVPTCSGYAIEAVKKHGACKGGWLAVRRISRCHPW 60

Query: 115 GSDGFDPVP 123
           G  G+DPVP
Sbjct: 61  GGSGYDPVP 69


>gi|152968450|ref|YP_001364234.1| hypothetical protein Krad_4511 [Kineococcus radiotolerans SRS30216]
 gi|151362967|gb|ABS05970.1| protein of unknown function DUF37 [Kineococcus radiotolerans
           SRS30216]
          Length = 91

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 29/71 (40%), Positives = 45/71 (63%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
             L+ +G++R+YQL+ S + G +CR+ P+CS Y  EA+   G  +G+WL + RL +C+P 
Sbjct: 13  PALLLVGLVRVYQLLVSPLLGPTCRFYPSCSAYAVEALRTRGALVGTWLAVRRLFRCHPW 72

Query: 115 GSDGFDPVPDD 125
              G DPVP  
Sbjct: 73  NPGGVDPVPPK 83


>gi|319786822|ref|YP_004146297.1| hypothetical protein Psesu_1218 [Pseudoxanthomonas suwonensis 11-1]
 gi|317465334|gb|ADV27066.1| protein of unknown function DUF37 [Pseudoxanthomonas suwonensis
           11-1]
          Length = 80

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 29/71 (40%), Positives = 44/71 (61%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           +   + I  +R Y+   S + G  CR++P+CSEY  +AI R+G W G WL   R+ +C+P
Sbjct: 1   MITRLLILALRFYKAFISPLLGPRCRFVPSCSEYAMQAIERHGPWRGGWLAARRIGRCHP 60

Query: 114 LGSDGFDPVPD 124
           L   G+DPVP+
Sbjct: 61  LHPGGYDPVPE 71


>gi|42518869|ref|NP_964799.1| hypothetical protein LJ0944 [Lactobacillus johnsonii NCC 533]
 gi|47606240|sp|P61470|Y944_LACJO RecName: Full=UPF0161 protein LJ_0944
 gi|41583155|gb|AAS08765.1| hypothetical protein LJ_0944 [Lactobacillus johnsonii NCC 533]
          Length = 97

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 45/78 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              + IG++ +Y+   S +   +CRY PTCS Y  +A+ ++G  +G  + L R+++CNP 
Sbjct: 1   MNKLLIGLVNVYKKFISPILPPTCRYYPTCSSYMIDALKKHGAILGLIMGLARILRCNPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G DPVPD    ++N 
Sbjct: 61  IKGGVDPVPDYFTLRRNP 78


>gi|315122697|ref|YP_004063186.1| hypothetical protein CKC_04745 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496099|gb|ADR52698.1| hypothetical protein CKC_04745 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 104

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 77/92 (83%), Positives = 83/92 (90%)

Query: 38  NNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGL 97
            N PKSRNW GKFPKT GRLIGIGIIRIYQL+FSN+FG+SCRYLPTCSEY YEAIARYGL
Sbjct: 4   KNIPKSRNWTGKFPKTPGRLIGIGIIRIYQLVFSNIFGHSCRYLPTCSEYAYEAIARYGL 63

Query: 98  WIGSWLTLLRLIKCNPLGSDGFDPVPDDLPPK 129
           WIG WLTL R+IKCNPLGS GF+PVPD+LP K
Sbjct: 64  WIGGWLTLFRVIKCNPLGSHGFNPVPDNLPKK 95


>gi|119947212|ref|YP_944892.1| hypothetical protein Ping_3610 [Psychromonas ingrahamii 37]
 gi|119865816|gb|ABM05293.1| protein of unknown function DUF37 [Psychromonas ingrahamii 37]
          Length = 79

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 31/69 (44%), Positives = 41/69 (59%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I +IR YQ+  S + G  CR+ PTCS+Y  EAI   G+  G WL   R+IKC P 
Sbjct: 1   MQWVVIKLIRGYQVFISPMIGPRCRFTPTCSQYAIEAIKLNGIIKGCWLAAKRIIKCQPF 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  SEGGYDPVP 69


>gi|315223386|ref|ZP_07865243.1| alpha-hemolysin [Capnocytophaga ochracea F0287]
 gi|314946559|gb|EFS98550.1| alpha-hemolysin [Capnocytophaga ochracea F0287]
          Length = 69

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 44/69 (63%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I ++R YQ+  S +   +CRY PTCS+Y  EA+ +YG + G WL + R+  C+P 
Sbjct: 1   MKYLFIYLVRFYQVAISPLKPPTCRYTPTCSQYTLEALRKYGFFKGGWLAIKRICSCHPW 60

Query: 115 GSDGFDPVP 123
           G  G+DPVP
Sbjct: 61  GGSGYDPVP 69


>gi|226315531|ref|YP_002775427.1| hypothetical protein BBR47_59460 [Brevibacillus brevis NBRC 100599]
 gi|226098481|dbj|BAH46923.1| conserved hypothetical protein [Brevibacillus brevis NBRC 100599]
          Length = 74

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/71 (47%), Positives = 44/71 (61%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            I + +IR YQL+ S     SCR+ PTCS Y  E+I R+G W G WL L R++KC+P   
Sbjct: 4   KIMVWLIRGYQLMISPYKPPSCRFAPTCSHYAIESIRRFGAWRGGWLALRRILKCHPFHP 63

Query: 117 DGFDPVPDDLP 127
            G+DPVPD   
Sbjct: 64  GGYDPVPDQHK 74


>gi|77461961|ref|YP_351468.1| hypothetical protein Pfl01_5744 [Pseudomonas fluorescens Pf0-1]
 gi|116256254|sp|Q3K427|Y5744_PSEPF RecName: Full=UPF0161 protein Pfl01_5744
 gi|77385964|gb|ABA77477.1| conserved hypothetical protein [Pseudomonas fluorescens Pf0-1]
          Length = 81

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 44/78 (56%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R + +  IR Y+   S +  + CR+ P+CS Y YEAI  +GL  G WLT  RL +C+P 
Sbjct: 1   MRKLALVPIRFYRYAISPLMASHCRFYPSCSCYAYEAIENHGLLRGGWLTFRRLGRCHPW 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G+DPVP     + ++
Sbjct: 61  NPGGYDPVPPIPTSRSSS 78


>gi|29839917|ref|NP_829023.1| hypothetical protein CCA00149 [Chlamydophila caviae GPIC]
 gi|33301877|sp|Q824J6|Y149_CHLCV RecName: Full=UPF0161 protein CCA_00149
 gi|29834264|gb|AAP04901.1| conserved hypothetical protein [Chlamydophila caviae GPIC]
          Length = 103

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 41/74 (55%)

Query: 50  FPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLI 109
           F K L   +  G+I IY+   S + G+ CR+ PTCS+Y  +A+  +G   G  LT+ R+ 
Sbjct: 6   FIKNLPTNLCCGLIHIYRWTISPLLGSPCRFFPTCSQYALQALKHHGCIKGLGLTIKRIG 65

Query: 110 KCNPLGSDGFDPVP 123
           KC P    G D VP
Sbjct: 66  KCGPWHPGGVDLVP 79


>gi|257867461|ref|ZP_05647114.1| conserved hypothetical protein [Enterococcus casseliflavus EC30]
 gi|257873790|ref|ZP_05653443.1| conserved hypothetical protein [Enterococcus casseliflavus EC10]
 gi|257801517|gb|EEV30447.1| conserved hypothetical protein [Enterococcus casseliflavus EC30]
 gi|257807954|gb|EEV36776.1| conserved hypothetical protein [Enterococcus casseliflavus EC10]
          Length = 91

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 41/79 (51%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              + IG +R YQ   S +F  SCRY PTCS Y  +AI  +G   G  + + R+++C+P 
Sbjct: 1   MSKLLIGFVRFYQRCISPLFPPSCRYYPTCSGYMIQAIQVHGAAKGGLMGVARILRCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNNP 133
              G D VP     K+N  
Sbjct: 61  VKGGIDYVPQTFTLKRNTK 79


>gi|261418061|ref|YP_003251743.1| hypothetical protein GYMC61_0582 [Geobacillus sp. Y412MC61]
 gi|319767980|ref|YP_004133481.1| hypothetical protein GYMC52_2973 [Geobacillus sp. Y412MC52]
 gi|261374518|gb|ACX77261.1| protein of unknown function DUF37 [Geobacillus sp. Y412MC61]
 gi|317112846|gb|ADU95338.1| protein of unknown function DUF37 [Geobacillus sp. Y412MC52]
          Length = 80

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 35/76 (46%), Positives = 44/76 (57%), Gaps = 2/76 (2%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            I  IR YQ   S +   +CR+ PTCS YG EAI R+G   G WLT  R++KC+P    G
Sbjct: 5   LIWCIRFYQRFLSPLKPPTCRFYPTCSNYGIEAIRRFGAIKGGWLTAKRILKCHPFHPGG 64

Query: 119 FDPVPDDLP--PKKNN 132
            DPVP+      +KNN
Sbjct: 65  LDPVPEPTHHLKRKNN 80


>gi|148245069|ref|YP_001219763.1| hypothetical protein COSY_0940 [Candidatus Vesicomyosocius okutanii
           HA]
 gi|146326896|dbj|BAF62039.1| conserved hypothetical protein [Candidatus Vesicomyosocius okutanii
           HA]
          Length = 71

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 29/68 (42%), Positives = 44/68 (64%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
           + + +I+ YQL  S +  ++CR+ PTCS+Y Y+AI  +G + G  L+L R+ KC+P    
Sbjct: 4   LLLILIKFYQLFISPLLSSNCRFQPTCSQYAYDAIQTHGFFKGLSLSLKRISKCHPWHDS 63

Query: 118 GFDPVPDD 125
           GFDPVP  
Sbjct: 64  GFDPVPKK 71


>gi|168334921|ref|ZP_02693041.1| hypothetical protein Epulo_07843 [Epulopiscium sp. 'N.t. morphotype
           B']
          Length = 73

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 41/73 (56%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + + +IR YQ   S   G  CR+ PTCS Y YEAI  +G + G  L   R+++CNP 
Sbjct: 1   MKKLALFLIRFYQKCISPHLGPRCRFYPTCSSYTYEAIQIHGFFKGGLLGTFRILRCNPF 60

Query: 115 GSDGFDPVPDDLP 127
              GFDPVP+   
Sbjct: 61  CKGGFDPVPEKKK 73


>gi|149925379|ref|ZP_01913643.1| hypothetical protein LMED105_04127 [Limnobacter sp. MED105]
 gi|149825496|gb|EDM84704.1| hypothetical protein LMED105_04127 [Limnobacter sp. MED105]
          Length = 90

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 46/76 (60%)

Query: 49  KFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRL 108
            F ++L       +IR YQL  S +F  SCR+ P+CSEY  EA+  +G W G+ L+  R+
Sbjct: 7   TFQRSLTARAITALIRGYQLAVSPLFPPSCRFYPSCSEYALEAVKIHGAWKGAALSFGRI 66

Query: 109 IKCNPLGSDGFDPVPD 124
            +CNP  + G DPVP+
Sbjct: 67  CRCNPWNAGGLDPVPE 82


>gi|190575190|ref|YP_001973035.1| hypothetical protein Smlt3309 [Stenotrophomonas maltophilia K279a]
 gi|194366508|ref|YP_002029118.1| hypothetical protein Smal_2735 [Stenotrophomonas maltophilia
           R551-3]
 gi|190013112|emb|CAQ46744.1| conserved hypothetical protein [Stenotrophomonas maltophilia K279a]
 gi|194349312|gb|ACF52435.1| protein of unknown function DUF37 [Stenotrophomonas maltophilia
           R551-3]
          Length = 84

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 31/68 (45%), Positives = 44/68 (64%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            + I ++R Y+   S + G  CR++P+CSEY  EAI+R+G   GSWL   RL +C+P   
Sbjct: 4   RLLIALLRFYKRFISPLLGPRCRFVPSCSEYAMEAISRHGPLRGSWLAARRLGRCHPFHP 63

Query: 117 DGFDPVPD 124
            GFDPVP+
Sbjct: 64  GGFDPVPE 71


>gi|323486757|ref|ZP_08092076.1| hypothetical protein HMPREF9474_03827 [Clostridium symbiosum
           WAL-14163]
 gi|323694899|ref|ZP_08109049.1| alpha-hemolysin [Clostridium symbiosum WAL-14673]
 gi|323399896|gb|EGA92275.1| hypothetical protein HMPREF9474_03827 [Clostridium symbiosum
           WAL-14163]
 gi|323500989|gb|EGB16901.1| alpha-hemolysin [Clostridium symbiosum WAL-14673]
          Length = 70

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 43/70 (61%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + I I +IR YQ   S + G  C+Y PTCS+Y  EA+ +YG + G  L   R+++C+P
Sbjct: 1   MIKKILIKMIRGYQKYISPLTGPHCKYTPTCSQYAIEAVQKYGAFKGMILACKRILRCHP 60

Query: 114 LGSDGFDPVP 123
               G+DPVP
Sbjct: 61  FAEGGYDPVP 70


>gi|313471889|ref|ZP_07812381.1| putative toxin-antitoxin system, toxin component [Lactobacillus
           jensenii 1153]
 gi|239529195|gb|EEQ68196.1| putative toxin-antitoxin system, toxin component [Lactobacillus
           jensenii 1153]
          Length = 95

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 45/78 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              + I ++R+YQ   S +F  +CRY P+CS Y  +++ ++G   G  + + R+I+CNP 
Sbjct: 1   MSKLLIFLVRVYQKFISPIFPPTCRYYPSCSSYMIDSLRKHGPLKGLIMGIARIIRCNPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G DPVPD    ++N 
Sbjct: 61  VRGGVDPVPDHFTLRRNP 78


>gi|30248405|ref|NP_840475.1| hypothetical protein NE0388 [Nitrosomonas europaea ATCC 19718]
 gi|47606151|sp|Q82XA0|Y388_NITEU RecName: Full=UPF0161 protein NE0388
 gi|30138291|emb|CAD84299.1| Domain of unknown function DUF37 [Nitrosomonas europaea ATCC 19718]
          Length = 69

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 26/69 (37%), Positives = 44/69 (63%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I +I++Y+     +   SCR+ PTCS Y +EA+ ++GL  G WL + R+++C+P 
Sbjct: 1   MKQLIIDLIKLYRYSIGLLIPPSCRFYPTCSNYMHEALVKHGLIKGLWLGMKRILRCHPW 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  NQGGYDPVP 69


>gi|116629869|ref|YP_815041.1| hypothetical protein LGAS_1234 [Lactobacillus gasseri ATCC 33323]
 gi|238853689|ref|ZP_04644057.1| conserved hypothetical protein [Lactobacillus gasseri 202-4]
 gi|282851617|ref|ZP_06260982.1| conserved hypothetical protein YidD [Lactobacillus gasseri 224-1]
 gi|122273193|sp|Q042L9|Y1234_LACGA RecName: Full=UPF0161 protein LGAS_1234
 gi|116095451|gb|ABJ60603.1| hypothetical protein LGAS_1234 [Lactobacillus gasseri ATCC 33323]
 gi|238833727|gb|EEQ25996.1| conserved hypothetical protein [Lactobacillus gasseri 202-4]
 gi|282557585|gb|EFB63182.1| conserved hypothetical protein YidD [Lactobacillus gasseri 224-1]
          Length = 97

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 45/78 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              + IG++ +Y+   S V   +CRY PTCS Y  +A+ ++G  +G  + + R+I+CNP 
Sbjct: 1   MNKLLIGLVNVYKKFISPVLPPTCRYYPTCSTYMIDALKKHGAILGLIMGISRIIRCNPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G DPVPD    ++N 
Sbjct: 61  IKGGVDPVPDYFTLRRNP 78


>gi|313884548|ref|ZP_07818309.1| conserved hypothetical protein [Eremococcus coleocola
           ACS-139-V-Col8]
 gi|312620332|gb|EFR31760.1| conserved hypothetical protein [Eremococcus coleocola
           ACS-139-V-Col8]
          Length = 87

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 44/80 (55%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + +   I  +  YQ   S  F  SCRY PTCS Y   AI ++G + G  + + R+++C+P
Sbjct: 4   MVKRFLITCVHFYQRGISPFFPPSCRYKPTCSNYMLGAIEKHGPFKGFLMGIARILRCHP 63

Query: 114 LGSDGFDPVPDDLPPKKNNP 133
               G+DPVPD    +++ P
Sbjct: 64  FVHGGYDPVPDYFTLRRSRP 83


>gi|260577132|ref|ZP_05845109.1| protein of unknown function DUF37 [Rhodobacter sp. SW2]
 gi|259020606|gb|EEW23925.1| protein of unknown function DUF37 [Rhodobacter sp. SW2]
          Length = 84

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 42/75 (56%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           T    I    +R Y+L  S   GN CR+ PTCS Y  EA+ R+G   G +L + R+ +C+
Sbjct: 2   TPLAQILALPVRAYRLFLSPWLGNGCRFQPTCSAYALEALERHGAAKGGYLAVHRICRCH 61

Query: 113 PLGSDGFDPVPDDLP 127
           P G  G+DPVP   P
Sbjct: 62  PWGGHGYDPVPGADP 76


>gi|157964069|ref|YP_001504103.1| hypothetical protein Spea_4258 [Shewanella pealeana ATCC 700345]
 gi|189040178|sp|A8HAI1|Y4258_SHEPA RecName: Full=UPF0161 protein Spea_4258
 gi|157849069|gb|ABV89568.1| protein of unknown function DUF37 [Shewanella pealeana ATCC 700345]
          Length = 84

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 44/75 (58%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            ++  + +   IIR YQL+ S + G  CR+ PTCS Y  EAI  +G+  G W    R+++
Sbjct: 4   TQSPLQWLATTIIRGYQLLISPMMGPRCRFNPTCSHYAIEAIRLHGVVKGCWFAGKRILR 63

Query: 111 CNPLGSDGFDPVPDD 125
           C+PL   G DPVP+ 
Sbjct: 64  CHPLHPGGEDPVPNK 78


>gi|297193298|ref|ZP_06910696.1| UPF0161 protein [Streptomyces pristinaespiralis ATCC 25486]
 gi|197718385|gb|EDY62293.1| UPF0161 protein [Streptomyces pristinaespiralis ATCC 25486]
          Length = 120

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 43/75 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   + +I+IYQ   S + G  CRY P+CS YGY AI R+G   G+ LT  R+++CNP 
Sbjct: 1   MKYPLLALIKIYQWTISPLLGPVCRYYPSCSHYGYTAIDRHGAVKGTALTAWRILRCNPW 60

Query: 115 GSDGFDPVPDDLPPK 129
              G D VP    P+
Sbjct: 61  SPGGVDHVPPRKRPR 75


>gi|294341967|emb|CAZ90396.1| conserved hypothetical protein [Thiomonas sp. 3As]
          Length = 147

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 29/73 (39%), Positives = 46/73 (63%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + IG++R+Y+L+ S   G  CR+ PTCS+Y  EA+ R+G   GS+L  +R+++C P 
Sbjct: 1   MKSVLIGLVRLYRLLLSPWVGGQCRFYPTCSQYTIEALERHGAAAGSYLGAVRILRCQPW 60

Query: 115 GSDGFDPVPDDLP 127
              G +PVPD   
Sbjct: 61  CQGGHEPVPDAFT 73


>gi|37521482|ref|NP_924859.1| hypothetical protein gsl1913 [Gloeobacter violaceus PCC 7421]
 gi|47606258|sp|Q7NJB9|Y1913_GLOVI RecName: Full=UPF0161 protein gsl1913
 gi|35212479|dbj|BAC89854.1| gsl1913 [Gloeobacter violaceus PCC 7421]
          Length = 78

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/76 (44%), Positives = 45/76 (59%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           L R    G IR YQ   S +   +CRY+PTCSEY  +AI R+G+  G WL   RL +C+P
Sbjct: 3   LVRRAATGAIRFYQRFVSPLTPPTCRYVPTCSEYTRQAIERFGVAAGIWLGTKRLCRCHP 62

Query: 114 LGSDGFDPVPDDLPPK 129
           L   G+DPVP+    +
Sbjct: 63  LHPGGYDPVPERRSVR 78


>gi|330997187|ref|ZP_08321040.1| hypothetical protein YidD [Paraprevotella xylaniphila YIT 11841]
 gi|329570982|gb|EGG52689.1| hypothetical protein YidD [Paraprevotella xylaniphila YIT 11841]
          Length = 80

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 27/65 (41%), Positives = 43/65 (66%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            I  I+ Y+ + S +   SCR+ PTCS+Y  EAI ++G + G +L + R+++C+P G  G
Sbjct: 16  LIAPIQFYRRVISPMTPPSCRFTPTCSQYAIEAIRKHGPFKGMYLAVRRILRCHPWGGSG 75

Query: 119 FDPVP 123
           +DPVP
Sbjct: 76  YDPVP 80


>gi|114327389|ref|YP_744546.1| putative cytoplasmic protein [Granulibacter bethesdensis CGDNIH1]
 gi|114315563|gb|ABI61623.1| hypothetical cytosolic protein [Granulibacter bethesdensis CGDNIH1]
          Length = 90

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 49/72 (68%), Gaps = 3/72 (4%)

Query: 55  GRLIGIGI---IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           GR+IG G+   +R+YQL+   V G +CR++P+CS+Y  +A+  +G + GS L   R+++C
Sbjct: 4   GRIIGYGLRLAVRLYQLVLRPVLGTNCRFVPSCSDYALQALREHGTFQGSMLAGRRILRC 63

Query: 112 NPLGSDGFDPVP 123
           NP    G+DPVP
Sbjct: 64  NPWHQGGYDPVP 75


>gi|91216060|ref|ZP_01253029.1| alpha hemolysin-like protein [Psychroflexus torquis ATCC 700755]
 gi|91186037|gb|EAS72411.1| alpha hemolysin-like protein [Psychroflexus torquis ATCC 700755]
          Length = 81

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 28/69 (40%), Positives = 44/69 (63%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            + +I+ YQ I S + G SCR+ PTCS Y ++A   +G+  G +L+++R+ KC+P G  G
Sbjct: 10  FLALIKAYQWILSPLLGPSCRFQPTCSHYAFQAFRTHGVLKGLYLSIIRVSKCHPWGDSG 69

Query: 119 FDPVPDDLP 127
           +DPVP    
Sbjct: 70  YDPVPKPKK 78


>gi|90023655|ref|YP_529482.1| hypothetical protein Sde_4015 [Saccharophagus degradans 2-40]
 gi|116256237|sp|Q21DF9|Y4015_SACD2 RecName: Full=UPF0161 protein Sde_4015
 gi|89953255|gb|ABD83270.1| protein of unknown function DUF37 [Saccharophagus degradans 2-40]
          Length = 91

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 31/88 (35%), Positives = 48/88 (54%), Gaps = 8/88 (9%)

Query: 38  NNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGL 97
           N+ P  +NW          L  + +I++Y+   S + G  CR+ PTCS Y  +A+  +G 
Sbjct: 12  NSDPTRKNW--------LNLPLLALIKVYRYAISPLLGPRCRFEPTCSSYAEQALIEHGP 63

Query: 98  WIGSWLTLLRLIKCNPLGSDGFDPVPDD 125
           + G+ L L RL KC+P  + G+DPVP  
Sbjct: 64  FKGTMLALSRLSKCHPWHAGGYDPVPKK 91


>gi|119718915|ref|YP_925880.1| hypothetical protein Noca_4698 [Nocardioides sp. JS614]
 gi|119539576|gb|ABL84193.1| protein of unknown function DUF37 [Nocardioides sp. JS614]
          Length = 92

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 47/77 (61%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
             R + IG +R Y+L+ S ++G  CRY P+CS Y  EA+  +G   GSWL   RL++C+P
Sbjct: 5   PVRYLLIGFLRAYRLLISPLYGQVCRYHPSCSAYALEAVRSHGSLKGSWLAGRRLVRCHP 64

Query: 114 LGSDGFDPVPDDLPPKK 130
             + G+DPVP     ++
Sbjct: 65  WAAGGYDPVPPASSRRR 81


>gi|66048359|ref|YP_238200.1| hypothetical protein Psyr_5135 [Pseudomonas syringae pv. syringae
           B728a]
 gi|237801667|ref|ZP_04590128.1| hypothetical protein POR16_22771 [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|257485602|ref|ZP_05639643.1| hypothetical protein PsyrptA_20216 [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|289628217|ref|ZP_06461171.1| hypothetical protein PsyrpaN_24318 [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289649107|ref|ZP_06480450.1| hypothetical protein Psyrpa2_15379 [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|289677545|ref|ZP_06498435.1| hypothetical protein PsyrpsF_29946 [Pseudomonas syringae pv.
           syringae FF5]
 gi|298484606|ref|ZP_07002711.1| hypothetical protein PSA3335_0003 [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|302185837|ref|ZP_07262510.1| hypothetical protein Psyrps6_05810 [Pseudomonas syringae pv.
           syringae 642]
 gi|75499947|sp|Q4ZL10|Y5135_PSEU2 RecName: Full=UPF0161 protein Psyr_5135
 gi|63259066|gb|AAY40162.1| Protein of unknown function DUF37 [Pseudomonas syringae pv.
           syringae B728a]
 gi|298160863|gb|EFI01879.1| hypothetical protein PSA3335_0003 [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|320321685|gb|EFW77784.1| hypothetical protein PsgB076_26855 [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320331113|gb|EFW87084.1| hypothetical protein PsgRace4_04931 [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330870072|gb|EGH04781.1| hypothetical protein PSYAE_23043 [Pseudomonas syringae pv. aesculi
           str. 0893_23]
 gi|330881911|gb|EGH16060.1| hypothetical protein Pgy4_23503 [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330890253|gb|EGH22914.1| hypothetical protein PSYMO_16113 [Pseudomonas syringae pv. mori
           str. 301020]
 gi|330898610|gb|EGH30029.1| hypothetical protein PSYJA_14072 [Pseudomonas syringae pv. japonica
           str. M301072PT]
 gi|330961502|gb|EGH61762.1| hypothetical protein PMA4326_23431 [Pseudomonas syringae pv.
           maculicola str. ES4326]
 gi|330970322|gb|EGH70388.1| hypothetical protein PSYAR_07514 [Pseudomonas syringae pv. aceris
           str. M302273PT]
 gi|330976399|gb|EGH76456.1| hypothetical protein PSYAP_07119 [Pseudomonas syringae pv. aptata
           str. DSM 50252]
 gi|330987016|gb|EGH85119.1| hypothetical protein PLA107_18457 [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331024526|gb|EGI04582.1| hypothetical protein POR16_22771 [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 81

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/69 (40%), Positives = 42/69 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R + +  I+ Y+   S +  + CR+ P+CS Y YEAI  +GL  G WL++ RL +C+P 
Sbjct: 1   MRKLALVPIQFYRYAISPLMASHCRFYPSCSCYAYEAIENHGLLRGGWLSIRRLGRCHPW 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  NPGGYDPVP 69


>gi|330444169|ref|YP_004377155.1| alpha-hemolysin [Chlamydophila pecorum E58]
 gi|328807279|gb|AEB41452.1| alpha-hemolysin [Chlamydophila pecorum E58]
          Length = 108

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 31/65 (47%), Positives = 40/65 (61%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            + +IR+YQ   S + GNSCR+ P+CS Y  +A+  +GL  G WLTL RL KC P    G
Sbjct: 16  ALSLIRVYQWTVSPLLGNSCRFFPSCSHYALQALHTHGLLYGLWLTLKRLGKCAPWHPGG 75

Query: 119 FDPVP 123
            D VP
Sbjct: 76  IDLVP 80


>gi|297184121|gb|ADI20240.1| hypothetical protein [uncultured Sphingobacterium sp. EB080_L08E11]
          Length = 91

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 42/65 (64%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            + +I +Y+ IFS + G SCRY PTCS Y  EA+  +G + G  +++ R+  C+P G  G
Sbjct: 13  LLALIWLYRKIFSRLLGPSCRYQPTCSVYAAEAVKIHGPFKGFLMSVKRISSCHPWGGHG 72

Query: 119 FDPVP 123
           +DPVP
Sbjct: 73  WDPVP 77


>gi|242278539|ref|YP_002990668.1| hypothetical protein Desal_1065 [Desulfovibrio salexigens DSM 2638]
 gi|242121433|gb|ACS79129.1| protein of unknown function DUF37 [Desulfovibrio salexigens DSM
           2638]
          Length = 82

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 34/82 (41%), Positives = 47/82 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R + +  IR YQ   S +F   CR+ PTCS+Y  EAI+ +G+  G   TL RL++CNPL
Sbjct: 1   MRTLFLYPIRFYQKFISPLFPGCCRFHPTCSQYAIEAISLHGVLKGGMYTLWRLLRCNPL 60

Query: 115 GSDGFDPVPDDLPPKKNNPKLL 136
              G+DPVP        +P L+
Sbjct: 61  CKGGYDPVPAHEKVPPRSPGLI 82


>gi|56477031|ref|YP_158620.1| hypothetical protein ebB89 [Aromatoleum aromaticum EbN1]
 gi|81357704|sp|Q5P4P3|Y1594_AZOSE RecName: Full=UPF0161 protein AZOSEA15940
 gi|56313074|emb|CAI07719.1| conserved hypothetical protein [Aromatoleum aromaticum EbN1]
          Length = 69

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/69 (40%), Positives = 44/69 (63%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + +G++R+Y+   S + G +CR+ P CSEY  EA+ R+G   G WL L R+ +C+P 
Sbjct: 1   MKALVLGLLRVYRYAISPMLGRNCRFHPCCSEYAQEAVERHGAMRGGWLALKRVGRCHPF 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  HPGGYDPVP 69


>gi|320449654|ref|YP_004201750.1| hypothetical protein TSC_c05690 [Thermus scotoductus SA-01]
 gi|320149823|gb|ADW21201.1| conserved hypothetical protein [Thermus scotoductus SA-01]
          Length = 85

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 31/76 (40%), Positives = 48/76 (63%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R + I +++ Y+   S +   +CR+ PTCS Y  EA+ R+G + GS+L + R++KC+PL
Sbjct: 1   MRGVLILLVKAYRRFISPLKPRTCRFHPTCSAYALEALERHGAFWGSYLAVRRILKCHPL 60

Query: 115 GSDGFDPVPDDLPPKK 130
              G DPVP   PP+K
Sbjct: 61  HPGGLDPVPLVFPPRK 76


>gi|311109681|ref|YP_003982534.1| hypothetical protein AXYL_06530 [Achromobacter xylosoxidans A8]
 gi|310764370|gb|ADP19819.1| hypothetical protein AXYL_06530 [Achromobacter xylosoxidans A8]
          Length = 90

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 30/70 (42%), Positives = 40/70 (57%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + + I  IR Y+   S   G  CR+ PTCS Y  EAI R+G W G WL + R+ +C+P
Sbjct: 1   MIKALLIAPIRFYRFFLSPWIGRQCRFTPTCSAYAIEAIERHGAWRGFWLAVRRIGRCHP 60

Query: 114 LGSDGFDPVP 123
               G DPVP
Sbjct: 61  WSPGGLDPVP 70


>gi|323527920|ref|YP_004230073.1| hypothetical protein BC1001_3600 [Burkholderia sp. CCGE1001]
 gi|323384922|gb|ADX57013.1| protein of unknown function DUF37 [Burkholderia sp. CCGE1001]
          Length = 76

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/76 (36%), Positives = 44/76 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I ++R Y+L  S + GN CR+ P+CS+Y  EAI  +G   G++L   RL +C+P 
Sbjct: 1   MQTVLIALLRFYKLAVSPLLGNRCRFYPSCSDYAREAIQYHGAARGTYLAARRLCRCHPF 60

Query: 115 GSDGFDPVPDDLPPKK 130
            + G D VP     K+
Sbjct: 61  SAGGIDLVPPSTSEKR 76


>gi|88803011|ref|ZP_01118538.1| hypothetical protein PI23P_10475 [Polaribacter irgensii 23-P]
 gi|88781869|gb|EAR13047.1| hypothetical protein PI23P_10475 [Polaribacter irgensii 23-P]
          Length = 73

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/73 (43%), Positives = 46/73 (63%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            K +     I ++R YQ+  S    ++CRY PTCS Y  EA+ ++G ++GSWL L R+ K
Sbjct: 1   MKKIIAYPFILLVRFYQVAISPFTPSTCRYSPTCSHYAIEALQKHGFFLGSWLALKRIFK 60

Query: 111 CNPLGSDGFDPVP 123
           C+P G  G+DPVP
Sbjct: 61  CHPWGGSGYDPVP 73


>gi|78212332|ref|YP_381111.1| hypothetical protein Syncc9605_0788 [Synechococcus sp. CC9605]
 gi|116256262|sp|Q3ALH6|Y788_SYNSC RecName: Full=UPF0161 protein Syncc9605_0788
 gi|78196791|gb|ABB34556.1| Protein of unknown function DUF37 [Synechococcus sp. CC9605]
          Length = 92

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 31/67 (46%), Positives = 42/67 (62%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
           + +  I  Y+   S + G  CR+ PTCS YG EAI ++G W G WLT+ RL++C+P    
Sbjct: 26  VLLAGIGFYRRFISPMIGPRCRFTPTCSAYGLEAIQKHGPWKGGWLTVKRLLRCHPFTPC 85

Query: 118 GFDPVPD 124
           G DPVPD
Sbjct: 86  GCDPVPD 92


>gi|311031178|ref|ZP_07709268.1| hypothetical protein Bm3-1_11631 [Bacillus sp. m3-13]
          Length = 75

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 43/75 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + + IIR Y+   S +   +CR+ PTCS YG EAI R+G   G WLT+ R+ KC+P 
Sbjct: 1   MKHVFLSIIRFYRKFISPLTPPTCRFYPTCSHYGMEAIERFGAIKGGWLTIKRIFKCHPF 60

Query: 115 GSDGFDPVPDDLPPK 129
              G D VP+    +
Sbjct: 61  HPGGIDHVPEKKDKR 75


>gi|320354721|ref|YP_004196060.1| hypothetical protein Despr_2633 [Desulfobulbus propionicus DSM
           2032]
 gi|320123223|gb|ADW18769.1| protein of unknown function DUF37 [Desulfobulbus propionicus DSM
           2032]
          Length = 92

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 26/86 (30%), Positives = 52/86 (60%)

Query: 37  KNNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYG 96
            + +  S   +G+  +    +  I + R YQL+ S +F   CR++P+CS+Y  EA+ ++G
Sbjct: 6   HHPSSSSEGKSGRSWRKAPAMCLIALFRGYQLLLSPLFPPVCRFIPSCSQYAIEAVRKHG 65

Query: 97  LWIGSWLTLLRLIKCNPLGSDGFDPV 122
           ++ G+ + + R+++C+P    G+DPV
Sbjct: 66  VFRGTLMAIWRILRCHPFSRGGYDPV 91


>gi|329667584|gb|AEB93532.1| hypothetical protein LJP_1210c [Lactobacillus johnsonii DPC 6026]
          Length = 97

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 45/78 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              + IG++ +Y+   S +   +CRY PTCS Y  +A+ ++G  +G  + L R+++CNP 
Sbjct: 1   MNKLLIGLVNVYKKFISPILPPTCRYYPTCSSYMIDALKKHGAILGLIMGLARIVRCNPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G DPVPD    ++N 
Sbjct: 61  IKGGVDPVPDYFTLRRNP 78


>gi|193216428|ref|YP_001997627.1| hypothetical protein Ctha_2731 [Chloroherpeton thalassium ATCC
           35110]
 gi|193089905|gb|ACF15180.1| protein of unknown function DUF37 [Chloroherpeton thalassium ATCC
           35110]
          Length = 87

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 27/83 (32%), Positives = 44/83 (53%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
                 +   + I +IR Y+L  S +F  SCR+ P+CS Y  EA   +  +  +WL++ R
Sbjct: 1   MSIVWKIMNSLPILLIRFYKLFISPLFPPSCRFHPSCSSYALEAYRTHNFFYATWLSVWR 60

Query: 108 LIKCNPLGSDGFDPVPDDLPPKK 130
           +++CNP    G+DPVP      +
Sbjct: 61  ILRCNPFVKGGYDPVPPSKNKIR 83


>gi|222152586|ref|YP_002561761.1| hypothetical protein SUB0408 [Streptococcus uberis 0140J]
 gi|254803862|sp|B9DTS7|Y408_STRU0 RecName: Full=UPF0161 protein SUB0408
 gi|222113397|emb|CAR41053.1| conserved hypothetical protein [Streptococcus uberis 0140J]
          Length = 82

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 47/80 (58%), Gaps = 1/80 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I  +R+YQ   S +F  SCRY PTCS Y  EA+ ++G   G  + + R+++C+P 
Sbjct: 1   MKSIIINFVRLYQKWISPLFPPSCRYRPTCSTYMIEAVEKHG-IKGVLMGIARILRCHPF 59

Query: 115 GSDGFDPVPDDLPPKKNNPK 134
              G DPVPD+   ++N  K
Sbjct: 60  VEGGEDPVPDEFTLRRNPQK 79


>gi|90655387|gb|ABD96228.1| unknown [uncultured marine type-A Synechococcus GOM 3M9]
          Length = 92

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 33/68 (48%), Positives = 45/68 (66%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            + + +I  Y+   S + G  CR++PTCS YG EAI ++G W GSWLT+ RL++C PL  
Sbjct: 25  WVLLALIGFYRRFISPLTGPRCRFIPTCSAYGLEAIQKHGPWRGSWLTIKRLLRCTPLTP 84

Query: 117 DGFDPVPD 124
            G DPVPD
Sbjct: 85  CGCDPVPD 92


>gi|87198601|ref|YP_495858.1| hypothetical protein Saro_0577 [Novosphingobium aromaticivorans DSM
           12444]
 gi|116256255|sp|Q2GAU9|Y577_NOVAD RecName: Full=UPF0161 protein Saro_0577
 gi|87134282|gb|ABD25024.1| protein of unknown function DUF37 [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 69

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 31/69 (44%), Positives = 43/69 (62%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I I R +QL  S V   SCRY P+CS+Y  EA+ ++G   G WL   RL++C+P 
Sbjct: 1   MKRLLILIARAWQLGPSRVLPPSCRYSPSCSQYAIEALEKHGAIKGGWLAAKRLLRCHPW 60

Query: 115 GSDGFDPVP 123
           G  G+DPVP
Sbjct: 61  GGHGYDPVP 69


>gi|126661996|ref|ZP_01732995.1| hypothetical protein FBBAL38_01555 [Flavobacteria bacterium BAL38]
 gi|126625375|gb|EAZ96064.1| hypothetical protein FBBAL38_01555 [Flavobacteria bacterium BAL38]
          Length = 85

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 49/78 (62%), Gaps = 3/78 (3%)

Query: 49  KFPKTLGRLI---GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTL 105
           K+PKTL + I    + ++R YQ+  S     +CR+ PTCS Y  +A+ ++GL+ G WL L
Sbjct: 8   KYPKTLKQWIIYPFLLLVRFYQVAISPFTPATCRFEPTCSSYTIQALQKHGLFKGGWLAL 67

Query: 106 LRLIKCNPLGSDGFDPVP 123
            R+  C+P G  G+DPVP
Sbjct: 68  KRIFSCHPWGRSGYDPVP 85


>gi|24380084|ref|NP_722039.1| hypothetical protein SMU.1710c [Streptococcus mutans UA159]
 gi|290579937|ref|YP_003484329.1| hypothetical protein SmuNN2025_0411 [Streptococcus mutans NN2025]
 gi|29428193|sp|Q8DSR1|Y1710_STRMU RecName: Full=UPF0161 protein SMU_1710c
 gi|24378079|gb|AAN59345.1|AE015000_3 conserved hypothetical protein [Streptococcus mutans UA159]
 gi|254996836|dbj|BAH87437.1| hypothetical protein [Streptococcus mutans NN2025]
          Length = 84

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 31/84 (36%), Positives = 47/84 (55%), Gaps = 1/84 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I  I+ YQ   S +F  SCRY PTCS Y  EAI ++G   G  + + R+++C+P 
Sbjct: 1   MKKVLIAPIKFYQKFISPIFPASCRYRPTCSAYMIEAIEKHG-LKGFLMGIARILRCHPF 59

Query: 115 GSDGFDPVPDDLPPKKNNPKLLSK 138
              G DPVP+    ++N  +  SK
Sbjct: 60  VEGGEDPVPNHFTLRRNKKEKPSK 83


>gi|26986752|ref|NP_742177.1| hypothetical protein PP_0007 [Pseudomonas putida KT2440]
 gi|60416275|sp|P0A179|Y007_PSEPK RecName: Full=UPF0161 protein PP_0007
 gi|60416351|sp|P0A180|YU161_PSEPU RecName: Full=UPF0161 protein in rnpA 3'region
 gi|24981342|gb|AAN65641.1|AE016190_7 conserved hypothetical protein TIGR00278 [Pseudomonas putida
           KT2440]
 gi|45708|emb|CAA44416.1| unnamed protein product [Pseudomonas putida]
          Length = 81

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 45/78 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R + +  I+ Y+   S +  N CR+ P+CS Y YEAI  +G+W G WL + RL +C+P 
Sbjct: 1   MRKLALVPIQFYRYAISPLMANHCRFFPSCSCYAYEAIENHGIWRGGWLAVRRLGRCHPW 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G+DPVP     + ++
Sbjct: 61  NDGGYDPVPPAPSSRTSS 78


>gi|284034940|ref|YP_003384871.1| hypothetical protein Kfla_7084 [Kribbella flavida DSM 17836]
 gi|283814233|gb|ADB36072.1| protein of unknown function DUF37 [Kribbella flavida DSM 17836]
          Length = 103

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 46/79 (58%)

Query: 60  IGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGF 119
           IG +++Y+   S ++G  CR+ P+CS Y  EA+ R+G   GSWL   RL +C+P    G+
Sbjct: 11  IGFLKLYRKFVSPMYGQVCRFYPSCSAYALEAVERHGAVRGSWLAARRLARCHPWNPGGY 70

Query: 120 DPVPDDLPPKKNNPKLLSK 138
           DPVP     ++  P   ++
Sbjct: 71  DPVPPTDVDQRGEPVSANQ 89


>gi|16752447|ref|NP_444708.1| hypothetical protein CP0156 [Chlamydophila pneumoniae AR39]
 gi|7189092|gb|AAF38037.1| conserved hypothetical protein [Chlamydophila pneumoniae AR39]
          Length = 106

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 44/77 (57%)

Query: 49  KFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRL 108
           +F + +   I + II +YQ + S + G+ CR+ P+CS Y  +A+  +G  +G WL++ R+
Sbjct: 8   RFLQQIPVRICLLIIYLYQWLISPLLGSCCRFFPSCSHYAEQALKSHGFLMGCWLSIKRI 67

Query: 109 IKCNPLGSDGFDPVPDD 125
            KC P    G D VP  
Sbjct: 68  GKCGPWHPGGIDMVPKT 84


>gi|330952337|gb|EGH52597.1| hypothetical protein PSYCIT7_13384 [Pseudomonas syringae Cit 7]
          Length = 81

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 45/78 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R + +  I+ Y+   S +  + CR+ P+CS Y YEAI  +GL  G WL++ RL +C+P 
Sbjct: 1   MRKLALVPIQFYRYAISPLMASHCRFYPSCSCYAYEAIENHGLLRGGWLSIRRLGRCHPW 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G+DPVP     + ++
Sbjct: 61  NPGGYDPVPAIPTSRSSS 78


>gi|71734893|ref|YP_277294.1| hypothetical protein PSPPH_5221 [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|116256252|sp|Q48BF1|Y5221_PSE14 RecName: Full=UPF0161 protein PSPPH_5221
 gi|71555446|gb|AAZ34657.1| conserved hypothetical protein TIGR00278 [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 81

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/69 (40%), Positives = 42/69 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R + +  I+ Y+   S +  + CR+ P+CS Y YEAI  +GL  G WL++ RL +C+P 
Sbjct: 1   MRKLALVPIQFYRYAMSPLMASHCRFYPSCSCYAYEAIENHGLLRGGWLSIRRLGRCHPW 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  NPGGYDPVP 69


>gi|114332118|ref|YP_748340.1| hypothetical protein Neut_2153 [Nitrosomonas eutropha C91]
 gi|122313200|sp|Q0AE57|Y2153_NITEC RecName: Full=UPF0161 protein Neut_2153
 gi|114309132|gb|ABI60375.1| protein of unknown function DUF37 [Nitrosomonas eutropha C91]
          Length = 69

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 27/69 (39%), Positives = 43/69 (62%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + IG+I++YQ     +   SCR+ PTCS Y  EA+ ++GL  G WL   R+++C+P 
Sbjct: 1   MKQLIIGLIKLYQYSIGLLIPPSCRFYPTCSNYMREALTKHGLIKGLWLGTRRILRCHPW 60

Query: 115 GSDGFDPVP 123
              G+DP+P
Sbjct: 61  NPGGYDPIP 69


>gi|104784448|ref|YP_610946.1| hypothetical protein PSEEN5557 [Pseudomonas entomophila L48]
 gi|122401167|sp|Q1I2H3|Y5557_PSEE4 RecName: Full=UPF0161 protein PSEEN5557
 gi|95113435|emb|CAK18163.1| conserved hypothetical protein [Pseudomonas entomophila L48]
          Length = 81

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 44/78 (56%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R + +  I+ Y+   S +  + CR+ P+CS Y YEAI  +GL  G WL + RL +C+P 
Sbjct: 1   MRKLALVPIQFYRYAISPLMASHCRFYPSCSCYAYEAIENHGLLRGGWLAVRRLGRCHPW 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              GFDPVP     + ++
Sbjct: 61  NDGGFDPVPPAPSSRTSS 78


>gi|256381074|ref|YP_003104734.1| hypothetical protein Amir_7098 [Actinosynnema mirum DSM 43827]
 gi|255925377|gb|ACU40888.1| protein of unknown function DUF37 [Actinosynnema mirum DSM 43827]
          Length = 89

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 31/82 (37%), Positives = 39/82 (47%)

Query: 47  NGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLL 106
               P      + +  IR YQ   S     +CR+ PTCS Y  EA+  +G   GSWLT+ 
Sbjct: 2   TDPAPVRPAVRVLVLPIRFYQRFISPYLPPTCRFHPTCSSYAVEALTVHGALRGSWLTVR 61

Query: 107 RLIKCNPLGSDGFDPVPDDLPP 128
           RL +C P    G DPVP    P
Sbjct: 62  RLGRCGPWHPGGLDPVPPKRVP 83


>gi|322375936|ref|ZP_08050447.1| putative toxin-antitoxin system, toxin component [Streptococcus sp.
           C300]
 gi|321279204|gb|EFX56246.1| putative toxin-antitoxin system, toxin component [Streptococcus sp.
           C300]
          Length = 80

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 30/77 (38%), Positives = 44/77 (57%), Gaps = 1/77 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I  +R YQ   S  F  SCR+ PTCS Y  +AI ++G + G  + L R+++C+P 
Sbjct: 1   MKRILIAPVRFYQRFISPAFPPSCRFEPTCSNYMIQAIEKHG-FKGVLMGLARILRCHPW 59

Query: 115 GSDGFDPVPDDLPPKKN 131
              G DPVPD    ++N
Sbjct: 60  SKTGKDPVPDHFSLRRN 76


>gi|157964432|ref|YP_001499256.1| hypothetical protein RMA_0498 [Rickettsia massiliae MTU5]
 gi|167012995|sp|A8F1C3|Y498_RICM5 RecName: Full=UPF0161 protein RMA_0498
 gi|157844208|gb|ABV84709.1| hypothetical protein RMA_0498 [Rickettsia massiliae MTU5]
          Length = 82

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/85 (42%), Positives = 48/85 (56%), Gaps = 4/85 (4%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              I + ++R YQ   S +  N+CR+ PTCSEY  EAI+ +G   G WLT  R+IKC P 
Sbjct: 1   MTRILLLLLRFYQYFISPLLSNNCRFHPTCSEYAKEAISMHGSIKGLWLTFKRIIKCQPF 60

Query: 115 GSDGFDPVPDDLPPKKNNPKLLSKK 139
              G+D VP  +     N K L+KK
Sbjct: 61  CDGGYDTVPISIK----NSKPLNKK 81


>gi|15618502|ref|NP_224788.1| YidD family protein [Chlamydophila pneumoniae CWL029]
 gi|15836124|ref|NP_300648.1| YidD family protein [Chlamydophila pneumoniae J138]
 gi|33241947|ref|NP_876888.1| alpha-hemolysin [Chlamydophila pneumoniae TW-183]
 gi|14286023|sp|Q9Z7W2|Y592_CHLPN RecName: Full=UPF0161 protein CPn_0592/CP_0156/CPj0592/CpB0617
 gi|4376886|gb|AAD18731.1| YidD family [Chlamydophila pneumoniae CWL029]
 gi|8978964|dbj|BAA98799.1| YidD family [Chlamydophila pneumoniae J138]
 gi|33236457|gb|AAP98545.1| alpha-hemolysin [Chlamydophila pneumoniae TW-183]
          Length = 103

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 44/77 (57%)

Query: 49  KFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRL 108
           +F + +   I + II +YQ + S + G+ CR+ P+CS Y  +A+  +G  +G WL++ R+
Sbjct: 5   RFLQQIPVRICLLIIYLYQWLISPLLGSCCRFFPSCSHYAEQALKSHGFLMGCWLSIKRI 64

Query: 109 IKCNPLGSDGFDPVPDD 125
            KC P    G D VP  
Sbjct: 65  GKCGPWHPGGIDMVPKT 81


>gi|331265751|ref|YP_004325381.1| hypothetical protein SOR_0354 [Streptococcus oralis Uo5]
 gi|326682423|emb|CBZ00040.1| conserved hypothetical protein [Streptococcus oralis Uo5]
          Length = 90

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I  +R YQ   S  F  SCR+ PTCS Y  +AI ++G + G  + L R+++C+P 
Sbjct: 1   MKRILIAPVRFYQRFISPAFPPSCRFEPTCSNYMIQAIEKHG-FKGVLMGLARILRCHPW 59

Query: 115 GSDGFDPVPDDLPPKKNNP 133
              G DPVPD    K+N+ 
Sbjct: 60  SPIGKDPVPDHFSLKRNHK 78


>gi|67922092|ref|ZP_00515607.1| Protein of unknown function DUF37 [Crocosphaera watsonii WH 8501]
 gi|67855992|gb|EAM51236.1| Protein of unknown function DUF37 [Crocosphaera watsonii WH 8501]
          Length = 74

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 45/74 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I +I+ Y+   S +F  SCR+ PTCS+Y  EAI R+G   GSWL L R+++C+P 
Sbjct: 1   MKKILILLIKGYRNFISPLFPPSCRFRPTCSQYTLEAIERFGPVQGSWLGLKRILRCHPF 60

Query: 115 GSDGFDPVPDDLPP 128
              G+DPVP     
Sbjct: 61  HPGGYDPVPPVSKK 74


>gi|254432013|ref|ZP_05045716.1| hypothetical protein CPCC7001_1904 [Cyanobium sp. PCC 7001]
 gi|197626466|gb|EDY39025.1| hypothetical protein CPCC7001_1904 [Cyanobium sp. PCC 7001]
          Length = 127

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 35/68 (51%), Positives = 47/68 (69%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
           L+ +G+I  Y+   S + G  CR++P+CS YG EAI R+G W GSWLTL RL++C+P   
Sbjct: 60  LVLLGLIGCYRRCLSPLLGPRCRFIPSCSAYGLEAIRRHGPWRGSWLTLRRLLRCHPFTP 119

Query: 117 DGFDPVPD 124
            G DPVPD
Sbjct: 120 CGCDPVPD 127


>gi|182684816|ref|YP_001836563.1| hypothetical protein SPCG_1846 [Streptococcus pneumoniae CGSP14]
 gi|303254618|ref|ZP_07340720.1| hypothetical protein CGSSpBS455_04076 [Streptococcus pneumoniae
           BS455]
 gi|303258819|ref|ZP_07344799.1| hypothetical protein CGSSp9vBS293_06844 [Streptococcus pneumoniae
           SP-BS293]
 gi|303261982|ref|ZP_07347928.1| hypothetical protein CGSSp14BS292_11264 [Streptococcus pneumoniae
           SP14-BS292]
 gi|303263845|ref|ZP_07349767.1| hypothetical protein CGSSpBS397_08564 [Streptococcus pneumoniae
           BS397]
 gi|303265620|ref|ZP_07351519.1| hypothetical protein CGSSpBS457_09225 [Streptococcus pneumoniae
           BS457]
 gi|303269888|ref|ZP_07355631.1| hypothetical protein CGSSpBS458_06464 [Streptococcus pneumoniae
           BS458]
 gi|226696130|sp|B2ISX1|Y1846_STRPS RecName: Full=UPF0161 protein SPCG_1846
 gi|182630150|gb|ACB91098.1| hypothetical protein SPCG_1846 [Streptococcus pneumoniae CGSP14]
 gi|301802564|emb|CBW35325.1| conserved hypothetical protein [Streptococcus pneumoniae INV200]
 gi|302598330|gb|EFL65374.1| hypothetical protein CGSSpBS455_04076 [Streptococcus pneumoniae
           BS455]
 gi|302637065|gb|EFL67554.1| hypothetical protein CGSSp14BS292_11264 [Streptococcus pneumoniae
           SP14-BS292]
 gi|302640320|gb|EFL70775.1| hypothetical protein CGSSpBS293_06844 [Streptococcus pneumoniae
           SP-BS293]
 gi|302640591|gb|EFL70995.1| hypothetical protein CGSSpBS458_06464 [Streptococcus pneumoniae
           BS458]
 gi|302644747|gb|EFL74995.1| hypothetical protein CGSSpBS457_09225 [Streptococcus pneumoniae
           BS457]
 gi|302646883|gb|EFL77108.1| hypothetical protein CGSSpBS397_08564 [Streptococcus pneumoniae
           BS397]
          Length = 80

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 30/77 (38%), Positives = 45/77 (58%), Gaps = 1/77 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I ++R YQ   S VF  SCR+  TCS Y  +AI ++G + G  + L R+++C+P 
Sbjct: 1   MKRILIALVRFYQRFISPVFPPSCRFELTCSNYMIQAIEKHG-FKGVLMGLARILRCHPW 59

Query: 115 GSDGFDPVPDDLPPKKN 131
              G DP+PD    K+N
Sbjct: 60  SKTGKDPIPDHFSLKRN 76


>gi|126176562|ref|YP_001052711.1| hypothetical protein Sbal_4381 [Shewanella baltica OS155]
 gi|153002876|ref|YP_001368557.1| hypothetical protein Shew185_4380 [Shewanella baltica OS185]
 gi|160877623|ref|YP_001556939.1| hypothetical protein Sbal195_4522 [Shewanella baltica OS195]
 gi|217975464|ref|YP_002360215.1| hypothetical protein Sbal223_4326 [Shewanella baltica OS223]
 gi|166227253|sp|A6WUK5|Y4380_SHEB8 RecName: Full=UPF0161 protein Shew185_4380
 gi|166227254|sp|A3DAS9|Y4381_SHEB5 RecName: Full=UPF0161 protein Sbal_4381
 gi|189040193|sp|A9KX21|Y4522_SHEB9 RecName: Full=UPF0161 protein Sbal195_4522
 gi|254803896|sp|B8EDW6|Y4326_SHEB2 RecName: Full=UPF0161 protein Sbal223_4326
 gi|125999767|gb|ABN63842.1| protein of unknown function DUF37 [Shewanella baltica OS155]
 gi|151367494|gb|ABS10494.1| protein of unknown function DUF37 [Shewanella baltica OS185]
 gi|160863145|gb|ABX51679.1| protein of unknown function DUF37 [Shewanella baltica OS195]
 gi|217500599|gb|ACK48792.1| protein of unknown function DUF37 [Shewanella baltica OS223]
 gi|315269822|gb|ADT96675.1| protein of unknown function DUF37 [Shewanella baltica OS678]
          Length = 84

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 42/78 (53%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
               ++  + +   +IR YQ+  S + G  CR+ PTCS Y  EAI  +G   G W  L R
Sbjct: 1   MAQTQSPLQWLATTLIRGYQVFISPILGPRCRFNPTCSHYAIEAIKVHGTAKGCWFALKR 60

Query: 108 LIKCNPLGSDGFDPVPDD 125
           ++KC+PL   G DPVP  
Sbjct: 61  ILKCHPLHPGGSDPVPPK 78


>gi|78189984|ref|YP_380322.1| hypothetical protein Cag_2031 [Chlorobium chlorochromatii CaD3]
 gi|116256149|sp|Q3ANZ6|Y2031_CHLCH RecName: Full=UPF0161 protein Cag_2031
 gi|78172183|gb|ABB29279.1| Protein of unknown function DUF37 [Chlorobium chlorochromatii CaD3]
          Length = 94

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 30/72 (41%), Positives = 44/72 (61%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
             +   I I +IR+Y+   S + G SC+Y+PTCS Y  EA  R+  +   WLT+ R+++C
Sbjct: 4   WKIINAIPIVLIRLYRTFLSPLLGPSCKYVPTCSSYALEAFERHNFFYALWLTIWRILRC 63

Query: 112 NPLGSDGFDPVP 123
           NP    G+DPVP
Sbjct: 64  NPFSKGGYDPVP 75


>gi|148550510|ref|YP_001270612.1| hypothetical protein Pput_5310 [Pseudomonas putida F1]
 gi|167013021|sp|A5WBB8|Y5310_PSEP1 RecName: Full=UPF0161 protein Pput_5310
 gi|148514568|gb|ABQ81428.1| protein of unknown function DUF37 [Pseudomonas putida F1]
          Length = 81

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 45/78 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R + +  I+ Y+   S +  N CR+ P+CS Y YEAI  +G+W G WL + RL +C+P 
Sbjct: 1   MRKLALVPIQFYRYAISPLMANHCRFFPSCSCYAYEAIENHGIWRGGWLAVRRLGRCHPW 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              GFDPVP     + ++
Sbjct: 61  NDGGFDPVPPAPSSRTSS 78


>gi|219871958|ref|YP_002476333.1| hypothetical protein HAPS_1897 [Haemophilus parasuis SH0165]
 gi|219692162|gb|ACL33385.1| conserved hypothetical protein [Haemophilus parasuis SH0165]
          Length = 75

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 41/75 (54%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            + ++  Y+ + S + G  CR+ PTCS Y  EA+  +G   G WL L R+++CNPL   G
Sbjct: 1   MLALVHFYRYVISPLIGPRCRFYPTCSTYALEAVKIHGAIKGGWLALKRILRCNPLNEGG 60

Query: 119 FDPVPDDLPPKKNNP 133
            DPVP      K + 
Sbjct: 61  EDPVPPKCNCGKKHK 75


>gi|292669289|ref|ZP_06602715.1| conserved hypothetical protein [Selenomonas noxia ATCC 43541]
 gi|292649130|gb|EFF67102.1| conserved hypothetical protein [Selenomonas noxia ATCC 43541]
          Length = 69

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 41/69 (59%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + + +I  Y+   S +    CRY PTCS Y  EAI RYG W G W+ L R+++C+P 
Sbjct: 1   MKRLLLLLIHFYRSGVSPLMPPHCRYYPTCSAYAAEAIERYGAWRGGWMALRRILRCHPF 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  HRGGYDPVP 69


>gi|157151462|ref|YP_001450945.1| hypothetical protein SGO_1668 [Streptococcus gordonii str. Challis
           substr. CH1]
 gi|262283234|ref|ZP_06061001.1| UPF0161 protein [Streptococcus sp. 2_1_36FAA]
 gi|189038979|sp|A8AYT5|Y1668_STRGC RecName: Full=UPF0161 protein SGO_1668
 gi|157076256|gb|ABV10939.1| conserved hypothetical protein TIGR00278 [Streptococcus gordonii
           str. Challis substr. CH1]
 gi|262261486|gb|EEY80185.1| UPF0161 protein [Streptococcus sp. 2_1_36FAA]
          Length = 84

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 45/81 (55%), Gaps = 1/81 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + + I  +R YQ   S  F  SCR+ PTCS Y  EAI ++G   G  + L R+ +C+P
Sbjct: 1   MIKKLLIAPVRFYQRFISPAFPPSCRFRPTCSNYMIEAIQKHGA-KGVLMGLARIFRCHP 59

Query: 114 LGSDGFDPVPDDLPPKKNNPK 134
               G DPVPD    K+N+ +
Sbjct: 60  WSQPGEDPVPDHFSLKRNDTR 80


>gi|127514792|ref|YP_001095989.1| hypothetical protein Shew_3867 [Shewanella loihica PV-4]
 gi|166232653|sp|A3QJT2|Y3867_SHELP RecName: Full=UPF0161 protein Shew_3867
 gi|126640087|gb|ABO25730.1| protein of unknown function DUF37 [Shewanella loihica PV-4]
          Length = 84

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 42/78 (53%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
               ++  + +   +IR YQ+  S + G  CR+ PTCS Y  EAI  +G   GSW    R
Sbjct: 1   MAQAQSPLQWLATKLIRGYQIFISPILGPKCRFHPTCSNYALEAIRLHGFVKGSWFAGKR 60

Query: 108 LIKCNPLGSDGFDPVPDD 125
           ++KC+PL   G DPVP  
Sbjct: 61  VLKCHPLHPGGEDPVPPK 78


>gi|307717724|ref|YP_003873256.1| hypothetical protein STHERM_c00070 [Spirochaeta thermophila DSM
           6192]
 gi|306531449|gb|ADN00983.1| hypothetical protein STHERM_c00070 [Spirochaeta thermophila DSM
           6192]
          Length = 93

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 31/87 (35%), Positives = 48/87 (55%), Gaps = 1/87 (1%)

Query: 38  NNTPKSRNWNGKFPK-TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYG 96
           ++ P S+  +         R + + +IR+YQ   S  F + CR+ PTCS Y  +A+ +YG
Sbjct: 7   SSAPFSKRQSWWVRWIAFPRKLLVLVIRLYQRFVSPAFPSRCRFYPTCSHYTIQALEKYG 66

Query: 97  LWIGSWLTLLRLIKCNPLGSDGFDPVP 123
           L  G  L + R+ KC+P    G+DPVP
Sbjct: 67  LVKGLSLGIKRISKCHPFHPGGYDPVP 93


>gi|282897684|ref|ZP_06305683.1| Protein of unknown function DUF37 [Raphidiopsis brookii D9]
 gi|281197363|gb|EFA72260.1| Protein of unknown function DUF37 [Raphidiopsis brookii D9]
          Length = 76

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 31/74 (41%), Positives = 47/74 (63%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I  I+ Y+L  S +F  SCR+ PTCS Y  EAI R+G++ GSW+ L R+++C+P 
Sbjct: 1   MKKLFIWPIQGYRLFISPLFPPSCRFQPTCSMYAIEAIERFGVFRGSWMALGRILRCHPF 60

Query: 115 GSDGFDPVPDDLPP 128
              G+DPVP+    
Sbjct: 61  HPGGYDPVPEKTEK 74


>gi|254818676|ref|ZP_05223677.1| hypothetical protein MintA_02069 [Mycobacterium intracellulare ATCC
           13950]
          Length = 116

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 34/86 (39%), Positives = 52/86 (60%), Gaps = 3/86 (3%)

Query: 42  KSRNWNGKFPKTLGRLIG---IGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLW 98
             R+  G    T+GR +    I +I++Y+ + S +   +CR++PTCS+Y  +A+  YGL 
Sbjct: 2   TGRSAVGALTHTVGRSVARGLIFLIQLYRHMVSPLRPATCRFVPTCSQYAVDALNEYGLI 61

Query: 99  IGSWLTLLRLIKCNPLGSDGFDPVPD 124
            GSWL  +RL KC P    G+DP+PD
Sbjct: 62  RGSWLAAVRLAKCGPWHEGGWDPIPD 87


>gi|259416047|ref|ZP_05739967.1| hypothetical protein SCH4B_1097 [Silicibacter sp. TrichCH4B]
 gi|259347486|gb|EEW59263.1| hypothetical protein SCH4B_1097 [Silicibacter sp. TrichCH4B]
          Length = 113

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 39/102 (38%), Positives = 56/102 (54%), Gaps = 1/102 (0%)

Query: 26  PIQKKGSPLLLKNNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCS 85
           P   +G+     N      +      + L RLI +  +R Y+L+FS   G +CRY PTCS
Sbjct: 3   PAPLRGAICRPINVALSEPSAYVDVMRFLARLIAL-PVRGYRLLFSPWVGFNCRYQPTCS 61

Query: 86  EYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVPDDLP 127
            Y  EA+ R+G   G++L L R+ +C+P GS G+DPVP   P
Sbjct: 62  AYALEALERHGPLKGTYLMLRRIGRCHPFGSSGYDPVPGADP 103


>gi|332299745|ref|YP_004441666.1| Ribonuclease P protein component [Porphyromonas asaccharolytica DSM
           20707]
 gi|332176808|gb|AEE12498.1| Ribonuclease P protein component [Porphyromonas asaccharolytica DSM
           20707]
          Length = 252

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 33/104 (31%), Positives = 48/104 (46%), Gaps = 3/104 (2%)

Query: 21  SSYALPIQKKGSPLLLKNNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRY 80
           S  A     +         T K    +     +L   +    ++ Y+   S +   SCR+
Sbjct: 148 SPEAEASTSRQEQ--TAKVTAKQATQDDSQQLSLAVRLLSYPVKFYRHFISPLLPPSCRF 205

Query: 81  LPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD-GFDPVP 123
            PTCS+Y  EA+  +G   GS LTL RL++CNP     G+DPVP
Sbjct: 206 TPTCSQYALEALRVHGALKGSCLTLWRLLRCNPFNPHVGYDPVP 249


>gi|172035662|ref|YP_001802163.1| hypothetical protein cce_0746 [Cyanothece sp. ATCC 51142]
 gi|254806602|sp|B1WR39|Y746_CYAA5 RecName: Full=UPF0161 protein cce_0746
 gi|171697116|gb|ACB50097.1| DUF37-containing protein [Cyanothece sp. ATCC 51142]
          Length = 74

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 30/74 (40%), Positives = 45/74 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   I +I+ Y+ + S +F  SCR+ PTCS+Y  EAI ++G   GSWL L R+++C+P 
Sbjct: 1   MKKTLILLIKGYRRLISPLFPPSCRFQPTCSQYTLEAIEKFGALRGSWLGLRRILRCHPF 60

Query: 115 GSDGFDPVPDDLPP 128
              G+DPVP     
Sbjct: 61  HPGGYDPVPPVTKK 74


>gi|188025447|ref|ZP_02958668.2| hypothetical protein PROSTU_00418 [Providencia stuartii ATCC 25827]
 gi|188023489|gb|EDU61529.1| hypothetical protein PROSTU_00418 [Providencia stuartii ATCC 25827]
          Length = 72

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 37/75 (49%), Positives = 50/75 (66%), Gaps = 3/75 (4%)

Query: 62  IIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDP 121
           +IR YQL  S + G  CR+ PTCS YG EA+ R+G+  GSWLT  R++KC+PL + G DP
Sbjct: 1   MIRGYQLAISPLLGPRCRFNPTCSNYGIEALRRFGMLKGSWLTAKRVLKCHPLHAGGDDP 60

Query: 122 VPDDLPPKKNNPKLL 136
           VP   P K ++ + L
Sbjct: 61  VP---PKKNDDNREL 72


>gi|160901488|ref|YP_001567070.1| hypothetical protein Daci_6057 [Delftia acidovorans SPH-1]
 gi|160367072|gb|ABX38685.1| protein of unknown function DUF37 [Delftia acidovorans SPH-1]
          Length = 96

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 30/74 (40%), Positives = 49/74 (66%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + + + ++R Y+L+ S   G++CR+ PTCS Y  EA+ ++G  +GS+LTL RL +C+P
Sbjct: 1   MMQRLLMALVRGYRLMLSPWLGSACRFTPTCSAYSLEALEQHGAAVGSYLTLRRLARCHP 60

Query: 114 LGSDGFDPVPDDLP 127
               G DPVP+  P
Sbjct: 61  WCDGGHDPVPEQKP 74


>gi|260584803|ref|ZP_05852548.1| toxin-antitoxin system, toxin component [Granulicatella elegans
           ATCC 700633]
 gi|260157460|gb|EEW92531.1| toxin-antitoxin system, toxin component [Granulicatella elegans
           ATCC 700633]
          Length = 99

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 46/78 (58%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I IG++R YQ   S +F  SC Y PTCS Y  +AI ++G   G  + + R+++C+P 
Sbjct: 1   MKRIMIGLVRGYQKWISPLFPPSCIYRPTCSTYMIQAIEKHGAIKGVIMGIGRIMRCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G DPVPD+   +++ 
Sbjct: 61  ILGGQDPVPDEFTVRRHK 78


>gi|170783401|ref|YP_001711735.1| hypothetical protein CMS_3113 [Clavibacter michiganensis subsp.
           sepedonicus]
 gi|189039818|sp|B0RDQ2|Y3113_CLAMS RecName: Full=UPF0161 protein CMS3113
 gi|169157971|emb|CAQ03181.1| conserved hypothetical protein [Clavibacter michiganensis subsp.
           sepedonicus]
          Length = 103

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/69 (40%), Positives = 41/69 (59%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R   I +I +Y+ I S ++G+ CRY P+CS YG EA+  +GL  G  L + R+ +C+P 
Sbjct: 12  PRNAAIAVIGLYRRIVSPLYGDVCRYYPSCSAYGLEAVQEHGLIRGGGLAVWRVCRCHPW 71

Query: 115 GSDGFDPVP 123
              G D VP
Sbjct: 72  AEGGIDDVP 80


>gi|78486229|ref|YP_392154.1| hypothetical protein Tcr_1890 [Thiomicrospira crunogena XCL-2]
 gi|116256147|sp|Q31EE3|Y1890_THICR RecName: Full=UPF0161 protein Tcr_1890
 gi|78364515|gb|ABB42480.1| Conserved hypothetical protein with DUF37 [Thiomicrospira crunogena
           XCL-2]
          Length = 91

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 29/71 (40%), Positives = 42/71 (59%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
              + + I  +R YQL  S + G  CR+ PTCS Y  EA+ ++G++ G WL + R+ KC+
Sbjct: 2   NPFKWLIILPVRFYQLFISPILGPRCRFYPTCSHYTIEAVQQHGVFCGLWLAIKRIAKCH 61

Query: 113 PLGSDGFDPVP 123
           P    G DPVP
Sbjct: 62  PGNPGGVDPVP 72


>gi|74318553|ref|YP_316293.1| hypothetical protein Tbd_2535 [Thiobacillus denitrificans ATCC
           25259]
 gi|116256207|sp|Q3SFW8|Y2535_THIDA RecName: Full=UPF0161 protein Tbd_2535
 gi|74058048|gb|AAZ98488.1| Protein of unknown function DUF37 [Thiobacillus denitrificans ATCC
           25259]
          Length = 78

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 39/77 (50%), Positives = 47/77 (61%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
            L +   +G IR+YQL  S   G  CRYLPTCSEYG EAI ++G   GSWL   R+ +C 
Sbjct: 2   NLAQKCLVGAIRVYQLALSPWLGRQCRYLPTCSEYGKEAIEKHGALKGSWLAAKRIGRCR 61

Query: 113 PLGSDGFDPVPDDLPPK 129
           P  S G+DPVP   P K
Sbjct: 62  PGCSHGYDPVPPVDPRK 78


>gi|288926856|ref|ZP_06420763.1| putative toxin-antitoxin system, toxin component [Prevotella buccae
           D17]
 gi|288336381|gb|EFC74760.1| putative toxin-antitoxin system, toxin component [Prevotella buccae
           D17]
          Length = 79

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 30/72 (41%), Positives = 43/72 (59%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           +     + I  IR YQL  S +   SCR+ PTCSEY  +A+ ++G   G  L + R+++C
Sbjct: 8   RKAVVWLLILPIRFYQLAISPLTPPSCRFTPTCSEYARQALIKHGPVKGLLLAVWRVLRC 67

Query: 112 NPLGSDGFDPVP 123
           NP G  G+DPVP
Sbjct: 68  NPWGGSGYDPVP 79


>gi|209542537|ref|YP_002274766.1| hypothetical protein Gdia_0355 [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209530214|gb|ACI50151.1| protein of unknown function DUF37 [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 79

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 47/73 (64%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            IG IR+YQ + S V G +CR++P+CS Y  EA+ R+G + G+ L   R+++CNP    G
Sbjct: 1   MIGAIRVYQWVLSPVLGPNCRFVPSCSNYAVEAVRRHGPFRGAILAAWRILRCNPWNIGG 60

Query: 119 FDPVPDDLPPKKN 131
           +DPVP     +++
Sbjct: 61  YDPVPSRERARRS 73


>gi|167560994|ref|ZP_02353910.1| hypothetical protein BoklE_00415 [Burkholderia oklahomensis EO147]
 gi|167568258|ref|ZP_02361132.1| hypothetical protein BoklC_00350 [Burkholderia oklahomensis C6786]
          Length = 89

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 44/77 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I ++R Y++  S + G+ CR+ P+CS+Y  EAI  +G   G++L   RL +C+P 
Sbjct: 1   MQTVLIALLRFYKVAVSPLLGSRCRFYPSCSDYAREAIQYHGAARGTYLAARRLCRCHPF 60

Query: 115 GSDGFDPVPDDLPPKKN 131
            + G D VP      +N
Sbjct: 61  SAGGIDLVPPPNSDARN 77


>gi|167587877|ref|ZP_02380265.1| hypothetical protein BuboB_21201 [Burkholderia ubonensis Bu]
          Length = 88

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 26/76 (34%), Positives = 43/76 (56%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I ++R Y++  S + GN CR+ P+CS+Y  EAI  +G   G++L   RL +C+P 
Sbjct: 1   MQTVLIALLRFYKVAVSPLLGNRCRFYPSCSDYAREAIQYHGAARGTYLAARRLCRCHPF 60

Query: 115 GSDGFDPVPDDLPPKK 130
            + G D VP      +
Sbjct: 61  SAGGIDLVPPPNSETR 76


>gi|134096617|ref|YP_001101692.1| hypothetical protein HEAR3470 [Herminiimonas arsenicoxydans]
 gi|166990843|sp|A4GAN4|Y3470_HERAR RecName: Full=UPF0161 protein HEAR3470
 gi|133740520|emb|CAL63571.1| conserved hypothetical protein [Herminiimonas arsenicoxydans]
          Length = 88

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 31/69 (44%), Positives = 41/69 (59%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I + ++R YQL  S   G +CR+ P+CS Y +EAI  YG   GS+L   RL KC+P 
Sbjct: 1   MKTILLLLVRAYQLGISPFLGQNCRFYPSCSAYAFEAIGEYGALKGSFLATKRLCKCHPW 60

Query: 115 GSDGFDPVP 123
              G DPVP
Sbjct: 61  HPGGVDPVP 69


>gi|332968627|gb|EGK07681.1| alpha-hemolysin [Kingella kingae ATCC 23330]
          Length = 69

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 28/69 (40%), Positives = 43/69 (62%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              + + ++R YQL  S +    CR++PTCS+Y  EAI ++G   G+ LT  R+ +C+P 
Sbjct: 1   MTRLLLALVRFYQLAISPLIPPRCRFVPTCSQYAVEAIRKHGACKGACLTAKRVCRCHPW 60

Query: 115 GSDGFDPVP 123
           G  G+DPVP
Sbjct: 61  GGSGYDPVP 69


>gi|77464642|ref|YP_354146.1| hypothetical protein RSP_1061 [Rhodobacter sphaeroides 2.4.1]
 gi|126463482|ref|YP_001044596.1| hypothetical protein Rsph17029_2722 [Rhodobacter sphaeroides ATCC
           17029]
 gi|221640554|ref|YP_002526816.1| hypothetical protein RSKD131_2455 [Rhodobacter sphaeroides KD131]
 gi|332559535|ref|ZP_08413857.1| hypothetical protein RSWS8N_10770 [Rhodobacter sphaeroides WS8N]
 gi|116256211|sp|Q3IYY9|Y2677_RHOS4 RecName: Full=UPF0161 protein RHOS4_26770
 gi|166228440|sp|A3PNA8|Y2722_RHOS1 RecName: Full=UPF0161 protein Rsph17029_2722
 gi|254765024|sp|B9KNZ3|Y2455_RHOSK RecName: Full=UPF0161 protein RSKD131_2455
 gi|77389060|gb|ABA80245.1| hypothetical protein RSP_1061 [Rhodobacter sphaeroides 2.4.1]
 gi|126105146|gb|ABN77824.1| protein of unknown function DUF37 [Rhodobacter sphaeroides ATCC
           17029]
 gi|221161335|gb|ACM02315.1| Hypothetical Protein RSKD131_2455 [Rhodobacter sphaeroides KD131]
 gi|332277247|gb|EGJ22562.1| hypothetical protein RSWS8N_10770 [Rhodobacter sphaeroides WS8N]
          Length = 84

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 44/82 (53%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           +    +    +R Y+L+ S   G+ CRY PTCS Y  +A+ R+G   G WL   R++ C+
Sbjct: 2   SPLAQVLALPVRAYRLLLSPWVGHGCRYQPTCSVYALDALERHGALKGGWLAARRILSCH 61

Query: 113 PLGSDGFDPVPDDLPPKKNNPK 134
           P G  G+DPVP   P     P+
Sbjct: 62  PWGGSGYDPVPGADPEHDRRPR 83


>gi|24371605|ref|NP_715647.1| hypothetical protein SO_0005 [Shewanella oneidensis MR-1]
 gi|120600875|ref|YP_965449.1| hypothetical protein Sputw3181_4093 [Shewanella sp. W3-18-1]
 gi|146295081|ref|YP_001185505.1| hypothetical protein Sputcn32_4003 [Shewanella putrefaciens CN-32]
 gi|29428199|sp|Q8EKT5|Y005_SHEON RecName: Full=UPF0161 protein SO_0005
 gi|166227216|sp|A4YCM3|Y4003_SHEPC RecName: Full=UPF0161 protein Sputcn32_4003
 gi|166227225|sp|A1RQF0|Y4093_SHESW RecName: Full=UPF0161 protein Sputw3181_4093
 gi|24345355|gb|AAN53092.1|AE015452_5 conserved hypothetical protein TIGR00278 [Shewanella oneidensis
           MR-1]
 gi|120560968|gb|ABM26895.1| protein of unknown function DUF37 [Shewanella sp. W3-18-1]
 gi|145566771|gb|ABP77706.1| protein of unknown function DUF37 [Shewanella putrefaciens CN-32]
 gi|319428594|gb|ADV56668.1| protein of unknown function DUF37 [Shewanella putrefaciens 200]
          Length = 84

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 42/78 (53%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
               ++  + +   +IR YQ+  S + G  CR+ PTCS Y  EAI  +G   G W  L R
Sbjct: 1   MAQTQSPLQWLATTLIRGYQIFISPILGPRCRFNPTCSHYAIEAIKVHGTAKGCWFALKR 60

Query: 108 LIKCNPLGSDGFDPVPDD 125
           ++KC+PL   G DPVP  
Sbjct: 61  ILKCHPLHPGGSDPVPPK 78


>gi|23015971|ref|ZP_00055733.1| COG0759: Uncharacterized conserved protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 89

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 32/67 (47%), Positives = 44/67 (65%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
           L+  G+IR+YQL+ S V   SCR+ P+CS Y  +AI  +G   GSWL L R+ +C+P   
Sbjct: 6   LVMRGLIRLYQLLLSPVLPASCRFTPSCSAYAMQAIRDHGPVGGSWLGLKRICRCHPWND 65

Query: 117 DGFDPVP 123
            G+DPVP
Sbjct: 66  GGYDPVP 72


>gi|325519716|gb|EGC99036.1| hypothetical protein B1M_38601 [Burkholderia sp. TJI49]
          Length = 88

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 25/73 (34%), Positives = 43/73 (58%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
           + I ++R Y++  S + GN CR+ P+CS+Y  EAI  +G   G++L + R+ +C+P  + 
Sbjct: 4   VLIALLRFYKVAVSPLLGNRCRFYPSCSDYAREAIQYHGAARGTYLAVRRVCRCHPFSAG 63

Query: 118 GFDPVPDDLPPKK 130
           G D VP      +
Sbjct: 64  GIDLVPPPNSDTR 76


>gi|297570494|ref|YP_003691838.1| protein of unknown function DUF37 [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296926409|gb|ADH87219.1| protein of unknown function DUF37 [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 101

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 35/91 (38%), Positives = 53/91 (58%), Gaps = 4/91 (4%)

Query: 37  KNNTPKSRNWNGKF----PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAI 92
               P+ ++ +G       + L R   + ++R YQL+ S +F  SCR++PTCSEY  EAI
Sbjct: 11  VGQPPEVKSHSGSPVPGGLRALPRRGCLLLVRFYQLVISPLFPPSCRFVPTCSEYALEAI 70

Query: 93  ARYGLWIGSWLTLLRLIKCNPLGSDGFDPVP 123
            RYG+  G +L   R+++C+P    GFDPV 
Sbjct: 71  TRYGVLRGCYLAFRRILRCHPFNPGGFDPVK 101


>gi|260221778|emb|CBA30682.1| UPF0161 protein Rfer_4243 [Curvibacter putative symbiont of Hydra
           magnipapillata]
          Length = 115

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 51/74 (68%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + R + IG+I+ Y+L+ S   G++CR+ PTCS Y  +A+ R+G  IGS+L + RL +C+P
Sbjct: 26  MIRGLLIGLIKGYRLLLSPWLGSACRFNPTCSVYALQALERHGATIGSYLMVARLARCHP 85

Query: 114 LGSDGFDPVPDDLP 127
             + G DPVP++ P
Sbjct: 86  WCAGGHDPVPENAP 99


>gi|257897978|ref|ZP_05677631.1| conserved hypothetical protein [Enterococcus faecium Com15]
 gi|257835890|gb|EEV60964.1| conserved hypothetical protein [Enterococcus faecium Com15]
          Length = 99

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 41/80 (51%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + I I ++R YQ   S  F  SCRY PTCS Y  +AI  +G   G+ +   R+++C+P
Sbjct: 1   MMKKILIYLVRGYQRFISPAFPPSCRYYPTCSNYMIKAIQTHGALKGTVMGTARILRCHP 60

Query: 114 LGSDGFDPVPDDLPPKKNNP 133
               G D VP      +N  
Sbjct: 61  FVKGGIDYVPLTFQLTRNKK 80


>gi|325275326|ref|ZP_08141279.1| hypothetical protein G1E_18490 [Pseudomonas sp. TJI-51]
 gi|324099574|gb|EGB97467.1| hypothetical protein G1E_18490 [Pseudomonas sp. TJI-51]
          Length = 81

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 46/78 (58%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R + +  I+ Y+   S +  + CR+ P+CS Y YEAI  +GLW G WL + RL +C+P 
Sbjct: 1   MRKLALVPIQFYRYAISPLMASHCRFFPSCSCYAYEAIENHGLWRGGWLAVRRLGRCHPW 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
            + GFDPVP     + ++
Sbjct: 61  NAGGFDPVPPAPSSRTSS 78


>gi|88809253|ref|ZP_01124762.1| hypothetical protein WH7805_06156 [Synechococcus sp. WH 7805]
 gi|88787195|gb|EAR18353.1| hypothetical protein WH7805_06156 [Synechococcus sp. WH 7805]
          Length = 72

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 30/67 (44%), Positives = 43/67 (64%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
           + + +I  Y+   S + G  CR++P+CS YG EAI ++G W G WLTL R+ +C+P    
Sbjct: 6   LFVALIGFYRRFVSPLIGPRCRFIPSCSAYGLEAIEKHGPWKGGWLTLRRISRCHPFTPC 65

Query: 118 GFDPVPD 124
           G DPVPD
Sbjct: 66  GCDPVPD 72


>gi|282863322|ref|ZP_06272381.1| protein of unknown function DUF37 [Streptomyces sp. ACTE]
 gi|282561657|gb|EFB67200.1| protein of unknown function DUF37 [Streptomyces sp. ACTE]
          Length = 119

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 43/75 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   + +I++YQ   S + G  CRY P+CS YGY AI R+G   G+ LT  R+++CNP 
Sbjct: 1   MKYPLLALIKLYQWTISPLLGPVCRYYPSCSHYGYTAIDRHGAIKGTALTAWRILRCNPW 60

Query: 115 GSDGFDPVPDDLPPK 129
              G D VP    P+
Sbjct: 61  SPGGVDHVPPRKRPR 75


>gi|254509623|ref|ZP_05121690.1| conserved hypothetical protein TIGR00278 [Rhodobacteraceae
           bacterium KLH11]
 gi|221533334|gb|EEE36322.1| conserved hypothetical protein TIGR00278 [Rhodobacteraceae
           bacterium KLH11]
          Length = 74

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 34/63 (53%), Positives = 45/63 (71%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           IR Y+LIFS   G +CRY PTCS Y  EA+ ++G   G+WL   R+ +C+P GSDG+DPV
Sbjct: 12  IRAYRLIFSPWVGFNCRYQPTCSAYALEALEKHGPIKGTWLAARRIGRCHPWGSDGYDPV 71

Query: 123 PDD 125
           PD+
Sbjct: 72  PDE 74


>gi|126657904|ref|ZP_01729057.1| hypothetical protein CY0110_13606 [Cyanothece sp. CCY0110]
 gi|126620844|gb|EAZ91560.1| hypothetical protein CY0110_13606 [Cyanothece sp. CCY0110]
          Length = 74

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 31/74 (41%), Positives = 44/74 (59%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I  I+ Y+   S +F  SCR+ PTCS+Y  EAI ++G   GSWL L R+++C+P 
Sbjct: 1   MKKILILFIKGYRTFISPLFPPSCRFRPTCSQYTLEAIEKFGAVQGSWLGLKRILRCHPF 60

Query: 115 GSDGFDPVPDDLPP 128
              G+DPVP     
Sbjct: 61  HPGGYDPVPPVTKK 74


>gi|165977385|ref|YP_001652978.1| hypothetical protein APJL_1986 [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|165877486|gb|ABY70534.1| hypothetical protein APJL_1986 [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
          Length = 78

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 28/77 (36%), Positives = 40/77 (51%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
           + +  I  Y+   S + G  CR+ PTCS Y  EAI  +G   G WL   R+ +C+P    
Sbjct: 1   MLLLPIYFYRYCISPLIGPRCRFYPTCSTYAVEAIKTHGAIKGGWLAAKRIARCHPWNEG 60

Query: 118 GFDPVPDDLPPKKNNPK 134
           G DPVP     K++N +
Sbjct: 61  GEDPVPPCCNHKESNKE 77


>gi|330812750|ref|YP_004357212.1| hypothetical protein PSEBR_m1755 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327380858|gb|AEA72208.1| Conserved hypothetical protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 81

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 44/78 (56%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R + +  I+ Y+   S +  + CR+ P+CS Y YEAI  +GL  G WLT  RL +C+P 
Sbjct: 1   MRKLALVPIQFYRYAISPLMASHCRFYPSCSCYAYEAIENHGLLRGGWLTFRRLGRCHPW 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G+DPVP     + ++
Sbjct: 61  NPGGYDPVPPIPTSRSSS 78


>gi|189347990|ref|YP_001944519.1| hypothetical protein Clim_2522 [Chlorobium limicola DSM 245]
 gi|189342137|gb|ACD91540.1| protein of unknown function DUF37 [Chlorobium limicola DSM 245]
          Length = 94

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 30/83 (36%), Positives = 47/83 (56%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
             +  L  + +IR Y+   S + G SC+Y PTCS+Y  +A   +  +  SWLT+ R+++C
Sbjct: 7   WRIVNLAPMALIRFYRTYLSVLLGPSCKYYPTCSQYALDAYGEHNFFYASWLTIWRVLRC 66

Query: 112 NPLGSDGFDPVPDDLPPKKNNPK 134
           NP    G+DPVP      ++N K
Sbjct: 67  NPFSKGGYDPVPLKSVKSQDNLK 89


>gi|229823432|ref|ZP_04449501.1| hypothetical protein GCWU000282_00730 [Catonella morbi ATCC 51271]
 gi|229787207|gb|EEP23321.1| hypothetical protein GCWU000282_00730 [Catonella morbi ATCC 51271]
          Length = 97

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 32/86 (37%), Positives = 50/86 (58%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + R + I ++R YQL  S +F  SCRY P+CS Y  +AI ++G + G  + L R+ +C+P
Sbjct: 1   MFRWLFIKLVRFYQLALSPLFPPSCRYSPSCSTYTIQAIEKHGAFKGLIMGLARISRCHP 60

Query: 114 LGSDGFDPVPDDLPPKKNNPKLLSKK 139
             + G DPVPD    +++     S K
Sbjct: 61  FVAGGKDPVPDYFTLRRSTLPDGSPK 86


>gi|148984325|ref|ZP_01817620.1| hypothetical protein CGSSp3BS71_03852 [Streptococcus pneumoniae
           SP3-BS71]
 gi|148989666|ref|ZP_01820998.1| hypothetical protein CGSSp6BS73_00455 [Streptococcus pneumoniae
           SP6-BS73]
 gi|148993331|ref|ZP_01822871.1| hypothetical protein CGSSp9BS68_07032 [Streptococcus pneumoniae
           SP9-BS68]
 gi|148998737|ref|ZP_01826175.1| hypothetical protein CGSSp11BS70_11754 [Streptococcus pneumoniae
           SP11-BS70]
 gi|149006472|ref|ZP_01830171.1| hypothetical protein CGSSp18BS74_01746 [Streptococcus pneumoniae
           SP18-BS74]
 gi|149011262|ref|ZP_01832509.1| hypothetical protein CGSSp19BS75_07627 [Streptococcus pneumoniae
           SP19-BS75]
 gi|168483405|ref|ZP_02708357.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC1873-00]
 gi|168487319|ref|ZP_02711827.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC1087-00]
 gi|168489849|ref|ZP_02714048.1| conserved hypothetical protein [Streptococcus pneumoniae SP195]
 gi|168494211|ref|ZP_02718354.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC3059-06]
 gi|168574938|ref|ZP_02720901.1| conserved hypothetical protein [Streptococcus pneumoniae MLV-016]
 gi|169833145|ref|YP_001695239.1| hypothetical protein SPH_1989 [Streptococcus pneumoniae
           Hungary19A-6]
 gi|194398569|ref|YP_002038462.1| hypothetical protein SPG_1758 [Streptococcus pneumoniae G54]
 gi|221232608|ref|YP_002511762.1| hypothetical protein SPN23F_18860 [Streptococcus pneumoniae ATCC
           700669]
 gi|225855306|ref|YP_002736818.1| hypothetical protein SPJ_1778 [Streptococcus pneumoniae JJA]
 gi|307068486|ref|YP_003877452.1| hypothetical protein SPAP_1867 [Streptococcus pneumoniae AP200]
 gi|307128068|ref|YP_003880099.1| hypothetical protein SP670_1947 [Streptococcus pneumoniae 670-6B]
 gi|226695947|sp|B5E1Y5|Y1758_STRP4 RecName: Full=UPF0161 protein SPG_1758
 gi|226701117|sp|B1I883|Y1989_STRPI RecName: Full=UPF0161 protein SPH_1989
 gi|254800627|sp|C1CG97|Y1778_STRZJ RecName: Full=UPF0161 protein SPJ_1778
 gi|254800696|sp|B8ZNB1|Y1886_STRPJ RecName: Full=UPF0161 protein SPN23F18860
 gi|147755431|gb|EDK62480.1| hypothetical protein CGSSp11BS70_11754 [Streptococcus pneumoniae
           SP11-BS70]
 gi|147761770|gb|EDK68733.1| hypothetical protein CGSSp18BS74_01746 [Streptococcus pneumoniae
           SP18-BS74]
 gi|147764252|gb|EDK71183.1| hypothetical protein CGSSp19BS75_07627 [Streptococcus pneumoniae
           SP19-BS75]
 gi|147923614|gb|EDK74727.1| hypothetical protein CGSSp3BS71_03852 [Streptococcus pneumoniae
           SP3-BS71]
 gi|147924983|gb|EDK76065.1| hypothetical protein CGSSp6BS73_00455 [Streptococcus pneumoniae
           SP6-BS73]
 gi|147928098|gb|EDK79117.1| hypothetical protein CGSSp9BS68_07032 [Streptococcus pneumoniae
           SP9-BS68]
 gi|168995647|gb|ACA36259.1| conserved hypothetical protein [Streptococcus pneumoniae
           Hungary19A-6]
 gi|172043292|gb|EDT51338.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC1873-00]
 gi|183569791|gb|EDT90319.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC1087-00]
 gi|183571743|gb|EDT92271.1| conserved hypothetical protein [Streptococcus pneumoniae SP195]
 gi|183575781|gb|EDT96309.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC3059-06]
 gi|183578787|gb|EDT99315.1| conserved hypothetical protein [Streptococcus pneumoniae MLV-016]
 gi|194358236|gb|ACF56684.1| conserved hypothetical protein [Streptococcus pneumoniae G54]
 gi|220675070|emb|CAR69648.1| conserved hypothetical protein [Streptococcus pneumoniae ATCC
           700669]
 gi|225724101|gb|ACO19954.1| conserved hypothetical protein [Streptococcus pneumoniae JJA]
 gi|301794835|emb|CBW37291.1| conserved hypothetical protein [Streptococcus pneumoniae INV104]
 gi|301800652|emb|CBW33296.1| conserved hypothetical protein [Streptococcus pneumoniae OXC141]
 gi|306410023|gb|ADM85450.1| Uncharacterized conserved protein [Streptococcus pneumoniae AP200]
 gi|306485130|gb|ADM91999.1| conserved hypothetical protein [Streptococcus pneumoniae 670-6B]
 gi|332072211|gb|EGI82696.1| hypothetical protein SPAR148_1784 [Streptococcus pneumoniae
           GA17545]
 gi|332072696|gb|EGI83179.1| hypothetical protein SPAR50_1868 [Streptococcus pneumoniae GA17570]
 gi|332073024|gb|EGI83504.1| hypothetical protein SPAR68_1900 [Streptococcus pneumoniae GA41301]
 gi|332200428|gb|EGJ14501.1| hypothetical protein SPAR93_1906 [Streptococcus pneumoniae GA47368]
 gi|332201283|gb|EGJ15354.1| hypothetical protein SPAR120_1790 [Streptococcus pneumoniae
           GA47901]
          Length = 80

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 44/77 (57%), Gaps = 1/77 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I  +R YQ   S VF  SCR+  TCS Y  +AI ++G + G  + L R+++C+P 
Sbjct: 1   MKRILIAPVRFYQRFISPVFPPSCRFELTCSNYMIQAIEKHG-FKGVLMGLARILRCHPW 59

Query: 115 GSDGFDPVPDDLPPKKN 131
              G DPVPD    K+N
Sbjct: 60  SKTGKDPVPDHFSLKRN 76


>gi|326319558|ref|YP_004237230.1| hypothetical protein Acav_4786 [Acidovorax avenae subsp. avenae
           ATCC 19860]
 gi|323376394|gb|ADX48663.1| protein of unknown function DUF37 [Acidovorax avenae subsp. avenae
           ATCC 19860]
          Length = 105

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 30/74 (40%), Positives = 46/74 (62%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + R + + ++R Y+   S   G++CR+ PTCS Y  +A+ R+G   GS+LTL RL +C+P
Sbjct: 1   MMRSLLMALVRGYRFFLSPWLGSACRFEPTCSAYALQALERHGAGAGSYLTLRRLARCHP 60

Query: 114 LGSDGFDPVPDDLP 127
               G DPVP + P
Sbjct: 61  WCDGGHDPVPAEAP 74


>gi|114565214|ref|YP_752728.1| hypothetical protein Sfri_4064 [Shewanella frigidimarina NCIMB 400]
 gi|122298223|sp|Q07VS5|Y4064_SHEFN RecName: Full=UPF0161 protein Sfri_4064
 gi|114336507|gb|ABI73889.1| protein of unknown function DUF37 [Shewanella frigidimarina NCIMB
           400]
          Length = 84

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 44/78 (56%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
               ++  + +   +IR YQ++ S + G  CR+ PTCS Y  EAI  +G   GSW  + R
Sbjct: 1   MAQTQSPLQWLATTVIRGYQILISPLLGPRCRFNPTCSYYAIEAIKTHGTVKGSWFAMKR 60

Query: 108 LIKCNPLGSDGFDPVPDD 125
           ++KC+PL   G DPVP  
Sbjct: 61  ILKCHPLHPGGSDPVPPK 78


>gi|260424965|ref|ZP_05779066.1| putative toxin-antitoxin system, toxin component [Dialister invisus
           DSM 15470]
 gi|260403760|gb|EEW97307.1| putative toxin-antitoxin system, toxin component [Dialister invisus
           DSM 15470]
          Length = 70

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 42/70 (60%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + + I +IR Y+   S +    CR+ PTCS Y  EA+ +YG   G WL L R++KC+P
Sbjct: 1   MMKTVLIVLIRFYRKYVSPLKPPCCRFTPTCSTYALEAVEKYGALKGGWLALKRILKCHP 60

Query: 114 LGSDGFDPVP 123
               G+DPVP
Sbjct: 61  FHKGGYDPVP 70


>gi|221633070|ref|YP_002522295.1| hypothetical protein trd_1086 [Thermomicrobium roseum DSM 5159]
 gi|254799929|sp|B9L0L5|Y1086_THERP RecName: Full=UPF0161 protein trd_1086
 gi|221156011|gb|ACM05138.1| conserved hypothetical protein TIGR00278 [Thermomicrobium roseum
           DSM 5159]
          Length = 69

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 33/69 (47%), Positives = 45/69 (65%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              + + +IR YQ   S     +CR+ PTCSEYGYEAI+RYG+  G  LT+ RL++C+P 
Sbjct: 1   MTKLALLLIRFYQRFISPGLPPACRFYPTCSEYGYEAISRYGIIKGGVLTVRRLLRCHPF 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  HPGGYDPVP 69


>gi|206900616|ref|YP_002251655.1| hypothetical protein DICTH_1847 [Dictyoglomus thermophilum H-6-12]
 gi|226696144|sp|B5YBN7|Y1847_DICT6 RecName: Full=UPF0161 protein DICTH_1847
 gi|206739719|gb|ACI18777.1| conserved hypothetical protein [Dictyoglomus thermophilum H-6-12]
          Length = 85

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 32/85 (37%), Positives = 46/85 (54%), Gaps = 5/85 (5%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R + I +I+ Y+   S V   SCR+ PTCS Y  EAI R+G + G  L + R+++C+P 
Sbjct: 1   MRGLLIILIKFYKKFISPVLPKSCRFYPTCSTYALEAIERFGAFEGGILAIKRILRCHPF 60

Query: 115 GSDGFDPVPDD-----LPPKKNNPK 134
              G+DPVP       L  K+   K
Sbjct: 61  NPGGYDPVPTKEEFLELKLKRRKNK 85


>gi|164686449|ref|ZP_02210477.1| hypothetical protein CLOBAR_00014 [Clostridium bartlettii DSM
           16795]
 gi|164604460|gb|EDQ97925.1| hypothetical protein CLOBAR_00014 [Clostridium bartlettii DSM
           16795]
          Length = 83

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 42/65 (64%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            + I +IR YQ   S + G +CR+ PTCS+Y  EA  +YG+  G +LT+ R++KC+P   
Sbjct: 17  KVCIYLIRFYQKYISPLKGPTCRFYPTCSQYAIEAFKKYGVIKGMFLTIKRILKCHPFHP 76

Query: 117 DGFDP 121
            G+DP
Sbjct: 77  GGYDP 81


>gi|158520118|ref|YP_001527988.1| hypothetical protein Dole_0101 [Desulfococcus oleovorans Hxd3]
 gi|158508944|gb|ABW65911.1| protein of unknown function DUF37 [Desulfococcus oleovorans Hxd3]
          Length = 64

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 27/62 (43%), Positives = 44/62 (70%)

Query: 62  IIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDP 121
           +IR YQL+ S + G  CR+ P+CS+Y +EA+ R+G+  G +L++ R+ +C+P    G+DP
Sbjct: 3   LIRAYQLVVSPLLGPRCRFYPSCSQYAHEAVFRHGVVKGLFLSIKRIARCHPFCPGGYDP 62

Query: 122 VP 123
           VP
Sbjct: 63  VP 64


>gi|325287201|ref|YP_004262991.1| hypothetical protein Celly_2300 [Cellulophaga lytica DSM 7489]
 gi|324322655|gb|ADY30120.1| UPF0161 protein yidD [Cellulophaga lytica DSM 7489]
          Length = 74

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 29/65 (44%), Positives = 43/65 (66%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            + +++IYQ + S +   SCRY PTCS+Y  EA+ ++GL+ G WL   R+  C+P G  G
Sbjct: 10  FLLLVKIYQTVISPLTPASCRYSPTCSQYTVEALKKHGLFKGGWLATKRIFSCHPWGGSG 69

Query: 119 FDPVP 123
           +DPVP
Sbjct: 70  YDPVP 74


>gi|257886798|ref|ZP_05666451.1| conserved hypothetical protein [Enterococcus faecium 1,141,733]
 gi|257895366|ref|ZP_05675019.1| conserved hypothetical protein [Enterococcus faecium Com12]
 gi|257822852|gb|EEV49784.1| conserved hypothetical protein [Enterococcus faecium 1,141,733]
 gi|257831931|gb|EEV58352.1| conserved hypothetical protein [Enterococcus faecium Com12]
          Length = 98

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 40/79 (50%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I ++R YQ   S  F  SCRY PTCS Y  +AI  +G   G+ +   R+++C+P 
Sbjct: 1   MKKILIYLVRGYQRFISPAFPPSCRYYPTCSNYMIKAIQTHGALKGTVMGTARILRCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNNP 133
              G D VP      +N  
Sbjct: 61  VKGGIDYVPLTFQLTRNKK 79


>gi|269792318|ref|YP_003317222.1| hypothetical protein Taci_0704 [Thermanaerovibrio acidaminovorans
           DSM 6589]
 gi|269099953|gb|ACZ18940.1| protein of unknown function DUF37 [Thermanaerovibrio
           acidaminovorans DSM 6589]
          Length = 75

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 32/73 (43%), Positives = 48/73 (65%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            +    L+ +  IR+YQ+  S + G +CR+ PTCS+Y +EAI+R+G+  G WL+  RL+K
Sbjct: 1   MRNPMVLLCLFSIRVYQIFLSPLLGRNCRFHPTCSQYAFEAISRFGVLRGIWLSAKRLVK 60

Query: 111 CNPLGSDGFDPVP 123
           C P    G+DPVP
Sbjct: 61  CGPWHPGGYDPVP 73


>gi|254391431|ref|ZP_05006633.1| conserved hypothetical protein [Streptomyces clavuligerus ATCC
           27064]
 gi|294813737|ref|ZP_06772380.1| DUF37 domain-containing protein [Streptomyces clavuligerus ATCC
           27064]
 gi|326442158|ref|ZP_08216892.1| hypothetical protein SclaA2_13889 [Streptomyces clavuligerus ATCC
           27064]
 gi|197705120|gb|EDY50932.1| conserved hypothetical protein [Streptomyces clavuligerus ATCC
           27064]
 gi|294326336|gb|EFG07979.1| DUF37 domain-containing protein [Streptomyces clavuligerus ATCC
           27064]
          Length = 119

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 43/75 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   + +I++YQ   S + G  CRY P+CS YGY AI R+G   G+ LT  R+++CNP 
Sbjct: 1   MKYPLLALIKLYQWTISPLLGPVCRYYPSCSHYGYTAIDRHGAVKGTVLTAWRILRCNPW 60

Query: 115 GSDGFDPVPDDLPPK 129
              G D VP    P+
Sbjct: 61  SPGGVDHVPPRRRPR 75


>gi|78048114|ref|YP_364289.1| hypothetical protein XCV2558 [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|116256209|sp|Q3BSH4|Y2558_XANC5 RecName: Full=UPF0161 protein XCV2558
 gi|78036544|emb|CAJ24235.1| conserved hypothetical protein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 97

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 45/73 (61%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
             +   + I ++R+Y+L+ S + G  CR+ P+CS+Y   AI R+G   GSWL   RL +C
Sbjct: 7   WQVISRLLIALLRVYKLVISPLLGPRCRFAPSCSDYAMTAIGRFGPLRGSWLAARRLGRC 66

Query: 112 NPLGSDGFDPVPD 124
           +P    GFDPVPD
Sbjct: 67  HPFHPGGFDPVPD 79


>gi|269214506|ref|ZP_05986709.2| putative toxin-antitoxin system, toxin component [Neisseria
           lactamica ATCC 23970]
 gi|269209661|gb|EEZ76116.1| putative toxin-antitoxin system, toxin component [Neisseria
           lactamica ATCC 23970]
          Length = 69

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 40/69 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              + + +IR YQ   S +    CRY PTCS+Y  EA+ +YG + G  L   R+ +C+PL
Sbjct: 1   MSKLLLVLIRFYQYCISPLIPPRCRYTPTCSQYAVEAVKKYGAFKGGLLAAKRIARCHPL 60

Query: 115 GSDGFDPVP 123
           G  G DPVP
Sbjct: 61  GGHGHDPVP 69


>gi|134297400|ref|YP_001121135.1| hypothetical protein Bcep1808_3311 [Burkholderia vietnamiensis G4]
 gi|166229105|sp|A4JJ47|Y3311_BURVG RecName: Full=UPF0161 protein Bcep1808_3311
 gi|134140557|gb|ABO56300.1| protein of unknown function DUF37 [Burkholderia vietnamiensis G4]
          Length = 88

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 24/76 (31%), Positives = 44/76 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I ++R Y++  S + G+ CR+ P+CS+Y  EAI  +G   G++L + R+ +C+P 
Sbjct: 1   MKTVLIALLRFYKVAVSPMLGDRCRFYPSCSDYAREAIQYHGAARGTYLAVRRVCRCHPF 60

Query: 115 GSDGFDPVPDDLPPKK 130
            + G D VP      +
Sbjct: 61  SAGGIDLVPPPNSDIR 76


>gi|113972268|ref|YP_736061.1| hypothetical protein Shewmr4_3941 [Shewanella sp. MR-4]
 gi|114049517|ref|YP_740067.1| hypothetical protein Shewmr7_4033 [Shewanella sp. MR-7]
 gi|117918466|ref|YP_867658.1| hypothetical protein Shewana3_0007 [Shewanella sp. ANA-3]
 gi|122943390|sp|Q0HD63|Y3941_SHESM RecName: Full=UPF0161 protein Shewmr4_3941
 gi|123030124|sp|Q0HPE5|Y4033_SHESR RecName: Full=UPF0161 protein Shewmr7_4033
 gi|166227755|sp|A0KR33|Y007_SHESA RecName: Full=UPF0161 protein Shewana3_0007
 gi|113886952|gb|ABI41004.1| protein of unknown function DUF37 [Shewanella sp. MR-4]
 gi|113890959|gb|ABI45010.1| protein of unknown function DUF37 [Shewanella sp. MR-7]
 gi|117610798|gb|ABK46252.1| protein of unknown function DUF37 [Shewanella sp. ANA-3]
          Length = 84

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 41/78 (52%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
               ++  + +    IR YQ+  S + G  CR+ PTCS Y  EAI  +G   G W  L R
Sbjct: 1   MAQTQSPLQWLATTFIRGYQIFISPLLGPRCRFNPTCSHYAIEAIKVHGTAKGCWFALKR 60

Query: 108 LIKCNPLGSDGFDPVPDD 125
           ++KC+PL   G DPVP  
Sbjct: 61  ILKCHPLHPGGSDPVPPK 78


>gi|118602999|ref|YP_904214.1| hypothetical protein Rmag_1039 [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
 gi|118567938|gb|ABL02743.1| protein of unknown function DUF37 [Candidatus Ruthia magnifica str.
           Cm (Calyptogena magnifica)]
          Length = 71

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 27/68 (39%), Positives = 42/68 (61%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
           + +  I+ Y+L  S + G++CR+ PTCS+Y Y+ I  +G + G  L+L R+ KC+     
Sbjct: 4   LLLMPIKFYRLFISPLLGSNCRFQPTCSQYAYDVIQTHGFFKGLGLSLKRISKCHSWHDG 63

Query: 118 GFDPVPDD 125
           GFDPVP  
Sbjct: 64  GFDPVPKK 71


>gi|170694072|ref|ZP_02885228.1| protein of unknown function DUF37 [Burkholderia graminis C4D1M]
 gi|307731537|ref|YP_003908761.1| hypothetical protein BC1003_3526 [Burkholderia sp. CCGE1003]
 gi|170141144|gb|EDT09316.1| protein of unknown function DUF37 [Burkholderia graminis C4D1M]
 gi|307586072|gb|ADN59470.1| protein of unknown function DUF37 [Burkholderia sp. CCGE1003]
          Length = 76

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 27/76 (35%), Positives = 44/76 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I ++R Y+L  S + GN CR+ P+CS+Y  EAI  +G   G++L   R+ +C+P 
Sbjct: 1   MQTVLIALLRFYKLAVSPMLGNRCRFYPSCSDYAREAIQYHGAARGTYLAARRICRCHPF 60

Query: 115 GSDGFDPVPDDLPPKK 130
            + G D VP     K+
Sbjct: 61  SAGGIDLVPPPTSEKR 76


>gi|315303483|ref|ZP_07874069.1| conserved hypothetical protein [Listeria ivanovii FSL F6-596]
 gi|313628147|gb|EFR96694.1| conserved hypothetical protein [Listeria ivanovii FSL F6-596]
          Length = 91

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 46/85 (54%), Gaps = 2/85 (2%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I IG IR+YQ   S     +CR+ PTCS YG EAI  +G   GS+L + R+ KC+P 
Sbjct: 1   MKKILIGGIRLYQKYISRFTPATCRFYPTCSAYGIEAIQTHGALKGSYLAVKRISKCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNNPKLLSKK 139
              G D VP      KN+    SK+
Sbjct: 61  HKGGLDFVPP--KKDKNDTDNKSKQ 83


>gi|206558828|ref|YP_002229588.1| hypothetical protein BCAL0425 [Burkholderia cenocepacia J2315]
 gi|226706152|sp|B4E7D4|Y424_BURCJ RecName: Full=UPF0161 protein BceJ2315_04240
 gi|198034865|emb|CAR50737.1| conserved hypothetical protein [Burkholderia cenocepacia J2315]
          Length = 88

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 25/76 (32%), Positives = 44/76 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I ++R Y++  S + GN CR+ P+CS+Y  EAI  +G   G++L + R+ +C+P 
Sbjct: 1   MKTVLIALLRFYKVAVSPMLGNRCRFYPSCSDYAREAIQYHGAARGTYLAVRRVCRCHPF 60

Query: 115 GSDGFDPVPDDLPPKK 130
            + G D VP      +
Sbjct: 61  SAGGIDLVPPPNSDTR 76


>gi|78067990|ref|YP_370759.1| hypothetical protein Bcep18194_A6521 [Burkholderia sp. 383]
 gi|115353267|ref|YP_775106.1| hypothetical protein Bamb_3216 [Burkholderia ambifaria AMMD]
 gi|170697751|ref|ZP_02888838.1| protein of unknown function DUF37 [Burkholderia ambifaria IOP40-10]
 gi|172062139|ref|YP_001809791.1| hypothetical protein BamMC406_3100 [Burkholderia ambifaria MC40-6]
 gi|116256259|sp|Q39BQ1|Y6521_BURS3 RecName: Full=UPF0161 protein Bcep18194_A6521
 gi|122321903|sp|Q0BAQ1|Y3216_BURCM RecName: Full=UPF0161 protein Bamb_3216
 gi|226703709|sp|B1YQJ8|Y3100_BURA4 RecName: Full=UPF0161 protein BamMC406_3100
 gi|77968735|gb|ABB10115.1| protein of unknown function DUF37 [Burkholderia sp. 383]
 gi|115283255|gb|ABI88772.1| protein of unknown function DUF37 [Burkholderia ambifaria AMMD]
 gi|170137366|gb|EDT05607.1| protein of unknown function DUF37 [Burkholderia ambifaria IOP40-10]
 gi|171994656|gb|ACB65575.1| protein of unknown function DUF37 [Burkholderia ambifaria MC40-6]
          Length = 88

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 25/73 (34%), Positives = 43/73 (58%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
           + I ++R Y++  S + GN CR+ P+CS+Y  EAI  +G   G++L + R+ +C+P  + 
Sbjct: 4   VLIALLRFYKVAVSPMLGNRCRFYPSCSDYAREAIQYHGAARGTYLAVRRVCRCHPFSAG 63

Query: 118 GFDPVPDDLPPKK 130
           G D VP      +
Sbjct: 64  GIDLVPPPNSDTR 76


>gi|264680933|ref|YP_003280843.1| hypothetical protein CtCNB1_4801 [Comamonas testosteroni CNB-2]
 gi|299530925|ref|ZP_07044339.1| hypothetical protein CTS44_09072 [Comamonas testosteroni S44]
 gi|262211449|gb|ACY35547.1| hypothetical conserved protein [Comamonas testosteroni CNB-2]
 gi|298721146|gb|EFI62089.1| hypothetical protein CTS44_09072 [Comamonas testosteroni S44]
          Length = 99

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 48/74 (64%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + + + ++R Y+L+ S   G++CR+ PTCS Y  +A+ ++G  +GS+LT+ RL +C+P
Sbjct: 1   MMQRLLMAVVRGYRLLLSPWLGSACRFEPTCSAYSLQALEQHGAAVGSYLTVRRLARCHP 60

Query: 114 LGSDGFDPVPDDLP 127
               G DPVP   P
Sbjct: 61  WCDGGHDPVPQQKP 74


>gi|28872712|ref|NP_795331.1| hypothetical protein PSPTO_5613 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213968444|ref|ZP_03396587.1| conserved hypothetical protein TIGR00278 [Pseudomonas syringae pv.
           tomato T1]
 gi|301384268|ref|ZP_07232686.1| hypothetical protein PsyrptM_16605 [Pseudomonas syringae pv. tomato
           Max13]
 gi|302063882|ref|ZP_07255423.1| hypothetical protein PsyrptK_28191 [Pseudomonas syringae pv. tomato
           K40]
 gi|302131965|ref|ZP_07257955.1| hypothetical protein PsyrptN_11274 [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|47606280|sp|Q87TS0|Y5613_PSESM RecName: Full=UPF0161 protein PSPTO_5613
 gi|28855968|gb|AAO59026.1| conserved hypothetical protein TIGR00278 [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213926732|gb|EEB60284.1| conserved hypothetical protein TIGR00278 [Pseudomonas syringae pv.
           tomato T1]
 gi|330876350|gb|EGH10499.1| hypothetical protein PSYMP_13749 [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330964184|gb|EGH64444.1| hypothetical protein PSYAC_05960 [Pseudomonas syringae pv.
           actinidiae str. M302091]
 gi|331017730|gb|EGH97786.1| hypothetical protein PLA106_16919 [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 81

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 28/69 (40%), Positives = 42/69 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R + +  I+ Y+   S +  + CR+ P+CS Y YEAI  +GL  G WL++ RL +C+P 
Sbjct: 1   MRKLALVPIQFYRYAISPLMASHCRFYPSCSCYAYEAIDNHGLLRGGWLSIRRLGRCHPW 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  NPGGYDPVP 69


>gi|84624187|ref|YP_451559.1| hypothetical protein XOO_2530 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|166712441|ref|ZP_02243648.1| hypothetical protein Xoryp_13565 [Xanthomonas oryzae pv. oryzicola
           BLS256]
 gi|116256206|sp|Q2P2E2|Y2530_XANOM RecName: Full=UPF0161 protein XOO2530
 gi|84368127|dbj|BAE69285.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
          Length = 95

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 32/73 (43%), Positives = 43/73 (58%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
             +   + I ++R Y+L  S + G  CR+ P+CSEY   AI R+G   GSWL   RL +C
Sbjct: 7   WQVISRLLIALLRFYKLFISPLLGPRCRFAPSCSEYAMTAIGRFGPLRGSWLAARRLGRC 66

Query: 112 NPLGSDGFDPVPD 124
           +P    GFDPVPD
Sbjct: 67  HPFHPGGFDPVPD 79


>gi|21243093|ref|NP_642675.1| hypothetical protein XAC2359 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|25009629|sp|Q8PK18|Y2359_XANAC RecName: Full=UPF0161 protein XAC2359
 gi|21108609|gb|AAM37211.1| alpha-hemolysin [Xanthomonas axonopodis pv. citri str. 306]
          Length = 95

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 46/77 (59%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
             +   +   + I ++R+Y+L+ S + G  CR+ P+CS+Y   AI R+G   GSWL   R
Sbjct: 1   MAYHWQVISRLLIALLRVYKLVISPLLGPRCRFAPSCSDYAMTAIGRFGPLRGSWLAARR 60

Query: 108 LIKCNPLGSDGFDPVPD 124
           L +C+P    GFDPVPD
Sbjct: 61  LGRCHPFHPGGFDPVPD 77


>gi|225867943|ref|YP_002743891.1| hypothetical protein SZO_03330 [Streptococcus equi subsp.
           zooepidemicus]
 gi|225701219|emb|CAW98158.1| conserved hypothetical protein [Streptococcus equi subsp.
           zooepidemicus]
          Length = 92

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + + I  +R YQ   S +F  SCRY PTCS Y   AI ++G   G  + L RL++C+P
Sbjct: 1   MIKALLIAPVRAYQKYISPLFPPSCRYQPTCSAYMITAIEKHGA-KGVLMGLARLLRCHP 59

Query: 114 LGSDGFDPVPDDLPPKKN 131
             + G DPVPD    K++
Sbjct: 60  FAAGGEDPVPDTFSLKRH 77


>gi|315607060|ref|ZP_07882064.1| alpha-hemolysin [Prevotella buccae ATCC 33574]
 gi|315251114|gb|EFU31099.1| alpha-hemolysin [Prevotella buccae ATCC 33574]
          Length = 79

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 30/72 (41%), Positives = 43/72 (59%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           +     + I  IR YQL  S +   SCR+ PTCSEY  +A+ ++G   G  L + R+++C
Sbjct: 8   RKAIVWLLILPIRFYQLAISPLTPPSCRFTPTCSEYARQALIKHGPVKGLLLAVWRVLRC 67

Query: 112 NPLGSDGFDPVP 123
           NP G  G+DPVP
Sbjct: 68  NPWGGSGYDPVP 79


>gi|313887223|ref|ZP_07820918.1| conserved hypothetical protein [Porphyromonas asaccharolytica
           PR426713P-I]
 gi|312923314|gb|EFR34128.1| conserved hypothetical protein [Porphyromonas asaccharolytica
           PR426713P-I]
          Length = 252

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 31/104 (29%), Positives = 51/104 (49%), Gaps = 3/104 (2%)

Query: 21  SSYALPIQKKGSPLLLKNNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRY 80
           S  A     +       +    +++ + +   +L   +    ++ Y+   S +   SCR+
Sbjct: 148 SPEAETSTSRQEQTAKVSAKQATQDDSQQL--SLAVRLLSYPVKFYRHFISPLLPPSCRF 205

Query: 81  LPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD-GFDPVP 123
            PTCS+Y  EA+  +G   GS LTL RL++CNP     G+DPVP
Sbjct: 206 TPTCSQYALEALRVHGALKGSCLTLWRLLRCNPFNPHVGYDPVP 249


>gi|320009747|gb|ADW04597.1| protein of unknown function DUF37 [Streptomyces flavogriseus ATCC
           33331]
          Length = 119

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 43/75 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   + +I++YQ   S + G  CRY P+CS YGY AI R+G   G+ LT  R+++CNP 
Sbjct: 1   MKYPLLALIKLYQWTISPLLGPVCRYYPSCSHYGYTAIDRHGAIKGTALTAWRILRCNPW 60

Query: 115 GSDGFDPVPDDLPPK 129
              G D VP    P+
Sbjct: 61  SPGGVDYVPPRKRPR 75


>gi|257884026|ref|ZP_05663679.1| conserved hypothetical protein [Enterococcus faecium 1,231,501]
 gi|257819864|gb|EEV47012.1| conserved hypothetical protein [Enterococcus faecium 1,231,501]
          Length = 99

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 41/80 (51%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + I I ++R YQ   S  F  SCRY PTCS Y  +AI  +G   G+ +   R+++C+P
Sbjct: 1   MMKKILIYLVRGYQRFISPAFPPSCRYYPTCSNYMIKAIQTHGALKGTVMGTARILRCHP 60

Query: 114 LGSDGFDPVPDDLPPKKNNP 133
               G D VP      +N  
Sbjct: 61  FVKGGIDYVPLTFQLTRNKK 80


>gi|149024997|ref|ZP_01836377.1| hypothetical protein CGSSp23BS72_10013 [Streptococcus pneumoniae
           SP23-BS72]
 gi|225859635|ref|YP_002741145.1| hypothetical protein SP70585_1928 [Streptococcus pneumoniae 70585]
 gi|254800661|sp|C1C9D9|Y1928_STRP7 RecName: Full=UPF0161 protein SP70585_1928
 gi|147929490|gb|EDK80485.1| hypothetical protein CGSSp23BS72_10013 [Streptococcus pneumoniae
           SP23-BS72]
 gi|225721001|gb|ACO16855.1| conserved hypothetical protein [Streptococcus pneumoniae 70585]
          Length = 80

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 44/77 (57%), Gaps = 1/77 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I  +R YQ   S VF  SCR+  TCS Y  +AI ++G + G  + L R+++C+P 
Sbjct: 1   MKRILIAPVRFYQRFISPVFPPSCRFDLTCSNYMIQAIEKHG-FKGVLMGLARILRCHPW 59

Query: 115 GSDGFDPVPDDLPPKKN 131
              G DPVPD    K+N
Sbjct: 60  SKTGKDPVPDHFSLKRN 76


>gi|146309634|ref|YP_001190099.1| hypothetical protein Pmen_4621 [Pseudomonas mendocina ymp]
 gi|145577835|gb|ABP87367.1| protein of unknown function DUF37 [Pseudomonas mendocina ymp]
          Length = 81

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 41/75 (54%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R   +  I++Y+   S +  + CR+ P+CS Y YEAI ++G   G WL   RL +C+P 
Sbjct: 1   MRKAALACIQVYRYAISPLMASHCRFYPSCSCYAYEAIEQHGFLRGGWLAARRLGRCHPW 60

Query: 115 GSDGFDPVPDDLPPK 129
              G+DPVP     +
Sbjct: 61  NPGGYDPVPPAKTSR 75


>gi|189501467|ref|YP_001960937.1| hypothetical protein Cphamn1_2562 [Chlorobium phaeobacteroides BS1]
 gi|189496908|gb|ACE05456.1| protein of unknown function DUF37 [Chlorobium phaeobacteroides BS1]
          Length = 92

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 29/83 (34%), Positives = 46/83 (55%), Gaps = 2/83 (2%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
             +   + I +I +Y+   S + G SCR+ PTCS+Y  +A   +  +   WLT+ R+++C
Sbjct: 7   WKIINRVPIFLISVYRSYISPLLGPSCRFYPTCSQYALDAFTTHNFFYAMWLTVWRVLRC 66

Query: 112 NPLGSDGFDPVPDDLPPKKNNPK 134
           NP    G+DP+P     KK N K
Sbjct: 67  NPFSKGGYDPIPPV--GKKLNSK 87


>gi|107024095|ref|YP_622422.1| hypothetical protein Bcen_2550 [Burkholderia cenocepacia AU 1054]
 gi|116691181|ref|YP_836804.1| hypothetical protein Bcen2424_3164 [Burkholderia cenocepacia
           HI2424]
 gi|170734514|ref|YP_001766461.1| hypothetical protein Bcenmc03_3182 [Burkholderia cenocepacia MC0-3]
 gi|116256208|sp|Q1BSF6|Y2550_BURCA RecName: Full=UPF0161 protein Bcen_2550
 gi|166229397|sp|A0KBN4|Y3164_BURCH RecName: Full=UPF0161 protein Bcen2424_3164
 gi|226703735|sp|B1K0Y5|Y3182_BURCC RecName: Full=UPF0161 protein Bcenmc03_3182
 gi|105894284|gb|ABF77449.1| protein of unknown function DUF37 [Burkholderia cenocepacia AU
           1054]
 gi|116649270|gb|ABK09911.1| protein of unknown function DUF37 [Burkholderia cenocepacia HI2424]
 gi|169817756|gb|ACA92339.1| protein of unknown function DUF37 [Burkholderia cenocepacia MC0-3]
          Length = 88

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 25/76 (32%), Positives = 44/76 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I ++R Y++  S + GN CR+ P+CS+Y  EAI  +G   G++L + R+ +C+P 
Sbjct: 1   MKTVLIALLRFYKVAVSPMLGNRCRFYPSCSDYAREAIQYHGAARGTYLAVRRVCRCHPF 60

Query: 115 GSDGFDPVPDDLPPKK 130
            + G D VP      +
Sbjct: 61  SAGGVDLVPPPNSDTR 76


>gi|308273508|emb|CBX30110.1| UPF0161 protein pc1368 [uncultured Desulfobacterium sp.]
          Length = 76

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 27/72 (37%), Positives = 42/72 (58%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + I +  IR YQ++ S   G  CR+ P+CSEY + AI ++GL  G +L   R+++C+P
Sbjct: 2   IIKNIVLYFIRFYQIVISPFIGPVCRFYPSCSEYAFIAINQHGLIKGIFLAFKRILRCHP 61

Query: 114 LGSDGFDPVPDD 125
               G D VP  
Sbjct: 62  FNPGGIDQVPKK 73


>gi|219850007|ref|YP_002464440.1| hypothetical protein Cagg_3146 [Chloroflexus aggregans DSM 9485]
 gi|254801616|sp|B8G7G9|Y3146_CHLAD RecName: Full=UPF0161 protein Cagg_3146
 gi|219544266|gb|ACL26004.1| protein of unknown function DUF37 [Chloroflexus aggregans DSM 9485]
          Length = 70

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 32/70 (45%), Positives = 44/70 (62%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + R + + +IR YQ+  S     SC Y PTCS YGYEAI +YG   G W+T+ R+ +C+P
Sbjct: 1   MLRWLLLKLIRFYQVAISPWTPPSCIYTPTCSHYGYEAIQKYGALRGGWMTIKRIARCHP 60

Query: 114 LGSDGFDPVP 123
               G+DPVP
Sbjct: 61  FARGGYDPVP 70


>gi|258406260|ref|YP_003199002.1| hypothetical protein Dret_2140 [Desulfohalobium retbaense DSM 5692]
 gi|257798487|gb|ACV69424.1| protein of unknown function DUF37 [Desulfohalobium retbaense DSM
           5692]
          Length = 79

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 44/79 (55%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R + + ++R YQ+  S +F   CR+ PTCSEY  +A+  +G W G +L + R+ +C+P 
Sbjct: 1   MRNVIVFLVRAYQVCVSPLFPPRCRFFPTCSEYTIQAVQEHGFWRGGYLAVRRISRCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNNP 133
              G DPVP       ++ 
Sbjct: 61  HCGGVDPVPPKKSLSPDSK 79


>gi|268319734|ref|YP_003293390.1| hypothetical protein FI9785_1263 [Lactobacillus johnsonii FI9785]
 gi|262398109|emb|CAX67123.1| hypothetical protein predicted by Glimmer/Critica [Lactobacillus
           johnsonii FI9785]
          Length = 97

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 44/78 (56%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              + I ++ +Y+   S +   +CRY PTCS Y  +A+ ++G  +G  + L R+++CNP 
Sbjct: 1   MNKLLIRLVNVYKKFISPILPPTCRYYPTCSSYMIDALKKHGAILGLIMGLARILRCNPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G DPVPD    ++N 
Sbjct: 61  IKGGVDPVPDYFTLRRNP 78


>gi|222112702|ref|YP_002554966.1| hypothetical protein Dtpsy_3543 [Acidovorax ebreus TPSY]
 gi|221732146|gb|ACM34966.1| protein of unknown function DUF37 [Acidovorax ebreus TPSY]
          Length = 98

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 31/74 (41%), Positives = 50/74 (67%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + R + +G++R Y+L+ S   G++CR+ PTCS Y  +A+ ++G   GS+LT+ RL +C+P
Sbjct: 1   MMRALLMGLVRGYRLLLSPWIGSACRFEPTCSVYSLQALEQHGAAAGSYLTVCRLARCHP 60

Query: 114 LGSDGFDPVPDDLP 127
               G DPVP +LP
Sbjct: 61  WCEGGLDPVPQELP 74


>gi|319765066|ref|YP_004129003.1| hypothetical protein Alide_4420 [Alicycliphilus denitrificans BC]
 gi|330827258|ref|YP_004390561.1| hypothetical protein Alide2_4747 [Alicycliphilus denitrificans
           K601]
 gi|317119627|gb|ADV02116.1| protein of unknown function DUF37 [Alicycliphilus denitrificans BC]
 gi|329312630|gb|AEB87045.1| protein of unknown function DUF37 [Alicycliphilus denitrificans
           K601]
          Length = 97

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 30/74 (40%), Positives = 48/74 (64%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + R + + ++R Y+L+ S   G++CR+ PTCS Y  +A+ ++G   GS+LT+ RL +C+P
Sbjct: 1   MMRALLMALVRGYRLLLSPWIGSACRFEPTCSLYSLQALEKHGAAAGSYLTVRRLARCHP 60

Query: 114 LGSDGFDPVPDDLP 127
               G DPVP  LP
Sbjct: 61  WCEGGHDPVPQQLP 74


>gi|288928868|ref|ZP_06422714.1| putative toxin-antitoxin system, toxin component [Prevotella sp.
           oral taxon 317 str. F0108]
 gi|288329852|gb|EFC68437.1| putative toxin-antitoxin system, toxin component [Prevotella sp.
           oral taxon 317 str. F0108]
          Length = 83

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 44/75 (58%)

Query: 49  KFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRL 108
              + +   + +  IR YQL  S     SCR+ P+CSEY  +AI ++G + G  L + R+
Sbjct: 9   GLFRRVAVWLLLLPIRFYQLAISPYTPPSCRFTPSCSEYARQAIIKHGPFKGLALAVWRV 68

Query: 109 IKCNPLGSDGFDPVP 123
           ++CNP G  G+DPVP
Sbjct: 69  LRCNPWGGSGYDPVP 83


>gi|91785812|ref|YP_561018.1| hypothetical protein Bxe_A4465 [Burkholderia xenovorans LB400]
 gi|187925955|ref|YP_001897597.1| hypothetical protein Bphyt_3987 [Burkholderia phytofirmans PsJN]
 gi|116256264|sp|Q13SH3|Y8C8_BURXL RecName: Full=UPF0161 protein Bxeno_A4428
 gi|226706092|sp|B2T7U2|Y3987_BURPP RecName: Full=UPF0161 protein Bphyt_3987
 gi|91689766|gb|ABE32966.1| Protein of unknown function DUF37 [Burkholderia xenovorans LB400]
 gi|187717149|gb|ACD18373.1| protein of unknown function DUF37 [Burkholderia phytofirmans PsJN]
          Length = 76

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 26/76 (34%), Positives = 44/76 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I ++R Y++  S + GN CR+ P+CS+Y  EAI  +G   G++L   R+ +C+P 
Sbjct: 1   MQTVLIALLRFYKVAVSPMLGNRCRFYPSCSDYAREAIQYHGAARGTYLAARRICRCHPF 60

Query: 115 GSDGFDPVPDDLPPKK 130
            + G D VP     K+
Sbjct: 61  SAGGIDLVPPPTSEKR 76


>gi|328883705|emb|CCA56944.1| Protein YidD [Streptomyces venezuelae ATCC 10712]
          Length = 108

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 43/75 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   + +I++YQ   S + G  CRY P+CS YG+ AI R+G   G+ LT  R+++CNP 
Sbjct: 1   MKYPLLALIKLYQWTISPLLGPVCRYYPSCSHYGFTAIDRHGAIKGTALTAWRILRCNPW 60

Query: 115 GSDGFDPVPDDLPPK 129
              G D VP    P+
Sbjct: 61  SPGGVDHVPPRKRPR 75


>gi|53711357|ref|YP_097349.1| hypothetical protein BF0066 [Bacteroides fragilis YCH46]
 gi|60679673|ref|YP_209817.1| hypothetical protein BF0077 [Bacteroides fragilis NCTC 9343]
 gi|253564537|ref|ZP_04841994.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
 gi|255010300|ref|ZP_05282426.1| hypothetical protein Bfra3_14262 [Bacteroides fragilis 3_1_12]
 gi|265764802|ref|ZP_06093077.1| UPF0161 protein [Bacteroides sp. 2_1_16]
 gi|313148099|ref|ZP_07810292.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
 gi|81317253|sp|Q5LJ21|Y077_BACFN RecName: Full=UPF0161 protein BF0077
 gi|81384007|sp|Q650K9|Y066_BACFR RecName: Full=UPF0161 protein BF0066
 gi|52214222|dbj|BAD46815.1| conserved hypothetical protein [Bacteroides fragilis YCH46]
 gi|60491107|emb|CAH05855.1| conserved hypothetical protein [Bacteroides fragilis NCTC 9343]
 gi|251948313|gb|EES88595.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
 gi|263254186|gb|EEZ25620.1| UPF0161 protein [Bacteroides sp. 2_1_16]
 gi|301161138|emb|CBW20676.1| conserved hypothetical protein [Bacteroides fragilis 638R]
 gi|313136866|gb|EFR54226.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
          Length = 73

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 29/73 (39%), Positives = 44/73 (60%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            K L   I +  I  Y+   S +   SCR+ PTCS+Y  EAI ++G + G +L + R+++
Sbjct: 1   MKRLLSYILLLPIYFYRACISPMTPPSCRFTPTCSQYAIEAIKKHGPFKGLYLAVRRILR 60

Query: 111 CNPLGSDGFDPVP 123
           C+P G  G+DPVP
Sbjct: 61  CHPWGGSGYDPVP 73


>gi|259048116|ref|ZP_05738517.1| toxin-antitoxin system, toxin component [Granulicatella adiacens
           ATCC 49175]
 gi|259035177|gb|EEW36432.1| toxin-antitoxin system, toxin component [Granulicatella adiacens
           ATCC 49175]
          Length = 94

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 42/78 (53%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I ++R YQ   S +F  SC Y PTCS Y  +A+ ++G   G  +   R+ +C+P 
Sbjct: 1   MKKIMIALVRGYQKWISPLFPPSCIYRPTCSSYTIQAVEKHGALKGVLMGCGRICRCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G DPVPD    ++N 
Sbjct: 61  IRGGQDPVPDYFTLRRNK 78


>gi|294507030|ref|YP_003571088.1| hypothetical protein SRM_01215 [Salinibacter ruber M8]
 gi|294343358|emb|CBH24136.1| conserved hypothetical protein [Salinibacter ruber M8]
          Length = 106

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 35/84 (41%), Positives = 48/84 (57%)

Query: 38  NNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGL 97
           NN   S          L RL+ IG++R+YQL+ S   G +CR+ PTCS Y  +A   YG 
Sbjct: 2   NNLSFSMRRALSLLARLPRLLLIGLVRLYQLVLSPHLGRTCRFHPTCSAYAIQAFREYGA 61

Query: 98  WIGSWLTLLRLIKCNPLGSDGFDP 121
             G  LT+ RL++C+P G  G+DP
Sbjct: 62  LKGLVLTVHRLLRCHPWGGHGYDP 85


>gi|330505870|ref|YP_004382739.1| hypothetical protein MDS_4956 [Pseudomonas mendocina NK-01]
 gi|328920156|gb|AEB60987.1| hypothetical protein MDS_4956 [Pseudomonas mendocina NK-01]
          Length = 81

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 42/75 (56%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R   +  I++Y+   S +  + CR+ P+CS Y YEAI ++G   G WL   RL +C+P 
Sbjct: 1   MRKAALACIQVYRYAISPLMASHCRFYPSCSCYAYEAIEQHGFLRGGWLAARRLGRCHPW 60

Query: 115 GSDGFDPVPDDLPPK 129
            + GFDPVP     +
Sbjct: 61  NAGGFDPVPPVKTSR 75


>gi|319949434|ref|ZP_08023495.1| hypothetical protein ES5_08336 [Dietzia cinnamea P4]
 gi|319436896|gb|EFV91955.1| hypothetical protein ES5_08336 [Dietzia cinnamea P4]
          Length = 89

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 43/72 (59%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            I + ++  YQ   S +   SCR+ PTCS Y  EA+  +G W G+WL++ RL++C P   
Sbjct: 3   RILLWMLDFYQKGISPLTPPSCRFEPTCSAYAVEAVRVHGAWYGTWLSVWRLLRCGPWTP 62

Query: 117 DGFDPVPDDLPP 128
            G+DPVP+   P
Sbjct: 63  GGWDPVPEPRAP 74


>gi|281421501|ref|ZP_06252500.1| putative toxin-antitoxin system, toxin component [Prevotella copri
           DSM 18205]
 gi|281404573|gb|EFB35253.1| putative toxin-antitoxin system, toxin component [Prevotella copri
           DSM 18205]
          Length = 84

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 29/73 (39%), Positives = 42/73 (57%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            + +   I I  I  YQ   +     SCR+ PTCSEY  +AI ++G + G  L + R+++
Sbjct: 12  MRKVLVWILILPILFYQKCITPYTPPSCRFQPTCSEYARQAILKHGPFKGLALAVWRILR 71

Query: 111 CNPLGSDGFDPVP 123
           CNP G  G+DPVP
Sbjct: 72  CNPWGGSGYDPVP 84


>gi|94263632|ref|ZP_01287441.1| Protein of unknown function DUF37 [delta proteobacterium MLMS-1]
 gi|93455937|gb|EAT06092.1| Protein of unknown function DUF37 [delta proteobacterium MLMS-1]
          Length = 89

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 32/71 (45%), Positives = 46/71 (64%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           ++ +  G+ +IR YQL  S +F  SCR++P+CSEY  EAI  +G W G WL   R+++C+
Sbjct: 19  SIMQRCGLALIRFYQLFISPLFPPSCRFVPSCSEYAREAIVSHGCWRGGWLATKRILRCH 78

Query: 113 PLGSDGFDPVP 123
           P    GFDPV 
Sbjct: 79  PFCRGGFDPVK 89


>gi|308179188|ref|YP_003918594.1| hypothetical protein AARI_34340 [Arthrobacter arilaitensis Re117]
 gi|307746651|emb|CBT77623.1| hypothetical protein AARI_34340 [Arthrobacter arilaitensis Re117]
          Length = 125

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 29/71 (40%), Positives = 48/71 (67%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + R I IG+++ Y+ + S ++G+ CRY P+CS YG EA+ ++G+  G+ LT  R+++CNP
Sbjct: 18  IPRNIVIGLLKAYRKLISPLYGDVCRYFPSCSAYGLEAVTQHGVVKGAGLTTWRILRCNP 77

Query: 114 LGSDGFDPVPD 124
               G D VP+
Sbjct: 78  WSDGGVDHVPE 88


>gi|294675905|ref|YP_003576520.1| hypothetical protein RCAP_rcc00348 [Rhodobacter capsulatus SB 1003]
 gi|294474725|gb|ADE84113.1| protein of unknown function DUF37 [Rhodobacter capsulatus SB 1003]
          Length = 89

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 30/65 (46%), Positives = 39/65 (60%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           +R Y+L+ S   G+ CRY PTCS Y  EA+ R+G   G WL   R+  C+P G  G+DPV
Sbjct: 12  VRGYRLLLSPWVGHGCRYQPTCSAYAMEALERHGAVKGGWLAAKRVASCHPWGGHGYDPV 71

Query: 123 PDDLP 127
           P   P
Sbjct: 72  PGADP 76


>gi|229586619|ref|YP_002845120.1| hypothetical protein RAF_ORF0447 [Rickettsia africae ESF-5]
 gi|259647050|sp|C3PN67|Y447_RICAE RecName: Full=UPF0161 protein RAF_ORF0447
 gi|228021669|gb|ACP53377.1| Unknown [Rickettsia africae ESF-5]
          Length = 82

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 48/85 (56%), Gaps = 4/85 (4%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              I + ++  YQ   S + GN+CR+ PTCSEY  EAI+ +G   G W T  R+IKC P 
Sbjct: 1   MTRILLLLLGFYQYFISPLLGNNCRFHPTCSEYAKEAISMHGSIKGLWFTFKRIIKCQPF 60

Query: 115 GSDGFDPVPDDLPPKKNNPKLLSKK 139
            + G+D VP  +     N K L+KK
Sbjct: 61  CNGGYDTVPISIK----NSKPLNKK 81


>gi|293364212|ref|ZP_06610938.1| alpha-hemolysin [Streptococcus oralis ATCC 35037]
 gi|291317058|gb|EFE57485.1| alpha-hemolysin [Streptococcus oralis ATCC 35037]
          Length = 80

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I  +R YQ   S  F  SCR+ PTCS Y  +AI ++G + G  + L R+ +C+P 
Sbjct: 1   MKRILIAPVRFYQRFISPAFPPSCRFEPTCSNYMIQAIEKHG-FKGVLMGLARIFRCHPW 59

Query: 115 GSDGFDPVPDDLPPKKNNPK 134
              G DPVPD    ++N  K
Sbjct: 60  SPIGKDPVPDHFSLRRNQEK 79


>gi|312797630|ref|YP_004030552.1| hypothetical protein RBRH_00967 [Burkholderia rhizoxinica HKI 454]
 gi|312169405|emb|CBW76408.1| Hypothetical cytosolic protein [Burkholderia rhizoxinica HKI 454]
          Length = 90

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 26/69 (37%), Positives = 43/69 (62%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I ++R Y+L  S   G+ CR+ P+CS+Y  EA+  +G   G++L + RL +C+P 
Sbjct: 15  MQTVLIALLRFYKLAVSPYLGDRCRFYPSCSDYAREAVQYHGAAHGTYLAVKRLCRCHPF 74

Query: 115 GSDGFDPVP 123
            + G DPVP
Sbjct: 75  SAGGVDPVP 83


>gi|332702557|ref|ZP_08422645.1| UPF0161 protein yidD [Desulfovibrio africanus str. Walvis Bay]
 gi|332552706|gb|EGJ49750.1| UPF0161 protein yidD [Desulfovibrio africanus str. Walvis Bay]
          Length = 88

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 32/72 (44%), Positives = 45/72 (62%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R + + +IR+YQL  S +    CR+ PTCS Y  EAI R+G   G  LTL R+++C+P 
Sbjct: 1   MRTLFLLLIRLYQLAVSPLLPACCRFTPTCSAYAAEAITRFGALRGGLLTLWRILRCHPF 60

Query: 115 GSDGFDPVPDDL 126
            + GFDPVP+  
Sbjct: 61  AAGGFDPVPETF 72


>gi|184202001|ref|YP_001856208.1| hypothetical protein KRH_23550 [Kocuria rhizophila DC2201]
 gi|183582231|dbj|BAG30702.1| hypothetical protein [Kocuria rhizophila DC2201]
          Length = 140

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 30/95 (31%), Positives = 51/95 (53%), Gaps = 3/95 (3%)

Query: 32  SPLLLKNNTPKSRNWNGKFP---KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYG 88
           +P  L    P   + +G      K   + + I ++++Y+ I S ++G+ CRY P+CS Y 
Sbjct: 2   TPEQLLARAPHEYDTSGGLLSAVKKAPQNLCIALLKLYRTIVSPLYGDVCRYFPSCSAYA 61

Query: 89  YEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVP 123
            EA   +G   G  L++ RL++C+P  + G D VP
Sbjct: 62  LEAFTVHGAVRGLGLSVRRLLRCHPWAAGGIDRVP 96


>gi|163845993|ref|YP_001634037.1| hypothetical protein Caur_0398 [Chloroflexus aurantiacus J-10-fl]
 gi|222523718|ref|YP_002568188.1| hypothetical protein Chy400_0424 [Chloroflexus sp. Y-400-fl]
 gi|226706094|sp|A9WDP2|Y398_CHLAA RecName: Full=UPF0161 protein Caur_0398
 gi|254803890|sp|B9LIC8|Y424_CHLSY RecName: Full=UPF0161 protein Chy400_0424
 gi|163667282|gb|ABY33648.1| protein of unknown function DUF37 [Chloroflexus aurantiacus
           J-10-fl]
 gi|222447597|gb|ACM51863.1| protein of unknown function DUF37 [Chloroflexus sp. Y-400-fl]
          Length = 70

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 32/70 (45%), Positives = 44/70 (62%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + R + + +IR YQ+  S     SC Y PTCS YGYEAI +YG   G W+T+ R+ +C+P
Sbjct: 1   MLRWLLLKLIRFYQVAISPWTPPSCIYTPTCSHYGYEAIKKYGALRGGWMTVKRIARCHP 60

Query: 114 LGSDGFDPVP 123
               G+DPVP
Sbjct: 61  FARGGYDPVP 70


>gi|292492287|ref|YP_003527726.1| hypothetical protein Nhal_2248 [Nitrosococcus halophilus Nc4]
 gi|291580882|gb|ADE15339.1| protein of unknown function DUF37 [Nitrosococcus halophilus Nc4]
          Length = 78

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I + +I +Y+   S + GN CRY P+CS Y  EAI  YG   GSWL L RL++C+P 
Sbjct: 1   MKTILLSLIAVYRYGISPLMGNHCRYYPSCSAYTQEAIQCYGGVRGSWLGLKRLLRCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNNP 133
              G DPVPD +P  ++ P
Sbjct: 61  HPGGVDPVPD-IPQWRSKP 78


>gi|289435003|ref|YP_003464875.1| hypothetical protein lse_1638 [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289171247|emb|CBH27789.1| conserved hypothetical protein [Listeria seeligeri serovar 1/2b
           str. SLCC3954]
 gi|313632945|gb|EFR99877.1| conserved hypothetical protein [Listeria seeligeri FSL N1-067]
          Length = 91

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 34/82 (41%), Positives = 44/82 (53%), Gaps = 2/82 (2%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I IG IR+YQ   S     +CR+ PTCS YG EAI  +G   GS+L + R+ KC+P 
Sbjct: 1   MKKILIGGIRLYQKYISRFTPATCRFYPTCSAYGIEAIQTHGALKGSYLAIKRISKCHPF 60

Query: 115 GSDGFDPVPDDLPPK--KNNPK 134
              G D VP     +  KN  K
Sbjct: 61  HKGGLDFVPPKEDKEDGKNKSK 82


>gi|221069750|ref|ZP_03545855.1| protein of unknown function DUF37 [Comamonas testosteroni KF-1]
 gi|220714773|gb|EED70141.1| protein of unknown function DUF37 [Comamonas testosteroni KF-1]
          Length = 99

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 48/74 (64%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + + + ++R Y+L+ S   G++CR+ PTCS Y  +A+ ++G  +GS+LT+ RL +C+P
Sbjct: 1   MMQRLLMAVVRGYRLLLSPWLGSACRFEPTCSAYSLQALEQHGAAVGSYLTVRRLARCHP 60

Query: 114 LGSDGFDPVPDDLP 127
               G DPVP   P
Sbjct: 61  WCDGGHDPVPQQKP 74


>gi|257890383|ref|ZP_05670036.1| conserved hypothetical protein [Enterococcus faecium 1,231,410]
 gi|257892991|ref|ZP_05672644.1| conserved hypothetical protein [Enterococcus faecium 1,231,408]
 gi|260559622|ref|ZP_05831802.1| conserved hypothetical protein [Enterococcus faecium C68]
 gi|257826743|gb|EEV53369.1| conserved hypothetical protein [Enterococcus faecium 1,231,410]
 gi|257829370|gb|EEV55977.1| conserved hypothetical protein [Enterococcus faecium 1,231,408]
 gi|260074290|gb|EEW62612.1| conserved hypothetical protein [Enterococcus faecium C68]
          Length = 99

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 41/80 (51%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + I I ++R YQ   S  F  SCRY PTCS Y  +AI  +G   G+ +   R+++C+P
Sbjct: 1   MMKKILIYLVRGYQRFISPAFPPSCRYYPTCSNYMIKAIQTHGALKGTVMGTARILRCHP 60

Query: 114 LGSDGFDPVPDDLPPKKNNP 133
               G D VP      +N  
Sbjct: 61  FVKGGIDYVPLTFQLTRNKK 80


>gi|319796644|ref|YP_004158284.1| hypothetical protein Varpa_6021 [Variovorax paradoxus EPS]
 gi|315599107|gb|ADU40173.1| protein of unknown function DUF37 [Variovorax paradoxus EPS]
          Length = 95

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 46/78 (58%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + IG+++ Y+L+ S   G SCR+ PTCS Y  EA+  +G   GS+LTL R+ +C P 
Sbjct: 1   MKRLLIGLVKGYRLLLSPWLGQSCRFTPTCSVYSIEALEVHGALKGSYLTLHRIARCQPW 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G DPVP   P + + 
Sbjct: 61  CQGGHDPVPPKSPCRTDK 78


>gi|313637562|gb|EFS02973.1| conserved hypothetical protein [Listeria seeligeri FSL S4-171]
          Length = 91

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 34/82 (41%), Positives = 44/82 (53%), Gaps = 2/82 (2%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I IG IR+YQ   S     +CR+ PTCS YG EAI  +G   GS+L + R+ KC+P 
Sbjct: 1   MKKILIGGIRLYQKYISRFTPATCRFYPTCSAYGIEAIQTHGALKGSYLAIKRISKCHPF 60

Query: 115 GSDGFDPVPDDLPPK--KNNPK 134
              G D VP     +  KN  K
Sbjct: 61  HKGGLDFVPPKEDKEDGKNKAK 82


>gi|269122722|ref|YP_003310899.1| hypothetical protein Sterm_4136 [Sebaldella termitidis ATCC 33386]
 gi|268616600|gb|ACZ10968.1| protein of unknown function DUF37 [Sebaldella termitidis ATCC
           33386]
          Length = 69

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 41/67 (61%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R I I +I+ YQ   S   G  CR+ PTCSEY  +A+ +YG   G +L L+R++KC+P 
Sbjct: 1   MRKIFIFLIKFYQKAISPFLGRRCRFYPTCSEYTKQAVEKYGALKGLYLGLIRILKCHPF 60

Query: 115 GSDGFDP 121
              G+DP
Sbjct: 61  HKGGYDP 67


>gi|295678215|ref|YP_003606739.1| protein of unknown function DUF37 [Burkholderia sp. CCGE1002]
 gi|295438058|gb|ADG17228.1| protein of unknown function DUF37 [Burkholderia sp. CCGE1002]
          Length = 76

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 26/76 (34%), Positives = 45/76 (59%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + + ++R Y+L  S + GN CR+ P+CS+Y  EAI  +G   G++L + R+ +C+P 
Sbjct: 1   MQTVLLALLRFYKLAVSPMLGNRCRFYPSCSDYAREAIQYHGAARGTYLAVRRVCRCHPF 60

Query: 115 GSDGFDPVPDDLPPKK 130
            + G D VP     K+
Sbjct: 61  SAGGIDLVPPPTSEKR 76


>gi|269216521|ref|ZP_06160375.1| YidD family protein [Slackia exigua ATCC 700122]
 gi|269130050|gb|EEZ61132.1| YidD family protein [Slackia exigua ATCC 700122]
          Length = 96

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 49/85 (57%), Gaps = 7/85 (8%)

Query: 48  GKFPKTLGRLI-------GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIG 100
               +TL R I        + +I  Y+   S +F + CR+ PTCSEYG  AI R+G   G
Sbjct: 1   MGVYQTLLRYIKGIPAQGALFLITFYRAAISPLFPSCCRFTPTCSEYGLTAIRRFGFLKG 60

Query: 101 SWLTLLRLIKCNPLGSDGFDPVPDD 125
           S LTL R+ +C+PL + G+DPVP+ 
Sbjct: 61  SLLTLKRISRCHPLHAGGYDPVPEK 85


>gi|332296666|ref|YP_004438589.1| UPF0161 protein yidD [Thermodesulfobium narugense DSM 14796]
 gi|332179769|gb|AEE15458.1| UPF0161 protein yidD [Thermodesulfobium narugense DSM 14796]
          Length = 84

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 30/68 (44%), Positives = 42/68 (61%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
             I +IR YQ   S + G SC + PTCSEY   AI+R+G   GS+L   R+++C+P    
Sbjct: 8   FLIFLIRFYQKFISPLKGRSCIFYPTCSEYAIIAISRFGPLKGSFLATKRILRCHPFNRG 67

Query: 118 GFDPVPDD 125
           G+DPVP+ 
Sbjct: 68  GYDPVPEK 75


>gi|195978739|ref|YP_002123983.1| hypothetical protein Sez_1639 [Streptococcus equi subsp.
           zooepidemicus MGCS10565]
 gi|195975444|gb|ACG62970.1| hypothetical protein Sez_1639 [Streptococcus equi subsp.
           zooepidemicus MGCS10565]
          Length = 92

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + + I  +R YQ   S +F  SCRY PTCS Y   AI ++G   G  + L RL++C+P
Sbjct: 1   MIKALLIAPVRAYQKYISPLFPPSCRYQPTCSAYMITAIEKHGA-KGVLMGLARLLRCHP 59

Query: 114 LGSDGFDPVPDDLPPKKN 131
             + G DPVPD    K++
Sbjct: 60  FAAGGEDPVPDTFSLKRH 77


>gi|154249720|ref|YP_001410545.1| hypothetical protein Fnod_1039 [Fervidobacterium nodosum Rt17-B1]
 gi|171769424|sp|A7HLV5|Y1039_FERNB RecName: Full=UPF0161 protein Fnod_1039
 gi|154153656|gb|ABS60888.1| protein of unknown function DUF37 [Fervidobacterium nodosum
           Rt17-B1]
          Length = 85

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 30/85 (35%), Positives = 48/85 (56%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R + + +IR YQ   S +   +CR+ PTCS Y Y+A+ R+G+  G  L   R+++CNP+
Sbjct: 1   MRKVILKLIRFYQKYISPLKPPTCRFEPTCSTYTYQAVERFGILKGLLLGFWRVLRCNPI 60

Query: 115 GSDGFDPVPDDLPPKKNNPKLLSKK 139
              G DPVP +    K +   L ++
Sbjct: 61  SKGGHDPVPTEFYLFKKSNNSLRRR 85


>gi|15901701|ref|NP_346305.1| hypothetical protein SP_1873 [Streptococcus pneumoniae TIGR4]
 gi|111657281|ref|ZP_01408046.1| hypothetical protein SpneT_02001498 [Streptococcus pneumoniae
           TIGR4]
 gi|25009623|sp|Q97NX8|Y1873_STRPN RecName: Full=UPF0161 protein SP_1873
 gi|14973376|gb|AAK75945.1| conserved hypothetical protein [Streptococcus pneumoniae TIGR4]
          Length = 80

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 44/77 (57%), Gaps = 1/77 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I  +R YQ   S VF  SCR+  TCS Y  +AI ++G + G  + L R+++C+P 
Sbjct: 1   MKRILIAPVRFYQRFISPVFPPSCRFELTCSNYMIQAIEKHG-FKGVLMGLARILRCHPW 59

Query: 115 GSDGFDPVPDDLPPKKN 131
              G DPVPD    K+N
Sbjct: 60  SKTGKDPVPDRFSLKRN 76


>gi|182437490|ref|YP_001825209.1| hypothetical protein SGR_3697 [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|326778145|ref|ZP_08237410.1| UPF0161 protein yidD [Streptomyces cf. griseus XylebKG-1]
 gi|226705826|sp|B1VPE7|Y3697_STRGG RecName: Full=UPF0161 protein SGR_3697
 gi|178466006|dbj|BAG20526.1| conserved hypothetical protein [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|326658478|gb|EGE43324.1| UPF0161 protein yidD [Streptomyces cf. griseus XylebKG-1]
          Length = 119

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 43/75 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   + +I++YQ   S + G  CRY P+CS YGY +I R+G   G+ LT  R+++CNP 
Sbjct: 1   MKYPLLALIKLYQWTISPLLGPVCRYYPSCSHYGYTSIDRHGAIKGTALTAWRILRCNPW 60

Query: 115 GSDGFDPVPDDLPPK 129
              G D VP    P+
Sbjct: 61  SPGGVDHVPPRKRPR 75


>gi|49474172|ref|YP_032214.1| hypothetical protein BQ05520 [Bartonella quintana str. Toulouse]
 gi|81647095|sp|Q6FZZ6|Y552_BARQU RecName: Full=UPF0161 protein BQ05520
 gi|49239676|emb|CAF26047.1| hypothetical protein BQ05520 [Bartonella quintana str. Toulouse]
          Length = 117

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 47/85 (55%), Positives = 64/85 (75%)

Query: 42  KSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGS 101
           ++RN+ G + KT GRL+G+ +IR YQ+  S+  GN CR+ PTCSEY YEAIAR+GLW G+
Sbjct: 12  QTRNYTGPWRKTPGRLLGLLLIRFYQITLSSFIGNQCRHAPTCSEYIYEAIARHGLWAGA 71

Query: 102 WLTLLRLIKCNPLGSDGFDPVPDDL 126
           W+ L R+++C P G+ GFDPVP  L
Sbjct: 72  WMGLFRIMRCGPFGTHGFDPVPTSL 96


>gi|294789684|ref|ZP_06754917.1| alpha-hemolysin [Simonsiella muelleri ATCC 29453]
 gi|294482396|gb|EFG30090.1| alpha-hemolysin [Simonsiella muelleri ATCC 29453]
          Length = 70

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 32/70 (45%), Positives = 48/70 (68%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + + +G+IR YQL  S +  + CRY+PTCS+Y  EAI +YG+  GS+L   R+ +C+P
Sbjct: 1   MFKSLFLGLIRFYQLAISPLIPSRCRYVPTCSQYAIEAIGKYGVCKGSYLATKRICRCHP 60

Query: 114 LGSDGFDPVP 123
            G  G+DPVP
Sbjct: 61  FGGSGYDPVP 70


>gi|291543429|emb|CBL16538.1| conserved hypothetical protein TIGR00278 [Ruminococcus sp. 18P13]
          Length = 88

 Score =  103 bits (258), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 27/72 (37%), Positives = 40/72 (55%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   + +IR Y+ + S +    C+Y P+CS Y    + R+G   GSWL + RL++CNP 
Sbjct: 1   MKQTAMLLIRFYRKVISPLLPRCCKYYPSCSAYALGVLERFGFLRGSWLAIWRLLRCNPW 60

Query: 115 GSDGFDPVPDDL 126
              GFDPVP   
Sbjct: 61  SKGGFDPVPQKF 72


>gi|332163524|ref|YP_004300101.1| hypothetical protein YE105_C3904 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325667754|gb|ADZ44398.1| conserved hypothetical protein [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
          Length = 85

 Score =  103 bits (258), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 36/68 (52%), Positives = 48/68 (70%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
           P + G  I IG+IR YQL+ S + G  CR+ PTCS YG EA++R+G+  GSWLTL R++K
Sbjct: 4   PLSPGSRILIGLIRGYQLVISPLLGPRCRFHPTCSHYGIEALSRFGMIKGSWLTLKRVLK 63

Query: 111 CNPLGSDG 118
           C+PL   G
Sbjct: 64  CHPLNPGG 71


>gi|319900642|ref|YP_004160370.1| hypothetical protein Bache_0762 [Bacteroides helcogenes P 36-108]
 gi|319415673|gb|ADV42784.1| protein of unknown function DUF37 [Bacteroides helcogenes P 36-108]
          Length = 73

 Score =  103 bits (258), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 29/73 (39%), Positives = 44/73 (60%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            K L   + +  +  YQ   S + G SCR+ PTCS+Y  EAI ++G + G  L + R+++
Sbjct: 1   MKRLFSYLLLLPVYFYQKCISPMLGPSCRFTPTCSQYAVEAIKKHGPFKGLCLAIRRILR 60

Query: 111 CNPLGSDGFDPVP 123
           C+P G  G+DPVP
Sbjct: 61  CHPWGGSGYDPVP 73


>gi|317126738|ref|YP_004100850.1| hypothetical protein Intca_3651 [Intrasporangium calvum DSM 43043]
 gi|315590826|gb|ADU50123.1| protein of unknown function DUF37 [Intrasporangium calvum DSM
           43043]
          Length = 140

 Score =  103 bits (258), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 27/67 (40%), Positives = 39/67 (58%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
           L  +  +R+YQ   S +   +CR+ PTCS Y  E++ R+G   G WL + RL +C+P   
Sbjct: 19  LPFVWAVRLYQRFVSPLRPATCRFHPTCSAYAVESLERFGPIKGGWLAIRRLGRCHPWTP 78

Query: 117 DGFDPVP 123
            G DPVP
Sbjct: 79  GGVDPVP 85


>gi|229822697|ref|YP_002884223.1| protein of unknown function DUF37 [Beutenbergia cavernae DSM 12333]
 gi|229568610|gb|ACQ82461.1| protein of unknown function DUF37 [Beutenbergia cavernae DSM 12333]
          Length = 115

 Score =  103 bits (258), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 41/72 (56%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           +     + +G++R YQLI S  F   CRY P+CS Y   A+ R+G+  G+ L   RL++C
Sbjct: 28  RNPLTWLLLGLVRGYQLIVSPWFAPRCRYYPSCSAYAVTALRRHGVVRGTGLAAWRLLRC 87

Query: 112 NPLGSDGFDPVP 123
           NP    G D VP
Sbjct: 88  NPWSKGGVDHVP 99


>gi|171316348|ref|ZP_02905568.1| protein of unknown function DUF37 [Burkholderia ambifaria MEX-5]
 gi|171098477|gb|EDT43279.1| protein of unknown function DUF37 [Burkholderia ambifaria MEX-5]
          Length = 88

 Score =  103 bits (258), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 24/73 (32%), Positives = 43/73 (58%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
           + I ++R Y++  S + G+ CR+ P+CS+Y  EAI  +G   G++L + R+ +C+P  + 
Sbjct: 4   VLIALLRFYKVAVSPMLGSRCRFYPSCSDYAREAIQYHGAARGTYLAIRRVCRCHPFSAG 63

Query: 118 GFDPVPDDLPPKK 130
           G D VP      +
Sbjct: 64  GIDLVPPPNSDTR 76


>gi|84394511|ref|ZP_00993221.1| hypothetical protein V12B01_01817 [Vibrio splendidus 12B01]
 gi|86147169|ref|ZP_01065485.1| hypothetical protein MED222_18871 [Vibrio sp. MED222]
 gi|218708092|ref|YP_002415713.1| hypothetical protein VS_0004 [Vibrio splendidus LGP32]
 gi|254799449|sp|B7VGH8|Y004_VIBSL RecName: Full=UPF0161 protein VS_0004
 gi|84374864|gb|EAP91801.1| hypothetical protein V12B01_01817 [Vibrio splendidus 12B01]
 gi|85835053|gb|EAQ53195.1| hypothetical protein MED222_18871 [Vibrio sp. MED222]
 gi|218321111|emb|CAV17061.1| Hypothetical protein VS_0004 [Vibrio splendidus LGP32]
          Length = 85

 Score =  103 bits (258), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 31/82 (37%), Positives = 43/82 (52%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
           P +    I +  I  Y+   S + G  CR+ PTCS Y  EA+  +G   G WL+  RL+K
Sbjct: 4   PVSPFAWIALIPIYFYRWFISPLIGPRCRFTPTCSLYAIEALKAHGFVKGCWLSGKRLLK 63

Query: 111 CNPLGSDGFDPVPDDLPPKKNN 132
           C+PL   GFDPVP      ++ 
Sbjct: 64  CHPLNEGGFDPVPPVQKQDRDK 85


>gi|255283810|ref|ZP_05348365.1| putative toxin-antitoxin system, toxin component [Bryantella
           formatexigens DSM 14469]
 gi|255265693|gb|EET58898.1| putative toxin-antitoxin system, toxin component [Bryantella
           formatexigens DSM 14469]
          Length = 80

 Score =  103 bits (258), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 43/72 (59%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I +IR+YQ   S +    C Y PTCS+YG EAI ++G   GS L   R+++CNP 
Sbjct: 1   MKTILIWLIRLYQKYLSPLKRVHCPYYPTCSQYGLEAIQKHGAIKGSILAGWRILRCNPF 60

Query: 115 GSDGFDPVPDDL 126
              G DPVP++ 
Sbjct: 61  SHGGIDPVPEEF 72


>gi|257879868|ref|ZP_05659521.1| conserved hypothetical protein [Enterococcus faecium 1,230,933]
 gi|257882712|ref|ZP_05662365.1| conserved hypothetical protein [Enterococcus faecium 1,231,502]
 gi|261208687|ref|ZP_05923124.1| conserved hypothetical protein [Enterococcus faecium TC 6]
 gi|257814096|gb|EEV42854.1| conserved hypothetical protein [Enterococcus faecium 1,230,933]
 gi|257818370|gb|EEV45698.1| conserved hypothetical protein [Enterococcus faecium 1,231,502]
 gi|260077189|gb|EEW64909.1| conserved hypothetical protein [Enterococcus faecium TC 6]
          Length = 99

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 41/80 (51%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + I I ++R YQ   S  F  SCRY PTCS Y  +AI  +G   G+ +   R+++C+P
Sbjct: 1   MMKKILIYLVRGYQRFISPAFPPSCRYYPTCSNYMIKAIQTHGALKGTVMGTARILRCHP 60

Query: 114 LGSDGFDPVPDDLPPKKNNP 133
               G D VP      +N  
Sbjct: 61  FVKGGIDYVPLTFRLTRNKK 80


>gi|87302989|ref|ZP_01085793.1| hypothetical protein WH5701_07441 [Synechococcus sp. WH 5701]
 gi|87282485|gb|EAQ74444.1| hypothetical protein WH5701_07441 [Synechococcus sp. WH 5701]
          Length = 84

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 32/69 (46%), Positives = 45/69 (65%)

Query: 56  RLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLG 115
           ++  + +I  Y+   S V G  CR++P+CS YG EAI R+G W G WLTL RL++C+P  
Sbjct: 16  QVALLALISGYRRWISPVLGPRCRFIPSCSAYGLEAIQRHGPWRGGWLTLRRLLRCHPFT 75

Query: 116 SDGFDPVPD 124
             G DPVP+
Sbjct: 76  PCGCDPVPE 84


>gi|116256129|sp|Q2S3T2|Y1017_SALRD RecName: Full=UPF0161 protein SRU_1017
          Length = 99

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 29/62 (46%), Positives = 41/62 (66%)

Query: 60  IGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGF 119
           IG++R+YQL+ S   G +CR+ PTCS Y  +A   YG   G  LT+ RL++C+P G  G+
Sbjct: 17  IGLVRLYQLVLSPHLGRTCRFHPTCSAYAIQAFREYGALKGLVLTVHRLLRCHPWGGHGY 76

Query: 120 DP 121
           DP
Sbjct: 77  DP 78


>gi|322517476|ref|ZP_08070349.1| alpha-hemolysin [Streptococcus vestibularis ATCC 49124]
 gi|322123958|gb|EFX95517.1| alpha-hemolysin [Streptococcus vestibularis ATCC 49124]
          Length = 83

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + +   I +++ YQ   S +F  SCR+ PTCS Y  +AI ++G   G  + + R+++C+P
Sbjct: 1   MMKKFLIALVKAYQRWISPLFPPSCRFRPTCSVYMIQAIEKHG-LKGIIMGIARILRCHP 59

Query: 114 LGSDGFDPVPDDLPPKKNNPKL 135
           L   G DPVPD    K+N   L
Sbjct: 60  LSETGDDPVPDYFSLKRNKTPL 81


>gi|150021505|ref|YP_001306859.1| hypothetical protein Tmel_1630 [Thermosipho melanesiensis BI429]
 gi|166231436|sp|A6LNH3|Y1630_THEM4 RecName: Full=UPF0161 protein Tmel_1630
 gi|149794026|gb|ABR31474.1| protein of unknown function DUF37 [Thermosipho melanesiensis BI429]
          Length = 81

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 31/76 (40%), Positives = 46/76 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I + +IR YQ   S +   +C Y PTCSEY Y+A+ ++G++ G +L   R+++CNPL
Sbjct: 1   MKKIILALIRFYQKFISPLKPPTCIYTPTCSEYTYQAVKKFGVFKGLFLGFKRILRCNPL 60

Query: 115 GSDGFDPVPDDLPPKK 130
              G DPVPD     K
Sbjct: 61  HEGGEDPVPDKFYIIK 76


>gi|46907901|ref|YP_014290.1| hypothetical protein LMOf2365_1694 [Listeria monocytogenes serotype
           4b str. F2365]
 gi|67462057|sp|Q71YZ7|Y1694_LISMF RecName: Full=UPF0161 protein LMOf2365_1694
 gi|46881170|gb|AAT04467.1| conserved hypothetical protein [Listeria monocytogenes serotype 4b
           str. F2365]
          Length = 88

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 34/78 (43%), Positives = 45/78 (57%), Gaps = 3/78 (3%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I IG IR+YQ   S    ++CR+ PTCS YG EAI  +G   GS+L + R+ KC+P 
Sbjct: 1   MKKILIGGIRLYQKYISRFTPDTCRFYPTCSAYGIEAIQTHGALKGSYLAIRRISKCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G D VP   P K+ N
Sbjct: 61  HKGGLDFVP---PKKEKN 75


>gi|210624039|ref|ZP_03294156.1| hypothetical protein CLOHIR_02108 [Clostridium hiranonis DSM 13275]
 gi|210153246|gb|EEA84252.1| hypothetical protein CLOHIR_02108 [Clostridium hiranonis DSM 13275]
          Length = 83

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 41  PKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIG 100
            K RN+  K  K L +   I ++R YQ   S + G +CR+ PTCS+Y  EA  +YG   G
Sbjct: 2   DKIRNYIDKIGKLLAKG-CIVLVRFYQKYISPLKGPTCRFYPTCSQYSIEAFKKYGFLKG 60

Query: 101 SWLTLLRLIKCNPLGSDGFDP 121
            +LT+ R+ KC+P    G+DP
Sbjct: 61  LYLTIRRVSKCHPFHPGGYDP 81


>gi|46579489|ref|YP_010297.1| hypothetical protein DVU1076 [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120602961|ref|YP_967361.1| hypothetical protein Dvul_1918 [Desulfovibrio vulgaris DP4]
 gi|47606236|sp|P61466|Y1076_DESVH RecName: Full=UPF0161 protein DVU_1076
 gi|166227493|sp|A1VER8|Y1918_DESVV RecName: Full=UPF0161 protein Dvul_1918
 gi|46448903|gb|AAS95556.1| conserved hypothetical protein TIGR00278 [Desulfovibrio vulgaris
           str. Hildenborough]
 gi|120563190|gb|ABM28934.1| protein of unknown function DUF37 [Desulfovibrio vulgaris DP4]
 gi|311233304|gb|ADP86158.1| protein of unknown function DUF37 [Desulfovibrio vulgaris RCH1]
          Length = 86

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 46/79 (58%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
              + R + +  +R YQ   S +F  +CRY+PTCS Y  EA+ R+G+  G WL   R+++
Sbjct: 1   MSVMLRRLVVLPVRFYQYCISPLFPPACRYVPTCSAYTAEAVMRHGVMRGLWLAARRILR 60

Query: 111 CNPLGSDGFDPVPDDLPPK 129
           C+P  + G DPVP   P +
Sbjct: 61  CHPWCAGGHDPVPPVPPQR 79


>gi|239942674|ref|ZP_04694611.1| hypothetical protein SrosN15_16900 [Streptomyces roseosporus NRRL
           15998]
 gi|239989133|ref|ZP_04709797.1| hypothetical protein SrosN1_17657 [Streptomyces roseosporus NRRL
           11379]
 gi|291446135|ref|ZP_06585525.1| UPF0161 protein [Streptomyces roseosporus NRRL 15998]
 gi|291349082|gb|EFE75986.1| UPF0161 protein [Streptomyces roseosporus NRRL 15998]
          Length = 119

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 43/75 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   + +I++YQ   S + G  CRY P+CS YGY +I R+G   G+ LT  R+++CNP 
Sbjct: 1   MKYPLLALIKLYQWTISPLLGPVCRYYPSCSHYGYTSIDRHGAIKGTALTAWRILRCNPW 60

Query: 115 GSDGFDPVPDDLPPK 129
              G D VP    P+
Sbjct: 61  SPGGVDHVPPRKRPR 75


>gi|332976007|gb|EGK12878.1| alpha-hemolysin [Psychrobacter sp. 1501(2011)]
          Length = 120

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 39/67 (58%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            + + II+ YQ   S +    CRY PTCSEYG  A+  +G   G WL + R+ +C+PLG 
Sbjct: 8   RLLLAIIKGYQNFVSPLLPARCRYYPTCSEYGKTAVIWHGPAQGGWLAVKRICRCHPLGG 67

Query: 117 DGFDPVP 123
            G D VP
Sbjct: 68  HGIDFVP 74


>gi|83816498|ref|YP_445149.1| hypothetical protein SRU_1017 [Salinibacter ruber DSM 13855]
 gi|83757892|gb|ABC46005.1| conserved hypothetical protein TIGR00278 [Salinibacter ruber DSM
           13855]
          Length = 123

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 35/84 (41%), Positives = 48/84 (57%)

Query: 38  NNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGL 97
           NN   S          L RL+ IG++R+YQL+ S   G +CR+ PTCS Y  +A   YG 
Sbjct: 19  NNLSFSMRRALSLLARLPRLLLIGLVRLYQLVLSPHLGRTCRFHPTCSAYAIQAFREYGA 78

Query: 98  WIGSWLTLLRLIKCNPLGSDGFDP 121
             G  LT+ RL++C+P G  G+DP
Sbjct: 79  LKGLVLTVHRLLRCHPWGGHGYDP 102


>gi|172056566|ref|YP_001813026.1| hypothetical protein Exig_0528 [Exiguobacterium sibiricum 255-15]
 gi|226707692|sp|B1YJH9|Y528_EXIS2 RecName: Full=UPF0161 protein Exig_0528
 gi|171989087|gb|ACB60009.1| protein of unknown function DUF37 [Exiguobacterium sibiricum
           255-15]
          Length = 88

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 32/88 (36%), Positives = 47/88 (53%), Gaps = 4/88 (4%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + +G I  YQ + S +   +CR+ PTCS YG EAI ++G   G +LT  RL++C P 
Sbjct: 1   MKQVLLGGIHFYQKVISPMKPATCRFYPTCSHYGKEAIEKHGALRGGYLTTRRLLRCQPF 60

Query: 115 GSDGFDPVPDDL----PPKKNNPKLLSK 138
              G D VP+      P ++ NP    K
Sbjct: 61  HPGGLDFVPETFDWKAPLQRENPAEHQK 88


>gi|83313454|ref|YP_423718.1| hypothetical protein amb4355 [Magnetospirillum magneticum AMB-1]
 gi|116256244|sp|Q2VZ16|Y4355_MAGMM RecName: Full=UPF0161 protein amb4355
 gi|82948295|dbj|BAE53159.1| Hypothetical UPF0161 protein CT0005 [Magnetospirillum magneticum
           AMB-1]
          Length = 89

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 30/63 (47%), Positives = 42/63 (66%)

Query: 61  GIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFD 120
           G+IR+YQL+ S V   SCR+ P+CS Y  +AI  +G   G+WL L R+ +C+P    G+D
Sbjct: 10  GLIRLYQLLLSPVLPASCRFTPSCSSYAMQAIEAHGPVGGTWLGLKRICRCHPWNDGGYD 69

Query: 121 PVP 123
           PVP
Sbjct: 70  PVP 72


>gi|330937303|gb|EGH41311.1| hypothetical protein PSYPI_02327 [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 81

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 28/69 (40%), Positives = 41/69 (59%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R + +  I+ Y+   S +  + CR+ P+CS Y YEAI  +GL  G WL++ RL  C+P 
Sbjct: 1   MRKLALVPIQFYRYAISPLMASHCRFYPSCSCYAYEAIENHGLLRGGWLSIRRLGCCHPW 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  NPGGYDPVP 69


>gi|270292160|ref|ZP_06198375.1| putative toxin-antitoxin system, toxin component [Streptococcus sp.
           M143]
 gi|270279688|gb|EFA25530.1| putative toxin-antitoxin system, toxin component [Streptococcus sp.
           M143]
          Length = 80

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 30/77 (38%), Positives = 42/77 (54%), Gaps = 1/77 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I  +R YQ   S  F  SCR+ PTCS Y  +AI ++  + G  + L R+ +C+P 
Sbjct: 1   MKRILIAPVRFYQRFISPAFPPSCRFEPTCSNYMIQAIEKHS-FKGVLMGLARIFRCHPW 59

Query: 115 GSDGFDPVPDDLPPKKN 131
              G DPVPD    K+N
Sbjct: 60  SKTGKDPVPDHFSLKRN 76


>gi|225857460|ref|YP_002738971.1| hypothetical protein SPP_1873 [Streptococcus pneumoniae P1031]
 gi|254800692|sp|C1CMI3|Y1873_STRZP RecName: Full=UPF0161 protein SPP_1873
 gi|225725529|gb|ACO21381.1| conserved hypothetical protein [Streptococcus pneumoniae P1031]
          Length = 80

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 44/77 (57%), Gaps = 1/77 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I  +R YQ   S VF  SCR+  TCS Y  +AI ++G + G  + L R+++C+P 
Sbjct: 1   MKRILIAPVRFYQRFISPVFPPSCRFELTCSNYMIQAIEKHG-FKGVLMGLSRILRCHPW 59

Query: 115 GSDGFDPVPDDLPPKKN 131
              G DPVPD    K+N
Sbjct: 60  SKTGKDPVPDRFSLKRN 76


>gi|15640031|ref|NP_219386.1| hypothetical protein TP0949a [Treponema pallidum subsp. pallidum
           str. Nichols]
 gi|291060305|gb|ADD73040.1| hypothetical protein TPChic_0949a [Treponema pallidum subsp.
           pallidum str. Chicago]
          Length = 94

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 27/68 (39%), Positives = 42/68 (61%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
           + + +IR YQ   S     SCRY P+CS+Y YE++  +G   G +LT+ R+++C+P    
Sbjct: 14  LLLALIRFYQRALSPHLLPSCRYYPSCSQYAYESVRVHGCVWGLFLTVKRVVRCHPFARG 73

Query: 118 GFDPVPDD 125
           G+DPVP  
Sbjct: 74  GYDPVPTK 81


>gi|304437935|ref|ZP_07397881.1| alpha-hemolysin [Selenomonas sp. oral taxon 149 str. 67H29BP]
 gi|304369075|gb|EFM22754.1| alpha-hemolysin [Selenomonas sp. oral taxon 149 str. 67H29BP]
          Length = 69

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 43/69 (62%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + + +IR Y+   S +F   CRY PTCS Y  EA+ RYG W G W+ L R+++C+P 
Sbjct: 1   MKRLLLFLIRFYRAAISPLFLPHCRYYPTCSAYALEAVTRYGAWRGGWMALRRILRCHPF 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  HRGGYDPVP 69


>gi|225871141|ref|YP_002747088.1| hypothetical protein SEQ_1860 [Streptococcus equi subsp. equi 4047]
 gi|225700545|emb|CAW95026.1| conserved hypothetical protein [Streptococcus equi subsp. equi
           4047]
          Length = 92

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + + I  +R YQ   S +F  SCRY PTCS Y   AI ++G   G  + L RL++C+P
Sbjct: 1   MIKALLIAPVRAYQKYISPLFPPSCRYQPTCSAYMITAIEKHGA-KGVLMGLTRLLRCHP 59

Query: 114 LGSDGFDPVPDDLPPKKN 131
             + G DPVPD    K++
Sbjct: 60  FAAGGEDPVPDTFSLKRH 77


>gi|150024694|ref|YP_001295520.1| hypothetical protein FP0599 [Flavobacterium psychrophilum JIP02/86]
 gi|149771235|emb|CAL42704.1| Protein of unknown function [Flavobacterium psychrophilum JIP02/86]
          Length = 75

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 27/65 (41%), Positives = 45/65 (69%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            + ++R YQ++ S +   +CR+ PTCS Y  EA+ ++GL+ GS+L   R++ C+P G+ G
Sbjct: 11  FLFLVRFYQIVISPLTPATCRFTPTCSHYTAEALQKHGLFKGSYLGAKRILSCHPWGASG 70

Query: 119 FDPVP 123
           +DPVP
Sbjct: 71  YDPVP 75


>gi|251796283|ref|YP_003011014.1| hypothetical protein Pjdr2_2272 [Paenibacillus sp. JDR-2]
 gi|247543909|gb|ACT00928.1| protein of unknown function DUF37 [Paenibacillus sp. JDR-2]
          Length = 91

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 27/73 (36%), Positives = 41/73 (56%), Gaps = 1/73 (1%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            +T  R +    +  Y+ + S +   +CRY PTCS Y  EA+ ++G   GSWL   R+ +
Sbjct: 4   SRTAVR-VMKAPVLFYRKVISPLTPPTCRYYPTCSAYALEALEKHGAVKGSWLAAKRIAR 62

Query: 111 CNPLGSDGFDPVP 123
           C+P    G+DPVP
Sbjct: 63  CHPFHPGGYDPVP 75


>gi|253702734|ref|YP_003023923.1| hypothetical protein GM21_4150 [Geobacter sp. M21]
 gi|259647035|sp|C6DYS2|Y4150_GEOSM RecName: Full=UPF0161 protein GM21_4150
 gi|251777584|gb|ACT20165.1| protein of unknown function DUF37 [Geobacter sp. M21]
          Length = 70

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 42/70 (60%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + I IG++  YQ   S +   SCR+ PTCS Y  +A+ +YG   G WLT  R++KC+P
Sbjct: 1   MLKQIFIGLVVFYQRFISPLKAPSCRFYPTCSHYSLQALEKYGPVKGLWLTAARVLKCHP 60

Query: 114 LGSDGFDPVP 123
               G+DPV 
Sbjct: 61  FHPGGYDPVK 70


>gi|305664987|ref|YP_003861274.1| hypothetical protein FB2170_01751 [Maribacter sp. HTCC2170]
 gi|88707399|gb|EAQ99644.1| hypothetical protein FB2170_01751 [Maribacter sp. HTCC2170]
          Length = 79

 Score =  103 bits (257), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 27/65 (41%), Positives = 41/65 (63%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            + +++ YQ   S     +CRY PTCS Y  EA+ ++GL+ G WL++ R+  C+P G  G
Sbjct: 15  FVLLVKFYQYAISPYTPATCRYSPTCSHYTLEALQKHGLFKGGWLSIKRIFSCHPWGGKG 74

Query: 119 FDPVP 123
           +DPVP
Sbjct: 75  YDPVP 79


>gi|315282627|ref|ZP_07870996.1| conserved hypothetical protein [Listeria marthii FSL S4-120]
 gi|313613726|gb|EFR87501.1| conserved hypothetical protein [Listeria marthii FSL S4-120]
          Length = 88

 Score =  103 bits (257), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 34/78 (43%), Positives = 43/78 (55%), Gaps = 3/78 (3%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I IG IR+YQ   S     +CR+ PTCS YG EAI  +G   GS+L + R+ KC+P 
Sbjct: 1   MKKILIGGIRLYQKYISRFTPATCRFYPTCSAYGIEAIQTHGALKGSYLAIRRISKCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G D VP   P K  N
Sbjct: 61  HKGGLDFVP---PKKDKN 75


>gi|221201818|ref|ZP_03574855.1| conserved hypothetical protein TIGR00278 [Burkholderia multivorans
           CGD2M]
 gi|221207676|ref|ZP_03580684.1| conserved hypothetical protein TIGR00278 [Burkholderia multivorans
           CGD2]
 gi|221172522|gb|EEE04961.1| conserved hypothetical protein TIGR00278 [Burkholderia multivorans
           CGD2]
 gi|221178238|gb|EEE10648.1| conserved hypothetical protein TIGR00278 [Burkholderia multivorans
           CGD2M]
          Length = 111

 Score =  103 bits (257), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 24/76 (31%), Positives = 43/76 (56%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + +   ++R Y++  S + GN CR+ P+CS+Y  EAI  +G   G++L + R+ +C+P 
Sbjct: 24  MKTVLTALLRFYKVAVSPLLGNRCRFYPSCSDYAREAIQYHGAARGTYLAVRRVCRCHPF 83

Query: 115 GSDGFDPVPDDLPPKK 130
            + G D VP      +
Sbjct: 84  SAGGVDLVPPPNSDTR 99


>gi|161526324|ref|YP_001581336.1| hypothetical protein Bmul_3155 [Burkholderia multivorans ATCC
           17616]
 gi|160343753|gb|ABX16839.1| protein of unknown function DUF37 [Burkholderia multivorans ATCC
           17616]
          Length = 111

 Score =  103 bits (257), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 24/76 (31%), Positives = 43/76 (56%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + +   ++R Y++  S + GN CR+ P+CS+Y  EAI  +G   G++L + R+ +C+P 
Sbjct: 24  MKTVLTALLRFYKVAVSPLLGNRCRFYPSCSDYAREAIQYHGAARGTYLAVRRVCRCHPF 83

Query: 115 GSDGFDPVPDDLPPKK 130
            + G D VP      +
Sbjct: 84  SAGGIDLVPPPNSDTR 99


>gi|91790728|ref|YP_551680.1| hypothetical protein Bpro_4906 [Polaromonas sp. JS666]
 gi|91699953|gb|ABE46782.1| protein of unknown function DUF37 [Polaromonas sp. JS666]
          Length = 117

 Score =  103 bits (257), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 47/70 (67%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           L + + IG+++ Y+L+ S   G++CR+ P+CS Y  +A+ ++G   GS+LTL RL +C+P
Sbjct: 23  LPQTVLIGLVKAYRLLLSPWLGSACRFEPSCSAYSLQALQQHGAARGSYLTLRRLARCHP 82

Query: 114 LGSDGFDPVP 123
               G DPVP
Sbjct: 83  WCDGGLDPVP 92


>gi|157828354|ref|YP_001494596.1| hypothetical protein A1G_02730 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|157800835|gb|ABV76088.1| hypothetical protein A1G_02730 [Rickettsia rickettsii str. 'Sheila
           Smith']
          Length = 81

 Score =  103 bits (257), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 35/80 (43%), Positives = 47/80 (58%), Gaps = 4/80 (5%)

Query: 60  IGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGF 119
           + ++R YQ   S + GN+CR+ PTCSEY  EAI+ +G   G W T  R+IKC P    G+
Sbjct: 5   LLLLRFYQYFISPLLGNNCRFHPTCSEYAKEAISMHGSIKGLWFTFKRIIKCQPFCDGGY 64

Query: 120 DPVPDDLPPKKNNPKLLSKK 139
           D VP  +     N K L+KK
Sbjct: 65  DTVPISIK----NSKPLNKK 80


>gi|238651039|ref|YP_002916896.1| putative cytoplasmic protein [Rickettsia peacockii str. Rustic]
 gi|259647109|sp|C4K2P7|Y6875_RICPU RecName: Full=UPF0161 protein RPR_06875
 gi|238625137|gb|ACR47843.1| putative cytoplasmic protein [Rickettsia peacockii str. Rustic]
          Length = 82

 Score =  103 bits (257), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 47/85 (55%), Gaps = 4/85 (4%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              I + ++R YQ   S + GN+CR+  TCSEY  EAI+ +G   G W T  R+IKC P 
Sbjct: 1   MTRILLLLLRFYQYFISPLLGNNCRFHLTCSEYAKEAISMHGSIKGLWFTFKRIIKCQPF 60

Query: 115 GSDGFDPVPDDLPPKKNNPKLLSKK 139
              G+D VP  +     N K L+KK
Sbjct: 61  CDGGYDTVPISIK----NSKPLNKK 81


>gi|170077792|ref|YP_001734430.1| hypothetical protein SYNPCC7002_A1175 [Synechococcus sp. PCC 7002]
 gi|226696257|sp|B1XKC8|Y1175_SYNP2 RecName: Full=UPF0161 protein SYNPCC7002_A1175
 gi|169885461|gb|ACA99174.1| conserved hypothetical protein TIGR00278 [Synechococcus sp. PCC
           7002]
          Length = 80

 Score =  103 bits (257), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 44/69 (63%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + +  I+ Y+   S +F  SCR+ PTCS+Y  EA+ R+G+  GSWL L RL +C+P 
Sbjct: 1   MKSLILWSIKGYRRWISPLFPPSCRFQPTCSQYALEAVERFGVLRGSWLALKRLGRCHPF 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  HPGGYDPVP 69


>gi|225077257|ref|ZP_03720456.1| hypothetical protein NEIFLAOT_02312 [Neisseria flavescens
           NRL30031/H210]
 gi|261380786|ref|ZP_05985359.1| putative toxin-antitoxin system, toxin component [Neisseria
           subflava NJ9703]
 gi|319639363|ref|ZP_07994114.1| hypothetical protein HMPREF0604_01738 [Neisseria mucosa C102]
 gi|224951401|gb|EEG32610.1| hypothetical protein NEIFLAOT_02312 [Neisseria flavescens
           NRL30031/H210]
 gi|284796251|gb|EFC51598.1| putative toxin-antitoxin system, toxin component [Neisseria
           subflava NJ9703]
 gi|317399547|gb|EFV80217.1| hypothetical protein HMPREF0604_01738 [Neisseria mucosa C102]
          Length = 73

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 29/61 (47%), Positives = 38/61 (62%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           IR YQ   S +    CRY PTCS+Y  EA+ +YG + G WL + R+ +C+P G  G DPV
Sbjct: 13  IRFYQYCISPLIPPRCRYTPTCSQYAVEAVKKYGAFKGGWLAIKRIARCHPFGGHGHDPV 72

Query: 123 P 123
           P
Sbjct: 73  P 73


>gi|188991317|ref|YP_001903327.1| hypothetical protein xccb100_1922 [Xanthomonas campestris pv.
           campestris str. B100]
 gi|226732162|sp|B0RS40|Y1922_XANCB RecName: Full=UPF0161 protein xcc-b100_1922
 gi|167733077|emb|CAP51275.1| Conserved hypothetical protein [Xanthomonas campestris pv.
           campestris]
          Length = 93

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 35/73 (47%), Positives = 47/73 (64%), Gaps = 1/73 (1%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           + +GRL+ I ++R Y+   S + G  CR+ P+CSEY   AIAR+G   GSWL   RL +C
Sbjct: 6   QVIGRLL-IALLRFYKRFISPLLGPRCRFAPSCSEYAMTAIARFGPLRGSWLAARRLGRC 64

Query: 112 NPLGSDGFDPVPD 124
           +P    GFDPVPD
Sbjct: 65  HPFHPGGFDPVPD 77


>gi|304318136|ref|YP_003853281.1| hypothetical protein Tthe_2755 [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302779638|gb|ADL70197.1| protein of unknown function DUF37 [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 69

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 42/69 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I +IR YQ   S +   SCR+ PTCS+Y  +AI +YG+  G  + L R+++CNP 
Sbjct: 1   MKYIFIYLIRFYQKFISPMKPKSCRFYPTCSQYAIDAIKKYGVLKGGIMALWRILRCNPF 60

Query: 115 GSDGFDPVP 123
              G+DPV 
Sbjct: 61  NPGGYDPVK 69


>gi|254466382|ref|ZP_05079793.1| conserved hypothetical protein TIGR00278 [Rhodobacterales bacterium
           Y4I]
 gi|206687290|gb|EDZ47772.1| conserved hypothetical protein TIGR00278 [Rhodobacterales bacterium
           Y4I]
          Length = 76

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 45/73 (61%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           T    I    +R Y+L+ S   G +CRY PTCS Y  EA+ ++G   G+WLTL R+ +C+
Sbjct: 2   TPLAHILALPVRAYRLLLSPWVGFNCRYQPTCSAYALEALEKHGAIKGAWLTLRRIGRCH 61

Query: 113 PLGSDGFDPVPDD 125
           P G DG+DPVP  
Sbjct: 62  PFGGDGYDPVPQK 74


>gi|291541859|emb|CBL14969.1| conserved hypothetical protein TIGR00278 [Ruminococcus bromii
           L2-63]
          Length = 79

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 31/70 (44%), Positives = 47/70 (67%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I + IIR Y+   S +  + C+Y+PTCS+YG EAI R+G   G+ LT+ R+++CNP 
Sbjct: 1   MKRILLAIIRFYRTSVSPLTASHCKYIPTCSQYGIEAIERFGALKGTALTVWRILRCNPF 60

Query: 115 GSDGFDPVPD 124
              G+DPVP+
Sbjct: 61  SKGGYDPVPE 70


>gi|270339607|ref|ZP_06005424.2| conserved hypothetical protein [Prevotella bergensis DSM 17361]
 gi|270334382|gb|EFA45168.1| conserved hypothetical protein [Prevotella bergensis DSM 17361]
          Length = 80

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 28/67 (41%), Positives = 40/67 (59%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            + I  I  YQ   +     SCR+ PTCSEY  +A+ ++G   G  LT+ R+++CNP G 
Sbjct: 14  WVLIQPIEFYQRFITPYTPASCRFTPTCSEYARQALLKHGPIKGLALTIWRILRCNPWGG 73

Query: 117 DGFDPVP 123
            G+DPVP
Sbjct: 74  SGYDPVP 80


>gi|311742160|ref|ZP_07715970.1| alpha-hemolysin [Aeromicrobium marinum DSM 15272]
 gi|311314653|gb|EFQ84560.1| alpha-hemolysin [Aeromicrobium marinum DSM 15272]
          Length = 79

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 46/75 (61%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + IG++R+Y+   S ++G  C+Y PTCS Y   A+  +G   GSWL + RL++C+P 
Sbjct: 1   MKYLLIGLLRVYRFAISPLYGQVCKYHPTCSAYALGAVETHGAIRGSWLAVRRLLRCHPW 60

Query: 115 GSDGFDPVPDDLPPK 129
            S G+DPVP     +
Sbjct: 61  SSGGYDPVPSPTSVR 75


>gi|254000530|ref|YP_003052593.1| hypothetical protein Msip34_2829 [Methylovorus sp. SIP3-4]
 gi|253987209|gb|ACT52066.1| protein of unknown function DUF37 [Methylovorus sp. SIP3-4]
          Length = 72

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 41/71 (57%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           +L     + IIR+YQ+  S  FG  CR+ PTCS+Y  EAI ++G   G    + R+ KC+
Sbjct: 2   SLLAKALVAIIRLYQVALSPYFGQQCRFSPTCSQYTIEAINKHGALSGLAYGVRRIGKCH 61

Query: 113 PLGSDGFDPVP 123
           P    G DPVP
Sbjct: 62  PWHPGGHDPVP 72


>gi|239818258|ref|YP_002947168.1| hypothetical protein Vapar_5300 [Variovorax paradoxus S110]
 gi|239804835|gb|ACS21902.1| protein of unknown function DUF37 [Variovorax paradoxus S110]
          Length = 95

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 43/69 (62%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + IG+++ Y+L+ S   G SCR+ PTCS Y  EA+  +G   GS+LTL R+ +C P 
Sbjct: 1   MKRLLIGLVKGYRLLLSPWLGQSCRFTPTCSVYSIEALEVHGALKGSYLTLHRIARCQPW 60

Query: 115 GSDGFDPVP 123
              G DPVP
Sbjct: 61  CQGGHDPVP 69


>gi|22537732|ref|NP_688583.1| hypothetical protein SAG1592 [Streptococcus agalactiae 2603V/R]
 gi|76786865|ref|YP_330210.1| hypothetical protein SAK_1607 [Streptococcus agalactiae A909]
 gi|76799446|ref|ZP_00781592.1| conserved hypothetical protein TIGR00278 [Streptococcus agalactiae
           18RS21]
 gi|77406886|ref|ZP_00783911.1| conserved hypothetical protein TIGR00278 [Streptococcus agalactiae
           H36B]
 gi|77409457|ref|ZP_00786150.1| conserved hypothetical protein TIGR00278 [Streptococcus agalactiae
           COH1]
 gi|77412372|ref|ZP_00788683.1| conserved hypothetical protein TIGR00278 [Streptococcus agalactiae
           CJB111]
 gi|77414385|ref|ZP_00790540.1| conserved hypothetical protein TIGR00278 [Streptococcus agalactiae
           515]
 gi|29428195|sp|Q8DY98|Y1592_STRA5 RecName: Full=UPF0161 protein SAG1592
 gi|116256140|sp|Q3JZU3|Y1607_STRA1 RecName: Full=UPF0161 protein SAK_1607
 gi|22534622|gb|AAN00456.1|AE014264_11 conserved hypothetical protein TIGR00278 [Streptococcus agalactiae
           2603V/R]
 gi|76561922|gb|ABA44506.1| conserved hypothetical protein TIGR00278 [Streptococcus agalactiae
           A909]
 gi|76585202|gb|EAO61814.1| conserved hypothetical protein TIGR00278 [Streptococcus agalactiae
           18RS21]
 gi|77159575|gb|EAO70731.1| conserved hypothetical protein TIGR00278 [Streptococcus agalactiae
           515]
 gi|77161592|gb|EAO72592.1| conserved hypothetical protein TIGR00278 [Streptococcus agalactiae
           CJB111]
 gi|77171924|gb|EAO75100.1| conserved hypothetical protein TIGR00278 [Streptococcus agalactiae
           COH1]
 gi|77174495|gb|EAO77339.1| conserved hypothetical protein TIGR00278 [Streptococcus agalactiae
           H36B]
 gi|319745533|gb|EFV97835.1| alpha-hemolysin [Streptococcus agalactiae ATCC 13813]
          Length = 83

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + +   I ++R YQ   S  F  SCRY PTCS Y  EAI ++G   G  + + R+++C+P
Sbjct: 1   MLKSFLIFLVRFYQKNISPAFPASCRYRPTCSTYMIEAIQKHG-LKGVLMGIARILRCHP 59

Query: 114 LGSDGFDPVPDDLPPKKNNP 133
           L   G DPVPD    ++N  
Sbjct: 60  LAHGGNDPVPDHFSLRRNKT 79


>gi|47093549|ref|ZP_00231309.1| conserved hypothetical protein [Listeria monocytogenes str. 4b
           H7858]
 gi|226224273|ref|YP_002758380.1| hypothetical protein Lm4b_01683 [Listeria monocytogenes Clip81459]
 gi|254852297|ref|ZP_05241645.1| conserved hypothetical protein [Listeria monocytogenes FSL R2-503]
 gi|254931613|ref|ZP_05264972.1| conserved hypothetical protein [Listeria monocytogenes HPB2262]
 gi|254992392|ref|ZP_05274582.1| hypothetical protein LmonocytoFSL_04434 [Listeria monocytogenes FSL
           J2-064]
 gi|255022672|ref|ZP_05294658.1| hypothetical protein LmonocyFSL_02556 [Listeria monocytogenes FSL
           J1-208]
 gi|290893262|ref|ZP_06556249.1| conserved hypothetical protein [Listeria monocytogenes FSL J2-071]
 gi|300766045|ref|ZP_07076014.1| conserved hypothetical protein [Listeria monocytogenes FSL N1-017]
 gi|259646458|sp|C1KVW9|Y1683_LISMC RecName: Full=UPF0161 protein Lm4b_01683
 gi|47018063|gb|EAL08836.1| conserved hypothetical protein [Listeria monocytogenes str. 4b
           H7858]
 gi|225876735|emb|CAS05444.1| Conserved hypothetical proteins [Listeria monocytogenes serotype 4b
           str. CLIP 80459]
 gi|258605603|gb|EEW18211.1| conserved hypothetical protein [Listeria monocytogenes FSL R2-503]
 gi|290557244|gb|EFD90771.1| conserved hypothetical protein [Listeria monocytogenes FSL J2-071]
 gi|293583166|gb|EFF95198.1| conserved hypothetical protein [Listeria monocytogenes HPB2262]
 gi|300513247|gb|EFK40325.1| conserved hypothetical protein [Listeria monocytogenes FSL N1-017]
 gi|313608412|gb|EFR84357.1| conserved hypothetical protein [Listeria monocytogenes FSL F2-208]
 gi|328465036|gb|EGF36315.1| hypothetical protein LM1816_09747 [Listeria monocytogenes 1816]
 gi|328474010|gb|EGF44823.1| hypothetical protein LM220_15865 [Listeria monocytogenes 220]
          Length = 88

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 34/78 (43%), Positives = 44/78 (56%), Gaps = 3/78 (3%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I IG IR+YQ   S     +CR+ PTCS YG EAI  +G   GS+L + R+ KC+P 
Sbjct: 1   MKKILIGGIRLYQKYISRFTPATCRFYPTCSAYGIEAIQTHGALKGSYLAIRRISKCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G D VP   P K+ N
Sbjct: 61  HKGGLDFVP---PKKEKN 75


>gi|124025175|ref|YP_001014291.1| hypothetical protein NATL1_04621 [Prochlorococcus marinus str.
           NATL1A]
 gi|166227273|sp|A2C0L6|Y462_PROM1 RecName: Full=UPF0161 protein NATL1_04621
 gi|123960243|gb|ABM75026.1| Uncharacterized conserved protein [Prochlorococcus marinus str.
           NATL1A]
          Length = 79

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 34/69 (49%), Positives = 46/69 (66%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
           L+ + +I  YQ   S +FG SCR++P+CS YG EA+ ++G W G WLTL RL KC+P   
Sbjct: 11  LVFVSLISFYQKWISPLFGPSCRFIPSCSAYGIEAVNKHGPWRGGWLTLKRLSKCHPFTP 70

Query: 117 DGFDPVPDD 125
            G DPVP+ 
Sbjct: 71  CGCDPVPEK 79


>gi|325860181|ref|ZP_08173306.1| YidD family protein [Prevotella denticola CRIS 18C-A]
 gi|325482268|gb|EGC85276.1| YidD family protein [Prevotella denticola CRIS 18C-A]
          Length = 99

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 41/67 (61%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            + I  IR Y+   S     SCR+ PTCSEY  +AI ++G + G  L + R+++CNP G 
Sbjct: 33  WLLILPIRFYRQFISPFTPPSCRFTPTCSEYARQAILKHGPFKGLALAIWRILRCNPWGG 92

Query: 117 DGFDPVP 123
            G+DPVP
Sbjct: 93  SGYDPVP 99


>gi|291615450|ref|YP_003525607.1| hypothetical protein Slit_2995 [Sideroxydans lithotrophicus ES-1]
 gi|291585562|gb|ADE13220.1| protein of unknown function DUF37 [Sideroxydans lithotrophicus
           ES-1]
          Length = 69

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 31/69 (44%), Positives = 46/69 (66%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + + ++R YQL+ S V   SCR+ P+CS+Y  EAI +YG   G WLT+ R+++CNP 
Sbjct: 1   MKSVLLLLVRAYQLLISPVLPQSCRFCPSCSQYSLEAITKYGALKGFWLTIRRVVRCNPW 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  NPGGYDPVP 69


>gi|307945490|ref|ZP_07660826.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
 gi|307771363|gb|EFO30588.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
          Length = 115

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 38/87 (43%), Positives = 58/87 (66%)

Query: 41  PKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIG 100
           P  ++ +     ++   IG+G+I +Y+   S   G +CRY P+CSEY  +A+ R+GLW G
Sbjct: 3   PPEKSKSDIAAASIPARIGLGLIWVYRHSLSLFMGRTCRYAPSCSEYTADALKRFGLWRG 62

Query: 101 SWLTLLRLIKCNPLGSDGFDPVPDDLP 127
            WL L R+++CNP G+DG+DP+PD LP
Sbjct: 63  GWLGLSRILRCNPWGADGYDPIPDQLP 89


>gi|303236131|ref|ZP_07322733.1| conserved hypothetical protein YidD [Prevotella disiens FB035-09AN]
 gi|302483713|gb|EFL46706.1| conserved hypothetical protein YidD [Prevotella disiens FB035-09AN]
          Length = 82

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 29/76 (38%), Positives = 42/76 (55%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
           G F       + I  I  YQ   +     SCR+ PTCSEY  +A+ ++G + G  L + R
Sbjct: 7   GHFVLRALSWLLILPILFYQRFITPFTPPSCRFTPTCSEYARQALIKHGPFKGLALAIWR 66

Query: 108 LIKCNPLGSDGFDPVP 123
           +++CNP G  G+DPVP
Sbjct: 67  ILRCNPWGGSGYDPVP 82


>gi|148654186|ref|YP_001281279.1| hypothetical protein PsycPRwf_2389 [Psychrobacter sp. PRwf-1]
 gi|148573270|gb|ABQ95329.1| protein of unknown function DUF37 [Psychrobacter sp. PRwf-1]
          Length = 135

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 32/67 (47%), Positives = 37/67 (55%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            + + II  YQ   S      CRY PTCSEYG  AI  +G   G WLTL R+  C+PLG 
Sbjct: 11  RMLLAIIHGYQRFVSPALPGRCRYYPTCSEYGKTAILWHGAGKGGWLTLKRIGSCHPLGG 70

Query: 117 DGFDPVP 123
            G D VP
Sbjct: 71  HGIDFVP 77


>gi|210634756|ref|ZP_03298284.1| hypothetical protein COLSTE_02211 [Collinsella stercoris DSM 13279]
 gi|210158696|gb|EEA89667.1| hypothetical protein COLSTE_02211 [Collinsella stercoris DSM 13279]
          Length = 70

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 44/70 (62%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + +   +  I  YQ   S V  ++C Y+PTCS+Y  EAI +YG+  G WL L R+++C+P
Sbjct: 1   MIKRFFLAAIHWYQRRISPVLPDACIYIPTCSQYAVEAIEKYGVVRGCWLGLRRILRCHP 60

Query: 114 LGSDGFDPVP 123
             + G+DPVP
Sbjct: 61  FHAGGYDPVP 70


>gi|21231694|ref|NP_637611.1| hypothetical protein XCC2256 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66768180|ref|YP_242942.1| hypothetical protein XC_1859 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|25009627|sp|Q8P8I5|Y2256_XANCP RecName: Full=UPF0161 protein XCC2256
 gi|81305845|sp|Q4UVK1|Y1859_XANC8 RecName: Full=UPF0161 protein XC_1859
 gi|21113394|gb|AAM41535.1| alpha-hemolysin [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66573512|gb|AAY48922.1| alpha-hemolysin [Xanthomonas campestris pv. campestris str. 8004]
          Length = 93

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 35/73 (47%), Positives = 47/73 (64%), Gaps = 1/73 (1%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           + +GRL+ I ++R Y+   S + G  CR+ P+CSEY   AIAR+G   GSWL   RL +C
Sbjct: 6   QVIGRLL-IALLRFYKRFISPLLGPRCRFAPSCSEYAMTAIARFGPLRGSWLAARRLGRC 64

Query: 112 NPLGSDGFDPVPD 124
           +P    GFDPVPD
Sbjct: 65  HPFHPGGFDPVPD 77


>gi|62184792|ref|YP_219577.1| hypothetical protein CAB147 [Chlamydophila abortus S26/3]
 gi|81313029|sp|Q5L6W5|Y147_CHLAB RecName: Full=UPF0161 protein CAB147
 gi|62147859|emb|CAH63605.1| conserved hypothetical protein [Chlamydophila abortus S26/3]
          Length = 103

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 39/71 (54%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
            L   +  G+I +Y+   S + G+ CR+ P+CS+Y  +A+  +    G WLT+ R+ KC 
Sbjct: 9   NLPTHLCCGLIHLYRWTISPLLGSPCRFFPSCSQYALQALKHHKCIRGLWLTIKRIGKCG 68

Query: 113 PLGSDGFDPVP 123
           P    G D VP
Sbjct: 69  PWHPGGIDLVP 79


>gi|157373144|ref|YP_001471744.1| hypothetical protein Ssed_0003 [Shewanella sediminis HAW-EB3]
 gi|189030190|sp|A8FP43|Y003_SHESH RecName: Full=UPF0161 protein Ssed_0003
 gi|157315518|gb|ABV34616.1| protein of unknown function DUF37 [Shewanella sediminis HAW-EB3]
          Length = 85

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 31/76 (40%), Positives = 43/76 (56%), Gaps = 1/76 (1%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNS-CRYLPTCSEYGYEAIARYGLWIGSWLTLLRLI 109
            ++  + +   +IR YQ+  S   G + CR+ PTCS Y  EAI  +G   GSWL   R++
Sbjct: 4   TQSPLQWLATTLIRGYQVFISPFLGANKCRFHPTCSTYAIEAIRLHGFAKGSWLAARRIL 63

Query: 110 KCNPLGSDGFDPVPDD 125
           KC+PL   G DPVP  
Sbjct: 64  KCHPLHPGGIDPVPPK 79


>gi|254824266|ref|ZP_05229267.1| conserved hypothetical protein [Listeria monocytogenes FSL J1-194]
 gi|255520984|ref|ZP_05388221.1| hypothetical protein LmonocFSL_07136 [Listeria monocytogenes FSL
           J1-175]
 gi|293593501|gb|EFG01262.1| conserved hypothetical protein [Listeria monocytogenes FSL J1-194]
          Length = 88

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 34/78 (43%), Positives = 44/78 (56%), Gaps = 3/78 (3%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I IG IR+YQ   S     +CR+ PTCS YG EAI  +G   GS+L + R+ KC+P 
Sbjct: 1   MKKILIGGIRLYQKYISRFTPATCRFYPTCSAYGIEAIQTHGALKGSYLAIRRISKCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G D VP   P K+ N
Sbjct: 61  HKGGLDFVP---PIKEKN 75


>gi|220933191|ref|YP_002510099.1| conserved hypothetical protein TIGR00278 [Halothermothrix orenii H
           168]
 gi|219994501|gb|ACL71104.1| conserved hypothetical protein TIGR00278 [Halothermothrix orenii H
           168]
          Length = 74

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 32/70 (45%), Positives = 46/70 (65%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           + L + + IG+IR YQ   S  F  +CR+ PTCSEY   AI+RYG+  G+WL + R+++C
Sbjct: 3   RNLFKKVFIGLIRFYQKAISPWFPKTCRFYPTCSEYSKAAISRYGVIKGTWLAIKRILRC 62

Query: 112 NPLGSDGFDP 121
           NP    G+DP
Sbjct: 63  NPFNPGGYDP 72


>gi|72383581|ref|YP_292936.1| hypothetical protein PMN2A_1745 [Prochlorococcus marinus str.
           NATL2A]
 gi|116256144|sp|Q46LZ8|Y1745_PROMT RecName: Full=UPF0161 protein PMN2A_1745
 gi|72003431|gb|AAZ59233.1| Protein of unknown function DUF37 [Prochlorococcus marinus str.
           NATL2A]
          Length = 79

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 35/69 (50%), Positives = 47/69 (68%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
           L+ + +I  YQ   S +FG SCR++P+CS YG EA+ ++G W G WLTL RL KC+PL  
Sbjct: 11  LVFVSLISFYQKWISPLFGPSCRFIPSCSAYGIEAVNKHGPWRGGWLTLKRLSKCHPLTP 70

Query: 117 DGFDPVPDD 125
            G DPVP+ 
Sbjct: 71  CGCDPVPEK 79


>gi|89068157|ref|ZP_01155574.1| hypothetical protein OG2516_08247 [Oceanicola granulosus HTCC2516]
 gi|89046396|gb|EAR52453.1| hypothetical protein OG2516_08247 [Oceanicola granulosus HTCC2516]
          Length = 73

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 43/72 (59%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           + G  +    +R Y+L+ S   G+ CRY PTCS Y  EA+ R+G   G WLT  R+++C+
Sbjct: 2   SPGARLLALPVRAYRLLLSPWVGHGCRYHPTCSAYALEALERHGALRGGWLTARRILRCH 61

Query: 113 PLGSDGFDPVPD 124
           P G  G D VPD
Sbjct: 62  PWGGSGIDNVPD 73


>gi|227494186|ref|ZP_03924502.1| alpha-hemolysin [Actinomyces coleocanis DSM 15436]
 gi|226831920|gb|EEH64303.1| alpha-hemolysin [Actinomyces coleocanis DSM 15436]
          Length = 97

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 37/80 (46%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
            +   +    IR YQL  S  F   CRY P+CS Y  EAI  +G   G  L   RL++CN
Sbjct: 2   NILTKLLTAPIRFYQLYISPAFPPRCRYYPSCSTYAVEAIKVHGPIKGLILGTYRLLRCN 61

Query: 113 PLGSDGFDPVPDDLPPKKNN 132
           P    G D VPD    K   
Sbjct: 62  PWSLGGVDHVPDVGKWKPKP 81


>gi|327312728|ref|YP_004328165.1| YidD family protein [Prevotella denticola F0289]
 gi|326945243|gb|AEA21128.1| YidD family protein [Prevotella denticola F0289]
          Length = 99

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 41/67 (61%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            + I  IR Y+   S     SCR+ PTCSEY  +AI ++G + G  L + R+++CNP G 
Sbjct: 33  WLLILPIRFYRQFISPFTPPSCRFTPTCSEYARQAILKHGPFKGLALAIWRILRCNPWGG 92

Query: 117 DGFDPVP 123
            G+DPVP
Sbjct: 93  SGYDPVP 99


>gi|317154270|ref|YP_004122318.1| hypothetical protein Daes_2574 [Desulfovibrio aespoeensis Aspo-2]
 gi|316944521|gb|ADU63572.1| protein of unknown function DUF37 [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 97

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 31/82 (37%), Positives = 47/82 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R + + +I  YQ + S +   +CR+ PTCSEY  EA+ R+G + G  L   RL++C PL
Sbjct: 1   MRSLFLALIWFYQKLISPLLPPACRFSPTCSEYAREAVTRHGAFKGGLLVSWRLLRCQPL 60

Query: 115 GSDGFDPVPDDLPPKKNNPKLL 136
              G+DPVP   P  K   +++
Sbjct: 61  CRGGYDPVPAIWPTDKLKARII 82


>gi|198274136|ref|ZP_03206668.1| hypothetical protein BACPLE_00273 [Bacteroides plebeius DSM 17135]
 gi|198273214|gb|EDY97483.1| hypothetical protein BACPLE_00273 [Bacteroides plebeius DSM 17135]
          Length = 73

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 27/73 (36%), Positives = 42/73 (57%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            K     + +  I  Y+   S     SCR+ PTCS+Y  EAI ++G + G +L + R+++
Sbjct: 1   MKKFISFLLLLPIYFYRNCISPFTPPSCRFTPTCSQYAIEAIQKHGPFKGLYLAIRRILR 60

Query: 111 CNPLGSDGFDPVP 123
           C+P G  G+DPVP
Sbjct: 61  CHPWGGSGYDPVP 73


>gi|86135816|ref|ZP_01054395.1| hypothetical protein MED193_16874 [Roseobacter sp. MED193]
 gi|85826690|gb|EAQ46886.1| hypothetical protein MED193_16874 [Roseobacter sp. MED193]
          Length = 85

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 35/75 (46%), Positives = 48/75 (64%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           T    I    +R Y+LIFS   G +CRY PTCS Y  EA+ ++G   G++LT+ R+ +C+
Sbjct: 2   TPLAHILALPVRAYRLIFSPWVGFNCRYQPTCSAYSLEALEKHGAIKGAYLTIRRIGRCH 61

Query: 113 PLGSDGFDPVPDDLP 127
           PLG DG+DPVP   P
Sbjct: 62  PLGGDGYDPVPGSDP 76


>gi|317131005|ref|YP_004097287.1| hypothetical protein Bcell_4329 [Bacillus cellulosilyticus DSM
           2522]
 gi|315475953|gb|ADU32556.1| protein of unknown function DUF37 [Bacillus cellulosilyticus DSM
           2522]
          Length = 83

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 35/73 (47%), Positives = 43/73 (58%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   IG IR YQ   S     +CR+ PTCS Y  EAI R+G + GSWLT  R++KC P 
Sbjct: 1   MKRFFIGSIRFYQKYISRFTPPTCRFYPTCSHYSIEAIQRFGAFKGSWLTFKRILKCQPF 60

Query: 115 GSDGFDPVPDDLP 127
              GFDPVPD+  
Sbjct: 61  HPGGFDPVPDEKK 73


>gi|320532818|ref|ZP_08033595.1| conserved hypothetical protein YidD [Actinomyces sp. oral taxon 171
           str. F0337]
 gi|320134969|gb|EFW27140.1| conserved hypothetical protein YidD [Actinomyces sp. oral taxon 171
           str. F0337]
          Length = 94

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 30/76 (39%), Positives = 41/76 (53%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            +  +R YQ   S     SCRY PTCS Y   A+  +G   G+ L L RL++CNPL   G
Sbjct: 9   LLAPVRFYQRFISPALPASCRYHPTCSAYAVTALEVHGPIKGTLLALWRLLRCNPLTRGG 68

Query: 119 FDPVPDDLPPKKNNPK 134
            D VPD    + ++P+
Sbjct: 69  VDHVPDKGQWRYHHPR 84


>gi|114770129|ref|ZP_01447667.1| hypothetical protein OM2255_10850 [alpha proteobacterium HTCC2255]
 gi|114548966|gb|EAU51849.1| hypothetical protein OM2255_10850 [alpha proteobacterium HTCC2255]
          Length = 73

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 35/72 (48%), Positives = 44/72 (61%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           T    I +  IR Y+LIFS   G +CRY PTCS Y  EA+ ++G   GSWL   R+ +C+
Sbjct: 2   TPFSYICMLPIRAYRLIFSPWVGCNCRYHPTCSAYALEALEKHGGIKGSWLATKRIFRCH 61

Query: 113 PLGSDGFDPVPD 124
           P GS G D VPD
Sbjct: 62  PWGSSGVDNVPD 73


>gi|69247771|ref|ZP_00604476.1| Protein of unknown function DUF37 [Enterococcus faecium DO]
 gi|289566056|ref|ZP_06446493.1| conserved hypothetical protein [Enterococcus faecium D344SRF]
 gi|68194700|gb|EAN09182.1| Protein of unknown function DUF37 [Enterococcus faecium DO]
 gi|289162163|gb|EFD10026.1| conserved hypothetical protein [Enterococcus faecium D344SRF]
          Length = 98

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 40/79 (50%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I ++R YQ   S  F  SCRY PTCS Y  +AI  +G   G+ +   R+++C+P 
Sbjct: 1   MKKILIYLVRGYQRFISPAFPPSCRYYPTCSNYMIKAIQTHGALKGTVMGTARILRCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNNP 133
              G D VP      +N  
Sbjct: 61  VKGGIDYVPLTFRLTRNKK 79


>gi|315605511|ref|ZP_07880548.1| alpha-hemolysin [Actinomyces sp. oral taxon 180 str. F0310]
 gi|315312778|gb|EFU60858.1| alpha-hemolysin [Actinomyces sp. oral taxon 180 str. F0310]
          Length = 128

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 39/80 (48%), Gaps = 3/80 (3%)

Query: 48  GKFPKTLGRL---IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLT 104
           G+    LGRL   I    I  YQ   S   G  CRY P+CS Y  +AI  +G   G  L 
Sbjct: 5   GRTMTRLGRLVGQIASAPIVAYQRFISPALGPRCRYAPSCSTYALQAIRVHGPIKGFVLG 64

Query: 105 LLRLIKCNPLGSDGFDPVPD 124
             RL++CNP    G D VP+
Sbjct: 65  AWRLLRCNPWSLGGVDHVPE 84


>gi|281492253|ref|YP_003354233.1| hypothetical protein LLKF_1831 [Lactococcus lactis subsp. lactis
           KF147]
 gi|281375924|gb|ADA65418.1| Hypothetical protein LLKF_1831 [Lactococcus lactis subsp. lactis
           KF147]
          Length = 88

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 40/77 (51%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + +  +  YQ   S     +CRY PTCS Y  +AI ++G   G  +   R+++C+P 
Sbjct: 1   MKKVLVKAVHGYQRWISPALPPACRYYPTCSNYMIQAIEKHGPAKGLAMGTARILRCHPF 60

Query: 115 GSDGFDPVPDDLPPKKN 131
              G+D VPD    ++N
Sbjct: 61  CQPGYDLVPDHFSLRRN 77


>gi|148241721|ref|YP_001226878.1| hypothetical protein SynRCC307_0622 [Synechococcus sp. RCC307]
 gi|147850031|emb|CAK27525.1| Uncharacterized conserved membrane protein [Synechococcus sp.
           RCC307]
          Length = 93

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 31/60 (51%), Positives = 42/60 (70%)

Query: 65  IYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVPD 124
           IY+ + S + G  CRY+PTCS Y  EA+ R+G   GSWLTL RL++C+P    G+DPVP+
Sbjct: 34  IYRRLISPLLGPRCRYVPTCSSYAVEAVQRHGALRGSWLTLKRLLRCHPFAEGGYDPVPE 93


>gi|289422425|ref|ZP_06424268.1| conserved hypothetical protein [Peptostreptococcus anaerobius
           653-L]
 gi|289156997|gb|EFD05619.1| conserved hypothetical protein [Peptostreptococcus anaerobius
           653-L]
          Length = 83

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/63 (44%), Positives = 40/63 (63%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            +G++R YQL  S + G +CR+ PTCS Y  +A  +YG   G WLT+ R+ KC+P    G
Sbjct: 19  AVGLVRFYQLYISPLKGPTCRFYPTCSSYSIQAFKKYGFLKGLWLTIKRVSKCHPFHPGG 78

Query: 119 FDP 121
           +DP
Sbjct: 79  YDP 81


>gi|269958145|ref|YP_003327934.1| hypothetical protein Xcel_3377 [Xylanimonas cellulosilytica DSM
           15894]
 gi|269306826|gb|ACZ32376.1| protein of unknown function DUF37 [Xylanimonas cellulosilytica DSM
           15894]
          Length = 124

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 44/78 (56%)

Query: 50  FPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLI 109
             + L   + +G+IR+YQ++ S + G +C+Y P+CS Y   AI  +G   G  L L R++
Sbjct: 18  ILRDLPTTVLVGMIRVYQVVVSPMTGPTCKYYPSCSHYAVVAIRTHGALRGMGLALWRIL 77

Query: 110 KCNPLGSDGFDPVPDDLP 127
           +CNP    G D VP   P
Sbjct: 78  RCNPWSLGGVDDVPPARP 95


>gi|315650197|ref|ZP_07903272.1| alpha-hemolysin [Eubacterium saburreum DSM 3986]
 gi|315487554|gb|EFU77862.1| alpha-hemolysin [Eubacterium saburreum DSM 3986]
          Length = 78

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 29/73 (39%), Positives = 45/73 (61%), Gaps = 1/73 (1%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNV-FGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            +L +   I +IR YQ+  S +     C Y PTCS+Y  EA+ ++G+  G+WL + R+++
Sbjct: 6   NSLVKTGMIKLIRFYQIFLSPLKVRTHCIYTPTCSQYAIEALKKHGIVKGTWLGIWRILR 65

Query: 111 CNPLGSDGFDPVP 123
           CNP    G+DPVP
Sbjct: 66  CNPFAKGGYDPVP 78


>gi|119383625|ref|YP_914681.1| hypothetical protein Pden_0874 [Paracoccus denitrificans PD1222]
 gi|166228768|sp|A1B0E1|Y874_PARDP RecName: Full=UPF0161 protein Pden_0874
 gi|119373392|gb|ABL68985.1| protein of unknown function DUF37 [Paracoccus denitrificans PD1222]
          Length = 80

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 43/69 (62%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           +R Y+L+ S   G+ CR+ PTCS Y  EA+ R+G   G WL   R+ +C+P G  GFDPV
Sbjct: 12  VRAYRLVASPWVGHGCRFQPTCSAYALEALERHGAAKGGWLAARRVCRCHPWGGHGFDPV 71

Query: 123 PDDLPPKKN 131
           P    P+++
Sbjct: 72  PGSEAPRQD 80


>gi|315925608|ref|ZP_07921818.1| alpha-hemolysin [Pseudoramibacter alactolyticus ATCC 23263]
 gi|315621149|gb|EFV01120.1| alpha-hemolysin [Pseudoramibacter alactolyticus ATCC 23263]
          Length = 74

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 30/65 (46%), Positives = 41/65 (63%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            + +IR YQ + S     SCR+ PTCS Y YEAI +YG   G WL + R+++C+P    G
Sbjct: 10  MLFLIRGYQRVISPFLPRSCRFYPTCSNYCYEAIQKYGPRKGLWLGMKRVVRCHPFNPGG 69

Query: 119 FDPVP 123
           +DPVP
Sbjct: 70  YDPVP 74


>gi|224367783|ref|YP_002601946.1| hypothetical protein HRM2_06680 [Desulfobacterium autotrophicum
           HRM2]
 gi|259647104|sp|C0QIZ2|Y668_DESAH RecName: Full=UPF0161 protein HRM2_06680
 gi|223690499|gb|ACN13782.1| conserved hypothetical protein [Desulfobacterium autotrophicum
           HRM2]
          Length = 70

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 27/70 (38%), Positives = 45/70 (64%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + +   + +I++YQ   S + G +CR+ PTCS+Y +EA+  +G   GS L + R++KC+P
Sbjct: 1   MVKRSILLLIKVYQYFISPLTGPTCRFYPTCSQYAFEAVMIHGSLKGSCLAVRRILKCHP 60

Query: 114 LGSDGFDPVP 123
               G+DPVP
Sbjct: 61  FHPGGYDPVP 70


>gi|241765815|ref|ZP_04763755.1| protein of unknown function DUF37 [Acidovorax delafieldii 2AN]
 gi|241364297|gb|EER59452.1| protein of unknown function DUF37 [Acidovorax delafieldii 2AN]
          Length = 98

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 50/74 (67%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + + +G+++ Y+L+ S   G++CR+ PTCS Y  +A+ ++G   GS+LT+ RL++C+P
Sbjct: 2   IMQRLLMGVVKGYRLLLSPWLGSACRFEPTCSAYSLQALQQHGAAAGSYLTVRRLVRCHP 61

Query: 114 LGSDGFDPVPDDLP 127
               G DPVP  LP
Sbjct: 62  WCDGGHDPVPQQLP 75


>gi|256826457|ref|YP_003150417.1| hypothetical protein Ksed_27020 [Kytococcus sedentarius DSM 20547]
 gi|256689850|gb|ACV07652.1| conserved hypothetical protein TIGR00278 [Kytococcus sedentarius
           DSM 20547]
          Length = 105

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 25/65 (38%), Positives = 36/65 (55%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           +  YQ + S +    CRY P+CS Y   A+  +G   G+WL+  R+ +CNP    G+DPV
Sbjct: 18  VWTYQRLISPLLPPMCRYYPSCSAYAVTALTEHGALRGTWLSTWRVARCNPWSHGGYDPV 77

Query: 123 PDDLP 127
           P   P
Sbjct: 78  PGTDP 82


>gi|163786102|ref|ZP_02180550.1| hypothetical protein FBALC1_12992 [Flavobacteriales bacterium
           ALC-1]
 gi|159877962|gb|EDP72018.1| hypothetical protein FBALC1_12992 [Flavobacteriales bacterium
           ALC-1]
          Length = 69

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/66 (42%), Positives = 40/66 (60%)

Query: 60  IGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGF 119
           + +I+IYQ + S +   +CRY PTCS Y  EA+  +G + G  L + R+  C+P G  GF
Sbjct: 1   MFLIKIYQTLISPITPATCRYQPTCSHYAKEALEVHGFFKGGKLAIKRIFSCHPFGGKGF 60

Query: 120 DPVPDD 125
           DPVP  
Sbjct: 61  DPVPKK 66


>gi|217966560|ref|YP_002352066.1| protein of unknown function DUF37 [Dictyoglomus turgidum DSM 6724]
 gi|217335659|gb|ACK41452.1| protein of unknown function DUF37 [Dictyoglomus turgidum DSM 6724]
          Length = 85

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/72 (38%), Positives = 42/72 (58%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + + I +I+ Y+   S V   SCR+ PTCS Y  EAI R+G   G  L + R+++C+P
Sbjct: 1   MIKNLLIILIKFYKKFISPVLPRSCRFYPTCSTYAMEAIERFGPIDGGILAIKRILRCHP 60

Query: 114 LGSDGFDPVPDD 125
               G+DPVP  
Sbjct: 61  FNPGGYDPVPTK 72


>gi|289550459|ref|YP_003471363.1| YidD [Staphylococcus lugdunensis HKU09-01]
 gi|315657949|ref|ZP_07910823.1| alpha-hemolysin [Staphylococcus lugdunensis M23590]
 gi|289179991|gb|ADC87236.1| YidD [Staphylococcus lugdunensis HKU09-01]
 gi|315496985|gb|EFU85306.1| alpha-hemolysin [Staphylococcus lugdunensis M23590]
          Length = 85

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/83 (39%), Positives = 49/83 (59%), Gaps = 4/83 (4%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            K L + + + +I +YQ   S +   +CR+ PTCSEY  EAI  YG   G+++ + R++K
Sbjct: 1   MKKLLQKLFLSLIYVYQHFISPMTPATCRFYPTCSEYTREAIVVYGPLKGTYMGIRRILK 60

Query: 111 CNPLGSDGFDPVPDDLPPKKNNP 133
           C+P    GFDPVP     KK+N 
Sbjct: 61  CHPFHKGGFDPVP----LKKDNK 79


>gi|237651141|ref|ZP_04525393.1| hypothetical protein SpneC1_10607 [Streptococcus pneumoniae CCRI
           1974]
 gi|237820919|ref|ZP_04596764.1| hypothetical protein SpneC19_01069 [Streptococcus pneumoniae CCRI
           1974M2]
          Length = 80

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 30/77 (38%), Positives = 43/77 (55%), Gaps = 1/77 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I  +R YQ   S VF  SCR+  TCS Y  +AI ++G + G  + L R+++C+P 
Sbjct: 1   MKRILIAPVRFYQRFISPVFPPSCRFELTCSNYMIQAIEKHG-FKGVLMGLARILRCHPW 59

Query: 115 GSDGFDPVPDDLPPKKN 131
              G DPVPD    K+ 
Sbjct: 60  SKTGKDPVPDHFSLKRK 76


>gi|239616663|ref|YP_002939985.1| protein of unknown function DUF37 [Kosmotoga olearia TBF 19.5.1]
 gi|259646872|sp|C5CD37|Y256_KOSOT RecName: Full=UPF0161 protein Kole_0256
 gi|239505494|gb|ACR78981.1| protein of unknown function DUF37 [Kosmotoga olearia TBF 19.5.1]
          Length = 80

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 46/80 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I + +I  Y+   S     +CR+ PTCS Y +EA+ R+G++ G  L   R+++CNP 
Sbjct: 1   MKKIVLTLINFYRKYISPSKPPTCRFTPTCSAYTFEAVQRFGVFKGLLLGTWRILRCNPF 60

Query: 115 GSDGFDPVPDDLPPKKNNPK 134
              G+DPVP++    + N K
Sbjct: 61  NKGGYDPVPEEFKLLRRNTK 80


>gi|56752481|ref|YP_173182.1| hypothetical protein syc2472_c [Synechococcus elongatus PCC 6301]
 gi|81300295|ref|YP_400503.1| hypothetical protein Synpcc7942_1486 [Synechococcus elongatus PCC
           7942]
 gi|81561212|sp|Q5MZ58|Y2472_SYNP6 RecName: Full=UPF0161 protein syc2472_c
 gi|116256137|sp|Q31N53|Y1486_SYNE7 RecName: Full=UPF0161 protein Synpcc7942_1486
 gi|56687440|dbj|BAD80662.1| hypothetical protein [Synechococcus elongatus PCC 6301]
 gi|81169176|gb|ABB57516.1| Protein of unknown function DUF37 [Synechococcus elongatus PCC
           7942]
          Length = 82

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 32/69 (46%), Positives = 47/69 (68%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +L+ + +I+ Y+   S +   SCR+ PTCS+YG EAI R+G   GSWLTL R+++C+P 
Sbjct: 1   MKLLLLALIQFYRRWISPLTPASCRFYPTCSQYGLEAIDRFGPLKGSWLTLCRILRCHPF 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  HPGGYDPVP 69


>gi|237716894|ref|ZP_04547375.1| conserved hypothetical protein [Bacteroides sp. D1]
 gi|237720659|ref|ZP_04551140.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|262405662|ref|ZP_06082212.1| conserved hypothetical protein [Bacteroides sp. 2_1_22]
 gi|229442877|gb|EEO48668.1| conserved hypothetical protein [Bacteroides sp. D1]
 gi|229450410|gb|EEO56201.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|262356537|gb|EEZ05627.1| conserved hypothetical protein [Bacteroides sp. 2_1_22]
          Length = 91

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 26/75 (34%), Positives = 42/75 (56%)

Query: 49  KFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRL 108
              + +     +  I  Y++  S +   SCR+ PTCS Y  EAI ++G   G +L + R+
Sbjct: 17  GILRKVFSFFLLAPIYFYRICISPLTPPSCRFTPTCSAYALEAIKKHGPIKGLYLAVRRI 76

Query: 109 IKCNPLGSDGFDPVP 123
           ++C+P G  G+DPVP
Sbjct: 77  LRCHPWGGSGYDPVP 91


>gi|163814991|ref|ZP_02206378.1| hypothetical protein COPEUT_01144 [Coprococcus eutactus ATCC 27759]
 gi|158449674|gb|EDP26669.1| hypothetical protein COPEUT_01144 [Coprococcus eutactus ATCC 27759]
          Length = 70

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 31/70 (44%), Positives = 46/70 (65%), Gaps = 1/70 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGN-SCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
            + I IG+IR Y+   S + G+ +C+Y PTCS+Y  EAI +YG+  G  L + R+++CNP
Sbjct: 1   MKKIFIGLIRFYRKYLSPLKGHATCKYFPTCSQYAIEAIEKYGVLKGGLLAVWRILRCNP 60

Query: 114 LGSDGFDPVP 123
               G+DPVP
Sbjct: 61  FSKGGYDPVP 70


>gi|90415381|ref|ZP_01223315.1| hypothetical protein GB2207_08696 [marine gamma proteobacterium
           HTCC2207]
 gi|90332704|gb|EAS47874.1| hypothetical protein GB2207_08696 [marine gamma proteobacterium
           HTCC2207]
          Length = 91

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 29/65 (44%), Positives = 44/65 (67%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
           + + +I+ YQ   S + G++CR+ P+CS Y  EA  R+G+  G +LTLLR++KC P  S 
Sbjct: 5   LIVRLIKAYQYAISPLLGSNCRFYPSCSHYAEEAFRRFGVVKGGYLTLLRIVKCQPFHSG 64

Query: 118 GFDPV 122
           G+DPV
Sbjct: 65  GYDPV 69


>gi|332199893|gb|EGJ13968.1| hypothetical protein SPAR69_1805 [Streptococcus pneumoniae GA41317]
          Length = 80

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 43/77 (55%), Gaps = 1/77 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I  +R YQ   S VF  SCR+  TCS Y  +AI ++G + G  + L R++ C+P 
Sbjct: 1   MKRILIAPVRFYQRFISPVFPPSCRFELTCSNYMIQAIEKHG-FKGVLMGLARILCCHPW 59

Query: 115 GSDGFDPVPDDLPPKKN 131
              G DPVPD    K+N
Sbjct: 60  SKTGKDPVPDHFSLKRN 76


>gi|16803710|ref|NP_465195.1| hypothetical protein lmo1670 [Listeria monocytogenes EGD-e]
 gi|47096743|ref|ZP_00234327.1| conserved hypothetical protein [Listeria monocytogenes str. 1/2a
           F6854]
 gi|224499252|ref|ZP_03667601.1| hypothetical protein LmonF1_05977 [Listeria monocytogenes Finland
           1988]
 gi|224503664|ref|ZP_03671971.1| hypothetical protein LmonFR_14360 [Listeria monocytogenes FSL
           R2-561]
 gi|254829636|ref|ZP_05234323.1| conserved hypothetical protein [Listeria monocytogenes FSL N3-165]
 gi|254832073|ref|ZP_05236728.1| hypothetical protein Lmon1_11990 [Listeria monocytogenes 10403S]
 gi|254898163|ref|ZP_05258087.1| hypothetical protein LmonJ_00070 [Listeria monocytogenes J0161]
 gi|254912344|ref|ZP_05262356.1| conserved hypothetical protein [Listeria monocytogenes J2818]
 gi|254936671|ref|ZP_05268368.1| conserved hypothetical protein [Listeria monocytogenes F6900]
 gi|255026832|ref|ZP_05298818.1| hypothetical protein LmonocytFSL_11811 [Listeria monocytogenes FSL
           J2-003]
 gi|255029527|ref|ZP_05301478.1| hypothetical protein LmonL_11393 [Listeria monocytogenes LO28]
 gi|284802062|ref|YP_003413927.1| hypothetical protein LM5578_1817 [Listeria monocytogenes 08-5578]
 gi|284995204|ref|YP_003416972.1| hypothetical protein LM5923_1769 [Listeria monocytogenes 08-5923]
 gi|25009618|sp|Q8Y6L4|Y1670_LISMO RecName: Full=UPF0161 protein lmo1670
 gi|16411106|emb|CAC99748.1| lmo1670 [Listeria monocytogenes EGD-e]
 gi|47014875|gb|EAL05824.1| conserved hypothetical protein [Listeria monocytogenes str. 1/2a
           F6854]
 gi|258602054|gb|EEW15379.1| conserved hypothetical protein [Listeria monocytogenes FSL N3-165]
 gi|258609267|gb|EEW21875.1| conserved hypothetical protein [Listeria monocytogenes F6900]
 gi|284057624|gb|ADB68565.1| hypothetical protein LM5578_1817 [Listeria monocytogenes 08-5578]
 gi|284060671|gb|ADB71610.1| hypothetical protein LM5923_1769 [Listeria monocytogenes 08-5923]
 gi|293590325|gb|EFF98659.1| conserved hypothetical protein [Listeria monocytogenes J2818]
          Length = 88

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 34/78 (43%), Positives = 43/78 (55%), Gaps = 3/78 (3%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I IG IR+YQ   S     +CR+ PTCS YG EAI  +G   GS+L + R+ KC+P 
Sbjct: 1   MKKILIGGIRLYQKYISRFTPATCRFYPTCSAYGIEAIQTHGALKGSYLAIRRISKCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G D VP   P K  N
Sbjct: 61  HKGGLDFVP---PKKDKN 75


>gi|329944745|ref|ZP_08292824.1| conserved hypothetical protein YidD [Actinomyces sp. oral taxon 170
           str. F0386]
 gi|328529881|gb|EGF56771.1| conserved hypothetical protein YidD [Actinomyces sp. oral taxon 170
           str. F0386]
          Length = 94

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/76 (38%), Positives = 41/76 (53%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            +  +R+YQ   S +   SCRY PTCS Y   A+  +G   G  L   RL++CNPL   G
Sbjct: 9   LLAPVRLYQRFISPLLPASCRYYPTCSAYAVTAVEVHGPIKGVLLATWRLLRCNPLTPGG 68

Query: 119 FDPVPDDLPPKKNNPK 134
            D VPD    + ++P+
Sbjct: 69  VDHVPDKGRWRYDHPR 84


>gi|308069628|ref|YP_003871233.1| hypothetical protein PPE_02870 [Paenibacillus polymyxa E681]
 gi|305858907|gb|ADM70695.1| Conserved hypothetical protein [Paenibacillus polymyxa E681]
          Length = 96

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/84 (35%), Positives = 41/84 (48%), Gaps = 3/84 (3%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            K   R +    I+ Y+   S +   +CR+ PTCS Y  EA+  +G   GSWL   R+ K
Sbjct: 1   MKITTRRVVQAPIKFYRSYISPLKPATCRFYPTCSAYALEAVEVHGALKGSWLAAKRIAK 60

Query: 111 CNPLGSDGFDPVPDDLPPKKNNPK 134
           C+P    G D VP   P KK   +
Sbjct: 61  CHPFHPGGVDLVP---PAKKGTDR 81


>gi|113869680|ref|YP_728169.1| hypothetical protein H16_A3745 [Ralstonia eutropha H16]
 gi|122946485|sp|Q0K5C0|Y3745_RALEH RecName: Full=UPF0161 protein H16_A3745
 gi|113528456|emb|CAJ94801.1| Alpha-hemolysin [Ralstonia eutropha H16]
          Length = 103

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/69 (40%), Positives = 44/69 (63%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I + ++RIY++  S   G+ CR+LPTCS+Y  +A+  +G   GSW+   RL +C+P 
Sbjct: 1   MKPILLALLRIYKIALSPYLGSRCRFLPTCSDYARDAVIHHGAARGSWMAACRLCRCHPF 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  AQGGYDPVP 69


>gi|218131653|ref|ZP_03460457.1| hypothetical protein BACEGG_03274 [Bacteroides eggerthii DSM 20697]
 gi|317474724|ref|ZP_07933998.1| hypothetical protein HMPREF1016_00977 [Bacteroides eggerthii
           1_2_48FAA]
 gi|217985956|gb|EEC52295.1| hypothetical protein BACEGG_03274 [Bacteroides eggerthii DSM 20697]
 gi|316909405|gb|EFV31085.1| hypothetical protein HMPREF1016_00977 [Bacteroides eggerthii
           1_2_48FAA]
          Length = 73

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/73 (39%), Positives = 44/73 (60%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            K L   + +  I  YQ   S +   SCR+ PTCS+Y  EAI ++G + G +L + R+++
Sbjct: 1   MKRLFSYLLLLPIYFYQKCISPMTSPSCRFTPTCSQYAVEAIKKHGPFKGLYLAIRRVLR 60

Query: 111 CNPLGSDGFDPVP 123
           C+P G  G+DPVP
Sbjct: 61  CHPWGGSGYDPVP 73


>gi|217964181|ref|YP_002349859.1| hypothetical protein LMHCC_0896 [Listeria monocytogenes HCC23]
 gi|254807262|sp|B8DFQ2|Y896_LISMH RecName: Full=UPF0161 protein LMHCC_0896
 gi|217333451|gb|ACK39245.1| conserved hypothetical protein [Listeria monocytogenes HCC23]
 gi|307571252|emb|CAR84431.1| conserved hypothetical protein [Listeria monocytogenes L99]
          Length = 88

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 34/78 (43%), Positives = 43/78 (55%), Gaps = 3/78 (3%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I IG IR+YQ   S     +CR+ PTCS YG EAI  +G   GS+L + R+ KC+P 
Sbjct: 1   MKKILIGGIRLYQKYISRFTPATCRFYPTCSAYGIEAIQTHGALKGSYLAIRRISKCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G D VP   P K  N
Sbjct: 61  HKGGLDFVP---PKKDKN 75


>gi|25011681|ref|NP_736076.1| hypothetical protein gbs1641 [Streptococcus agalactiae NEM316]
 gi|29428196|sp|Q8E3W3|Y1641_STRA3 RecName: Full=UPF0161 protein gbs1641
 gi|24413221|emb|CAD47300.1| Unknown [Streptococcus agalactiae NEM316]
          Length = 83

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + +   I ++R YQ   S  F  SCRY PTCS Y  EAI ++G   G  + + R+++C+P
Sbjct: 1   MLKSFLIFLVRFYQKNISPAFPASCRYCPTCSTYMIEAIQKHG-LKGVLMGIARILRCHP 59

Query: 114 LGSDGFDPVPDDLPPKKNNP 133
           L   G DPVPD    ++N  
Sbjct: 60  LAHGGNDPVPDHFSLRRNKT 79


>gi|330840119|ref|YP_004414699.1| UPF0161 protein yidD [Selenomonas sputigena ATCC 35185]
 gi|329747883|gb|AEC01240.1| UPF0161 protein yidD [Selenomonas sputigena ATCC 35185]
          Length = 69

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/69 (40%), Positives = 45/69 (65%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +++ + +IR Y+   S +   SCRY+PTCSEY   A+ +YG   GS+L + R+++C+P 
Sbjct: 1   MKVVLLLLIRFYRGFLSPLKPPSCRYIPTCSEYAMIAVEKYGAAKGSFLAIKRILRCHPF 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  HKGGYDPVP 69


>gi|168491812|ref|ZP_02715955.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC0288-04]
 gi|183573850|gb|EDT94378.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC0288-04]
          Length = 80

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/77 (38%), Positives = 43/77 (55%), Gaps = 1/77 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I  +R YQ   S VF  SCR+  TCS Y  +AI ++G + G  + L R+++C+P 
Sbjct: 1   MKRILIAPVRFYQRFISPVFPPSCRFELTCSNYMIQAIEKHG-FKGVLMGLARILRCHPW 59

Query: 115 GSDGFDPVPDDLPPKKN 131
              G DPV D    K+N
Sbjct: 60  SKTGKDPVSDHFSLKRN 76


>gi|332291037|ref|YP_004429646.1| protein of unknown function DUF37 [Krokinobacter diaphorus
           4H-3-7-5]
 gi|332169123|gb|AEE18378.1| protein of unknown function DUF37 [Krokinobacter diaphorus
           4H-3-7-5]
          Length = 84

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/67 (44%), Positives = 42/67 (62%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            +G+I  YQ   S+   +SCRY PTCS Y   A+ R+GL  G WL++ R+  C+P G  G
Sbjct: 12  FLGLIWFYQKFISSWTPSSCRYSPTCSSYTKTALERHGLITGGWLSIKRIFSCHPWGGQG 71

Query: 119 FDPVPDD 125
           +DPVP+ 
Sbjct: 72  YDPVPEK 78


>gi|313847703|emb|CBY16691.1| conserved hypothetical protein [Chlamydophila psittaci RD1]
 gi|328914345|gb|AEB55178.1| conserved hypothetical protein [Chlamydophila psittaci 6BC]
          Length = 103

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 25/75 (33%), Positives = 39/75 (52%)

Query: 49  KFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRL 108
           +  + L   +   +I +Y+   S + G+ CR+ PTCSEY  +A+  +    G WL + R+
Sbjct: 5   QLIQNLPTRLCCSLIHLYRWTISPLLGSPCRFFPTCSEYALQALKHHKCMKGLWLIIKRI 64

Query: 109 IKCNPLGSDGFDPVP 123
            KC P    G D VP
Sbjct: 65  GKCGPWHPGGIDLVP 79


>gi|294138799|ref|YP_003554777.1| hypothetical protein SVI_0028 [Shewanella violacea DSS12]
 gi|293325268|dbj|BAI99998.1| conserved hypothetical protein [Shewanella violacea DSS12]
          Length = 85

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 34/76 (44%), Positives = 45/76 (59%), Gaps = 1/76 (1%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFG-NSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLI 109
             +  + +   IIR YQ++ S + G N CR+ PTCS Y  EAI  +G   GSWLT  R++
Sbjct: 4   THSPLQWLATTIIRGYQILISPLLGTNKCRFHPTCSYYAIEAIHLHGFVKGSWLTAKRVL 63

Query: 110 KCNPLGSDGFDPVPDD 125
           KC+PL   G DPVP  
Sbjct: 64  KCHPLHPGGIDPVPSK 79


>gi|253582577|ref|ZP_04859798.1| ribonuclease P [Fusobacterium varium ATCC 27725]
 gi|251835447|gb|EES63987.1| ribonuclease P [Fusobacterium varium ATCC 27725]
          Length = 79

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 32/79 (40%), Positives = 47/79 (59%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I + +IR YQ   S   G +CR++PTCS Y YEAI R+G+  G  L + R++KC+P 
Sbjct: 1   MKKIILCMIRFYQKYISIFLGKNCRFIPTCSAYTYEAIERFGVIKGMCLGIKRIVKCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNNP 133
              GFDPVP+     + + 
Sbjct: 61  NPGGFDPVPEKKKKVREDK 79


>gi|289665716|ref|ZP_06487297.1| hypothetical protein XcampvN_22229 [Xanthomonas campestris pv.
           vasculorum NCPPB702]
 gi|289671271|ref|ZP_06492346.1| hypothetical protein XcampmN_23020 [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 99

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 34/71 (47%), Positives = 46/71 (64%), Gaps = 1/71 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           +GRL+ I ++R Y+L  S + G  CR+ P+CSEY   AI R+G   GSWL   RL +C+P
Sbjct: 10  IGRLL-IALLRFYKLFISPLLGPRCRFAPSCSEYAMTAIGRFGPLRGSWLAACRLGRCHP 68

Query: 114 LGSDGFDPVPD 124
               GFDPVP+
Sbjct: 69  FHPGGFDPVPE 79


>gi|254462905|ref|ZP_05076321.1| conserved hypothetical protein TIGR00278 [Rhodobacterales bacterium
           HTCC2083]
 gi|206679494|gb|EDZ43981.1| conserved hypothetical protein TIGR00278 [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 73

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 32/72 (44%), Positives = 44/72 (61%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           +    I    +R+Y+L+FS   G +CRY PTCS Y  EA+ ++G   GSWL   R+ +C+
Sbjct: 2   SPLAHIIALPVRVYRLVFSPWVGFNCRYHPTCSAYAMEALEKHGAIKGSWLAARRIGRCH 61

Query: 113 PLGSDGFDPVPD 124
           P GS G D VPD
Sbjct: 62  PWGSSGVDNVPD 73


>gi|189348961|ref|YP_001944589.1| hypothetical protein BMULJ_00073 [Burkholderia multivorans ATCC
           17616]
 gi|221214578|ref|ZP_03587548.1| conserved hypothetical protein TIGR00278 [Burkholderia multivorans
           CGD1]
 gi|189332983|dbj|BAG42053.1| conserved hypothetical protein [Burkholderia multivorans ATCC
           17616]
 gi|221165468|gb|EED97944.1| conserved hypothetical protein TIGR00278 [Burkholderia multivorans
           CGD1]
          Length = 88

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 24/76 (31%), Positives = 43/76 (56%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + +   ++R Y++  S + GN CR+ P+CS+Y  EAI  +G   G++L + R+ +C+P 
Sbjct: 1   MKTVLTALLRFYKVAVSPLLGNRCRFYPSCSDYAREAIQYHGAARGTYLAVRRVCRCHPF 60

Query: 115 GSDGFDPVPDDLPPKK 130
            + G D VP      +
Sbjct: 61  SAGGIDLVPPPNSDTR 76


>gi|148274160|ref|YP_001223721.1| hypothetical protein CMM_2976 [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
 gi|189039802|sp|A5CVC4|Y2976_CLAM3 RecName: Full=UPF0161 protein CMM_2976
 gi|147832090|emb|CAN03063.1| conserved hypothetical protein [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
          Length = 103

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 27/69 (39%), Positives = 40/69 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R   I +I +Y+ + S ++G+ CRY P+CS YG EA+  +GL  G  L   R+ +C+P 
Sbjct: 12  PRNAAIAVISLYRRVVSPIYGDVCRYYPSCSAYGLEAVQEHGLVHGGVLAAWRVCRCHPW 71

Query: 115 GSDGFDPVP 123
              G D VP
Sbjct: 72  AEGGIDDVP 80


>gi|84517256|ref|ZP_01004611.1| hypothetical protein SKA53_00415 [Loktanella vestfoldensis SKA53]
 gi|84508931|gb|EAQ05393.1| hypothetical protein SKA53_00415 [Loktanella vestfoldensis SKA53]
          Length = 73

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 32/72 (44%), Positives = 42/72 (58%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           T    I    +R Y+LIFS   G +CRY PTCS Y  EA+ ++G   G WL   R+++C+
Sbjct: 2   TPFAYILSLPVRAYRLIFSPWVGFNCRYHPTCSAYALEALEKHGAIKGGWLAFRRILRCH 61

Query: 113 PLGSDGFDPVPD 124
           P G  G D VPD
Sbjct: 62  PWGRSGIDNVPD 73


>gi|260910552|ref|ZP_05917219.1| conserved hypothetical protein [Prevotella sp. oral taxon 472 str.
           F0295]
 gi|260635323|gb|EEX53346.1| conserved hypothetical protein [Prevotella sp. oral taxon 472 str.
           F0295]
          Length = 83

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/70 (42%), Positives = 43/70 (61%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           +   + +  IR YQL  S     SCR+ P+CSEY  +AI ++G + G  L + RL++CNP
Sbjct: 14  MAVWLLLLPIRFYQLAISPYTPPSCRFTPSCSEYARQAIIKHGPFKGLVLAVWRLLRCNP 73

Query: 114 LGSDGFDPVP 123
            G  G+DPVP
Sbjct: 74  WGGSGYDPVP 83


>gi|268610507|ref|ZP_06144234.1| hypothetical protein RflaF_13557 [Ruminococcus flavefaciens FD-1]
          Length = 98

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 43/79 (54%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I + +I  Y+   S +    C+Y PTCS Y Y+A+ RYG   GS L + RL++CNP 
Sbjct: 1   MKRIILSLINFYRKCISPLTPPKCKYYPTCSCYAYKAVERYGALRGSALAVWRLLRCNPW 60

Query: 115 GSDGFDPVPDDLPPKKNNP 133
              G DPVPD    ++   
Sbjct: 61  SMGGIDPVPDKFTFRRQKT 79


>gi|157368278|ref|YP_001476267.1| hypothetical protein Spro_0029 [Serratia proteamaculans 568]
 gi|166919098|sp|A8G7P9|Y029_SERP5 RecName: Full=UPF0161 protein Spro_0029
 gi|157320042|gb|ABV39139.1| protein of unknown function DUF37 [Serratia proteamaculans 568]
          Length = 85

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/68 (48%), Positives = 46/68 (67%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
           P + G  I IG++R YQL+ S + G  CR+ PTCS Y  EA++R+G+  GSWL L R++K
Sbjct: 4   PLSPGSRILIGLVRAYQLVISPLLGPRCRFQPTCSHYAIEALSRFGMIKGSWLALKRVLK 63

Query: 111 CNPLGSDG 118
           C+PL   G
Sbjct: 64  CHPLNPGG 71


>gi|120613421|ref|YP_973099.1| hypothetical protein Aave_4794 [Acidovorax citrulli AAC00-1]
 gi|120591885|gb|ABM35325.1| protein of unknown function DUF37 [Acidovorax citrulli AAC00-1]
          Length = 105

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 45/74 (60%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + R + + ++R Y+   S   G++CR+ PTCS Y  +A+ R+G   GS+LTL RL +C+P
Sbjct: 1   MMRSLLMALVRGYRFFLSPWLGSACRFEPTCSAYALQALERHGAGAGSYLTLRRLARCHP 60

Query: 114 LGSDGFDPVPDDLP 127
               G DPV  + P
Sbjct: 61  WCDGGHDPVSAEAP 74


>gi|238028970|ref|YP_002913201.1| hypothetical protein bglu_1g34390 [Burkholderia glumae BGR1]
 gi|237878164|gb|ACR30497.1| Hypothetical protein bglu_1g34390 [Burkholderia glumae BGR1]
          Length = 88

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 27/76 (35%), Positives = 43/76 (56%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I ++R Y+   S + G+ CR+ P+CSEY  EAI  +G   G++L   RL +C+P 
Sbjct: 1   MQTVLIALLRFYKAAVSPLLGSRCRFYPSCSEYAREAIQYHGAARGTYLAARRLCRCHPF 60

Query: 115 GSDGFDPVPDDLPPKK 130
            + G D VP   P  +
Sbjct: 61  SAGGVDLVPPPNPDTR 76


>gi|99080152|ref|YP_612306.1| hypothetical protein TM1040_0311 [Ruegeria sp. TM1040]
 gi|116256222|sp|Q1GJX2|Y311_SILST RecName: Full=UPF0161 protein TM1040_0311
 gi|99036432|gb|ABF63044.1| protein of unknown function DUF37 [Ruegeria sp. TM1040]
          Length = 86

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 34/78 (43%), Positives = 50/78 (64%), Gaps = 1/78 (1%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            + L RLI +  +R Y+L+FS   G +CRY PTCS Y  +A+ R+G + G++L L R+ +
Sbjct: 1   MRLLARLIAL-PVRGYRLLFSPWVGFNCRYQPTCSAYALDALERHGPFKGTYLMLRRIGR 59

Query: 111 CNPLGSDGFDPVPDDLPP 128
           C+P G  G+DPVP   P 
Sbjct: 60  CHPFGGSGYDPVPGADPK 77


>gi|262204660|ref|YP_003275868.1| hypothetical protein Gbro_4862 [Gordonia bronchialis DSM 43247]
 gi|262088007|gb|ACY23975.1| protein of unknown function DUF37 [Gordonia bronchialis DSM 43247]
          Length = 115

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 48/82 (58%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           + L R   I +I +Y+   S +   +CR+ PTCS Y  EA+ R+G   G WL+++RL+KC
Sbjct: 28  RLLPRRTLIFVIELYRTWISPMRLPTCRFEPTCSGYAVEALERHGFRYGGWLSVIRLLKC 87

Query: 112 NPLGSDGFDPVPDDLPPKKNNP 133
            P    G+DPVP+D    +  P
Sbjct: 88  GPWHKPGYDPVPEDGFRWRRPP 109


>gi|302877174|ref|YP_003845807.1| hypothetical protein Clocel_4387 [Clostridium cellulovorans 743B]
 gi|302580031|gb|ADL54043.1| protein of unknown function DUF37 [Clostridium cellulovorans 743B]
          Length = 72

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 46/68 (67%), Gaps = 1/68 (1%)

Query: 56  RLIGIGIIRIYQLIFSNVFG-NSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
           + I I II+ Y+   S + G  +C++LPTCS+Y  EA+ ++G+  G ++ L R+++CNP 
Sbjct: 4   KRILIKIIKFYRKYISPLKGTPTCKFLPTCSQYAIEALEKHGVIRGGFMALKRVLRCNPF 63

Query: 115 GSDGFDPV 122
            S G+DPV
Sbjct: 64  SSGGYDPV 71


>gi|149911782|ref|ZP_01900386.1| hypothetical protein PE36_15450 [Moritella sp. PE36]
 gi|149805128|gb|EDM65150.1| hypothetical protein PE36_15450 [Moritella sp. PE36]
          Length = 76

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 32/71 (45%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + +G  +IR YQL  S + G  CR+ PTCS+Y  E+I  +G   G WLT  RL+ C+P 
Sbjct: 1   MQWLGTKLIRGYQLFISPIIGPRCRFTPTCSQYAIESIKLHGFTKGCWLTAKRLLICHPF 60

Query: 115 -GSDGFDPVPD 124
               G+DPVPD
Sbjct: 61  SNKHGYDPVPD 71


>gi|88854497|ref|ZP_01129164.1| alpha-hemolysin [marine actinobacterium PHSC20C1]
 gi|88816305|gb|EAR26160.1| alpha-hemolysin [marine actinobacterium PHSC20C1]
          Length = 103

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 26/75 (34%), Positives = 47/75 (62%)

Query: 49  KFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRL 108
            F   + R   + I+R+Y+++ S ++G+ CRY P+CS Y  +AI ++G++ G WL   R+
Sbjct: 6   TFAMLIPRNFCVLILRVYRIVISPLYGDVCRYYPSCSHYTLQAIQQHGVFRGVWLGSRRI 65

Query: 109 IKCNPLGSDGFDPVP 123
           ++C+P    G D +P
Sbjct: 66  LRCHPWAEGGIDDIP 80


>gi|291285981|ref|YP_003502797.1| hypothetical protein Dacet_0035 [Denitrovibrio acetiphilus DSM
           12809]
 gi|290883141|gb|ADD66841.1| protein of unknown function DUF37 [Denitrovibrio acetiphilus DSM
           12809]
          Length = 80

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 27/69 (39%), Positives = 44/69 (63%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I ++R+Y+L  S + GN CR+ P+CS+Y   A+   GL  G+ L++ R+ +CNPL
Sbjct: 12  PKNLLIAVLRLYKLFISPLLGNRCRFYPSCSDYAMTALKEKGLIKGTMLSVWRVARCNPL 71

Query: 115 GSDGFDPVP 123
              G+DPV 
Sbjct: 72  SKGGYDPVK 80


>gi|186477843|ref|YP_001859313.1| hypothetical protein Bphy_3099 [Burkholderia phymatum STM815]
 gi|226703705|sp|B2JJR9|Y3099_BURP8 RecName: Full=UPF0161 protein Bphy_3099
 gi|184194302|gb|ACC72267.1| protein of unknown function DUF37 [Burkholderia phymatum STM815]
          Length = 76

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 27/76 (35%), Positives = 44/76 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + +   ++R Y++  S + GN CR+ P+CS+Y  EAI  +G   G++L   RL +C+P 
Sbjct: 1   MQTVLFALLRFYKIAVSPMLGNRCRFYPSCSDYAREAIQYHGAARGTYLAARRLCRCHPF 60

Query: 115 GSDGFDPVPDDLPPKK 130
            + G D VP   P K+
Sbjct: 61  SAGGIDLVPPPTPKKR 76


>gi|192359284|ref|YP_001984275.1| hypothetical protein CJA_3824 [Cellvibrio japonicus Ueda107]
 gi|226706058|sp|B3PIU2|Y3824_CELJU RecName: Full=UPF0161 protein CJA_3824
 gi|190685449|gb|ACE83127.1| conserved hypothetical protein TIGR00278 [Cellvibrio japonicus
           Ueda107]
          Length = 86

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/67 (41%), Positives = 40/67 (59%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
           G+ ++  Y+ + S   GN CR+ P+CS Y  EA+  +G   G +LT  RLIKC+P    G
Sbjct: 5   GVKLLHGYRYLLSPWIGNQCRFYPSCSHYAEEALKTHGFLAGIYLTARRLIKCHPWHPGG 64

Query: 119 FDPVPDD 125
            DPVP+ 
Sbjct: 65  IDPVPEH 71


>gi|332296676|ref|YP_004438598.1| UPF0161 protein yidD [Treponema brennaborense DSM 12168]
 gi|332179779|gb|AEE15467.1| UPF0161 protein yidD [Treponema brennaborense DSM 12168]
          Length = 73

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 43/73 (58%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            K     +   +IR+YQ+  S +F   CR+ PTCS Y  EAI ++G + G  + + R+++
Sbjct: 1   MKNFLTRVLCSLIRLYQVCISPLFPPCCRFYPTCSVYALEAIRKHGPFKGFLMAVRRVLR 60

Query: 111 CNPLGSDGFDPVP 123
           CNP    G+DPVP
Sbjct: 61  CNPFCDGGYDPVP 73


>gi|312142025|ref|YP_004009361.1| hypothetical protein REQ_47440 [Rhodococcus equi 103S]
 gi|325677524|ref|ZP_08157188.1| alpha-hemolysin [Rhodococcus equi ATCC 33707]
 gi|311891364|emb|CBH50685.1| conserved hypothetical protein [Rhodococcus equi 103S]
 gi|325551771|gb|EGD21469.1| alpha-hemolysin [Rhodococcus equi ATCC 33707]
          Length = 112

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 32/100 (32%), Positives = 49/100 (49%), Gaps = 10/100 (10%)

Query: 25  LPIQKKGSPLLLKNNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTC 84
            P  +  S L     T           ++    + I +I +Y+   S +   +CR+ PTC
Sbjct: 11  EPGPRSSSFLGTVWTT----------LRSFPARVLIFLIELYRTYVSPLRLPTCRFTPTC 60

Query: 85  SEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVPD 124
           SEY  +A+  +G   GS LT++RL KC P    G+DPVP+
Sbjct: 61  SEYAVDAMRTHGAIKGSALTVVRLAKCAPWHPGGWDPVPE 100


>gi|289432824|ref|YP_003462697.1| hypothetical protein DehalGT_0878 [Dehalococcoides sp. GT]
 gi|288946544|gb|ADC74241.1| protein of unknown function DUF37 [Dehalococcoides sp. GT]
          Length = 70

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 32/70 (45%), Positives = 50/70 (71%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + + +IR+YQ  +S    +SCR++PTCS+Y YEAI R+G++ G WL + RL +C+PL
Sbjct: 1   MKKLALKLIRLYQNTYSKTAPSSCRFIPTCSQYTYEAIERFGIFKGIWLGVKRLSRCHPL 60

Query: 115 GSDGFDPVPD 124
              G+DPVP+
Sbjct: 61  NKGGYDPVPE 70


>gi|150003758|ref|YP_001298502.1| hypothetical protein BVU_1189 [Bacteroides vulgatus ATCC 8482]
 gi|237709154|ref|ZP_04539635.1| UPF0161 protein [Bacteroides sp. 9_1_42FAA]
 gi|237724365|ref|ZP_04554846.1| conserved hypothetical protein [Bacteroides sp. D4]
 gi|254881013|ref|ZP_05253723.1| conserved hypothetical protein [Bacteroides sp. 4_3_47FAA]
 gi|265752683|ref|ZP_06088252.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
 gi|294777423|ref|ZP_06742874.1| conserved hypothetical protein YidD [Bacteroides vulgatus PC510]
 gi|319640020|ref|ZP_07994747.1| hypothetical protein HMPREF9011_00344 [Bacteroides sp. 3_1_40A]
 gi|166228910|sp|A6KZL6|Y1189_BACV8 RecName: Full=UPF0161 protein BVU_1189
 gi|149932182|gb|ABR38880.1| conserved hypothetical protein [Bacteroides vulgatus ATCC 8482]
 gi|229437234|gb|EEO47311.1| conserved hypothetical protein [Bacteroides dorei 5_1_36/D4]
 gi|229456850|gb|EEO62571.1| UPF0161 protein [Bacteroides sp. 9_1_42FAA]
 gi|254833806|gb|EET14115.1| conserved hypothetical protein [Bacteroides sp. 4_3_47FAA]
 gi|263235869|gb|EEZ21364.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
 gi|294448491|gb|EFG17040.1| conserved hypothetical protein YidD [Bacteroides vulgatus PC510]
 gi|317388298|gb|EFV69150.1| hypothetical protein HMPREF9011_00344 [Bacteroides sp. 3_1_40A]
          Length = 73

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 27/73 (36%), Positives = 45/73 (61%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            K +   + +  +  Y+   S +   SCR++PTCSEY  EAI ++G + G +L + R+++
Sbjct: 1   MKKILSYLLLLPVYFYRGYISPMTPPSCRFVPTCSEYAIEAIKKHGPFKGLYLAVRRILR 60

Query: 111 CNPLGSDGFDPVP 123
           C+P G  G+DPVP
Sbjct: 61  CHPWGGSGYDPVP 73


>gi|329938641|ref|ZP_08288037.1| hypothetical protein SGM_3529 [Streptomyces griseoaurantiacus M045]
 gi|329302132|gb|EGG46024.1| hypothetical protein SGM_3529 [Streptomyces griseoaurantiacus M045]
          Length = 118

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 44/75 (58%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   + +I++YQ   S + G  C+Y P+CS YGY AI R+G   G+ LT  R+++CNP 
Sbjct: 1   MKYPLLALIKLYQWTISPLLGPVCKYYPSCSHYGYTAIDRHGALKGTALTAWRILRCNPW 60

Query: 115 GSDGFDPVPDDLPPK 129
              G D VP+   P+
Sbjct: 61  SLGGVDHVPERKRPR 75


>gi|313204650|ref|YP_004043307.1| hypothetical protein Palpr_2186 [Paludibacter propionicigenes WB4]
 gi|312443966|gb|ADQ80322.1| protein of unknown function DUF37 [Paludibacter propionicigenes
           WB4]
          Length = 73

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/73 (39%), Positives = 44/73 (60%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            K +   I +  +  Y+   S +F   CRY PTCS+Y  EA+ ++G++ GSWL + R+  
Sbjct: 1   MKKILHFIVLLPVYFYKYSISPLFPARCRYTPTCSQYTIEAVNKHGIFKGSWLAIKRISS 60

Query: 111 CNPLGSDGFDPVP 123
           C+P G  G+DPVP
Sbjct: 61  CHPWGGSGYDPVP 73


>gi|170729248|ref|YP_001763274.1| hypothetical protein Swoo_4930 [Shewanella woodyi ATCC 51908]
 gi|226707636|sp|B1KQ66|Y4930_SHEWM RecName: Full=UPF0161 protein Swoo_4930
 gi|169814595|gb|ACA89179.1| protein of unknown function DUF37 [Shewanella woodyi ATCC 51908]
          Length = 85

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/76 (39%), Positives = 42/76 (55%), Gaps = 1/76 (1%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNS-CRYLPTCSEYGYEAIARYGLWIGSWLTLLRLI 109
            ++  + +   +IR YQ+  S   G + CR+ PTCS Y  EAI  +G   G WL   R++
Sbjct: 4   TQSPLQWLATTLIRGYQVFISPFLGANKCRFHPTCSTYAIEAIRLHGSVKGCWLAARRIL 63

Query: 110 KCNPLGSDGFDPVPDD 125
           KC+PL   G DPVP  
Sbjct: 64  KCHPLHPGGIDPVPPK 79


>gi|332971200|gb|EGK10163.1| alpha-hemolysin family protein [Desmospora sp. 8437]
          Length = 69

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/69 (47%), Positives = 43/69 (62%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   + +IR YQ   S +   +CR+ PTCS YGY AI+RYG   G WLT+ R+ KC+P 
Sbjct: 1   MKAAALVLIRFYQRFISPLTPPTCRFAPTCSHYGYVAISRYGFLRGGWLTVKRIAKCHPF 60

Query: 115 GSDGFDPVP 123
              GFDPVP
Sbjct: 61  HPGGFDPVP 69


>gi|157825611|ref|YP_001493331.1| hypothetical protein A1C_02640 [Rickettsia akari str. Hartford]
 gi|166228417|sp|A8GN48|Y2640_RICAH RecName: Full=UPF0161 protein A1C_02640
 gi|157799569|gb|ABV74823.1| hypothetical protein A1C_02640 [Rickettsia akari str. Hartford]
          Length = 82

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 36/85 (42%), Positives = 49/85 (57%), Gaps = 4/85 (4%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              I + I++ YQ   S + GN+CR+ P+CSEY  EAI  YG   G W+T  R+IKC P 
Sbjct: 1   MSKILLLIVKFYQYFISPLLGNNCRFHPSCSEYAKEAITIYGSTKGLWITFKRIIKCQPF 60

Query: 115 GSDGFDPVPDDLPPKKNNPKLLSKK 139
            + G+D VP  +     N K L+KK
Sbjct: 61  CNGGYDNVPISIK----NYKSLNKK 81


>gi|15673654|ref|NP_267828.1| hypothetical protein L122982 [Lactococcus lactis subsp. lactis
           Il1403]
 gi|14286084|sp|Q9CF09|YRCB_LACLA RecName: Full=UPF0161 protein yrcB
 gi|12724686|gb|AAK05770.1|AE006398_1 conserved hypothetical protein [Lactococcus lactis subsp. lactis
           Il1403]
 gi|326407138|gb|ADZ64209.1| conserved hypothetical protein [Lactococcus lactis subsp. lactis
           CV56]
          Length = 88

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 40/77 (51%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + +  +  YQ   S     +CRY PTCS Y  +AI ++G   G  +   R+++C+P 
Sbjct: 1   MKKVLVKAVHGYQRWISPALPPACRYYPTCSNYMVQAIEKHGPAKGLAMGTARILRCHPF 60

Query: 115 GSDGFDPVPDDLPPKKN 131
              G+D VPD    ++N
Sbjct: 61  CQPGYDLVPDHFSLRRN 77


>gi|310642693|ref|YP_003947451.1| hypothetical protein PPSC2_c3251 [Paenibacillus polymyxa SC2]
 gi|309247643|gb|ADO57210.1| hypothetical protein PPSC2_c3251 [Paenibacillus polymyxa SC2]
          Length = 96

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/80 (37%), Positives = 40/80 (50%), Gaps = 3/80 (3%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            K   R +    I+ Y+   S +   +CR+ PTCS Y  EA+  +G   GSWL   R+ K
Sbjct: 1   MKITTRRVVQAPIQFYRAYISPLKPATCRFYPTCSAYALEAVEVHGALKGSWLAAKRIAK 60

Query: 111 CNPLGSDGFDPVPDDLPPKK 130
           C+P    G D VP   P KK
Sbjct: 61  CHPFHPGGVDLVP---PAKK 77


>gi|253997710|ref|YP_003049774.1| hypothetical protein Mmol_2347 [Methylotenera mobilis JLW8]
 gi|253984389|gb|ACT49247.1| protein of unknown function DUF37 [Methylotenera mobilis JLW8]
          Length = 69

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 40/69 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              + I +I+ YQ I S  FG  CR+ PTCS+Y  EAI R+G   G +  + RL +C+P 
Sbjct: 1   MSRLLIWMIKGYQFILSPFFGQQCRFYPTCSQYAVEAIQRHGAMRGGYYMVHRLCRCHPW 60

Query: 115 GSDGFDPVP 123
              G DPVP
Sbjct: 61  CEGGHDPVP 69


>gi|320161693|ref|YP_004174918.1| hypothetical protein ANT_22920 [Anaerolinea thermophila UNI-1]
 gi|319995547|dbj|BAJ64318.1| hypothetical protein ANT_22920 [Anaerolinea thermophila UNI-1]
          Length = 94

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 27/73 (36%), Positives = 43/73 (58%), Gaps = 1/73 (1%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNS-CRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
             + R + + +IR YQ   S     + CR+ P+CS YGY+A+ +YG   G  + + R+++
Sbjct: 22  WNIPRWVLLLLIRGYQKFISPGLPPNTCRFYPSCSHYGYQAVYKYGAIKGGLMAVWRVLR 81

Query: 111 CNPLGSDGFDPVP 123
           CNP    G+DPVP
Sbjct: 82  CNPFNPGGYDPVP 94


>gi|71279931|ref|YP_271689.1| hypothetical protein CPS_5051 [Colwellia psychrerythraea 34H]
 gi|116256249|sp|Q47U34|Y5051_COLP3 RecName: Full=UPF0161 protein CPS_5051
 gi|71145671|gb|AAZ26144.1| conserved hypothetical protein TIGR00278 [Colwellia psychrerythraea
           34H]
          Length = 82

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 45/78 (57%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
            +  + + I  I+ YQ   S + G++CR+ P+CS Y  EAI R+G+  G WL   R+++C
Sbjct: 5   NSTPQKLVITGIKGYQRFISPLLGSNCRFTPSCSAYATEAINRFGVIKGGWLASKRILRC 64

Query: 112 NPLGSDGFDPVPDDLPPK 129
           +PL   G DPVP     K
Sbjct: 65  HPLNDGGEDPVPPIKKSK 82


>gi|116512535|ref|YP_811442.1| hypothetical protein LACR_1842 [Lactococcus lactis subsp. cremoris
           SK11]
 gi|123320261|sp|Q02XJ3|Y1842_LACLS RecName: Full=UPF0161 protein LACR_1842
 gi|116108189|gb|ABJ73329.1| hypothetical protein LACR_1842 [Lactococcus lactis subsp. cremoris
           SK11]
          Length = 90

 Score =  101 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 26/85 (30%), Positives = 44/85 (51%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + +  +  YQ   S VF  +CRY PTCS Y  +AI ++G   G  +   R+++C+P 
Sbjct: 1   MKKVLVKAVHGYQRWISPVFPPACRYYPTCSNYMIQAIEKHGPAKGLAMGTARILRCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNNPKLLSKK 139
              G+D VP     ++N  +   K+
Sbjct: 61  CQPGYDLVPKHFSLRRNWAEPEKKE 85


>gi|328956379|ref|YP_004373712.1| protein of unknown function DUF37 [Coriobacterium glomerans PW2]
 gi|328456703|gb|AEB07897.1| protein of unknown function DUF37 [Coriobacterium glomerans PW2]
          Length = 90

 Score =  101 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/68 (44%), Positives = 41/68 (60%)

Query: 56  RLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLG 115
           R I    IR+YQ   S +  ++C Y P+CS Y  EAI R+GL  G WL   R+++C P  
Sbjct: 23  RRIATVPIRLYQRGISPLLPDACIYEPSCSRYAIEAIERHGLVRGCWLASCRILRCTPWH 82

Query: 116 SDGFDPVP 123
           + G+DPVP
Sbjct: 83  AGGYDPVP 90


>gi|254429836|ref|ZP_05043543.1| conserved hypothetical protein TIGR00278 [Alcanivorax sp. DG881]
 gi|196196005|gb|EDX90964.1| conserved hypothetical protein TIGR00278 [Alcanivorax sp. DG881]
          Length = 93

 Score =  101 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 41/73 (56%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + +G I +YQ + S   GN CR+ PTCSEY  +A+  +G   GS L   RL KC+P 
Sbjct: 1   MKSLLLGAIWLYQKVLSPWIGNQCRFYPTCSEYARQAVVAHGSLRGSALAAKRLCKCHPW 60

Query: 115 GSDGFDPVPDDLP 127
              GFD VP   P
Sbjct: 61  HPGGFDYVPGTEP 73


>gi|16800846|ref|NP_471114.1| hypothetical protein lin1778 [Listeria innocua Clip11262]
 gi|25009622|sp|Q92AZ0|Y1778_LISIN RecName: Full=UPF0161 protein lin1778
 gi|16414265|emb|CAC97009.1| lin1778 [Listeria innocua Clip11262]
 gi|313618583|gb|EFR90556.1| conserved hypothetical protein [Listeria innocua FSL S4-378]
          Length = 88

 Score =  101 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 43/78 (55%), Gaps = 3/78 (3%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + IG IR+YQ   S     +CR+ PTCS YG EAI  +G   GS+L + R+ KC+P 
Sbjct: 1   MKKMLIGGIRLYQKYISRFTPATCRFYPTCSAYGIEAIETHGALKGSYLAIRRISKCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G D VP   P K  N
Sbjct: 61  HKGGLDFVP---PKKDKN 75


>gi|306832009|ref|ZP_07465164.1| alpha-hemolysin family protein [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
 gi|325978957|ref|YP_004288673.1| hypothetical protein SGGBAA2069_c17570 [Streptococcus gallolyticus
           subsp. gallolyticus ATCC BAA-2069]
 gi|304425935|gb|EFM29052.1| alpha-hemolysin family protein [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
 gi|325178885|emb|CBZ48929.1| conserved hypothetical protein [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
          Length = 87

 Score =  101 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/86 (32%), Positives = 46/86 (53%), Gaps = 1/86 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + +   I +++ YQ   S +   SCRY PTCS Y   AI ++G   G  + + R+++C+P
Sbjct: 1   MMKKSLIALVKWYQKRISPMSPPSCRYRPTCSNYMIGAIEKHG-LKGVLMGIARILRCHP 59

Query: 114 LGSDGFDPVPDDLPPKKNNPKLLSKK 139
             + G DPVPD    ++N      K+
Sbjct: 60  FVTGGDDPVPDYFTLRRNKDFRTKKE 85


>gi|313894739|ref|ZP_07828300.1| conserved hypothetical protein YidD [Selenomonas sp. oral taxon 137
           str. F0430]
 gi|320531080|ref|ZP_08032109.1| conserved hypothetical protein YidD [Selenomonas artemidis F0399]
 gi|312976648|gb|EFR42102.1| conserved hypothetical protein YidD [Selenomonas sp. oral taxon 137
           str. F0430]
 gi|320136662|gb|EFW28615.1| conserved hypothetical protein YidD [Selenomonas artemidis F0399]
          Length = 72

 Score =  101 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 39/68 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I + +IR Y+   S      CRY PTCS Y  EAI RYG   G W+ + R+++C+P 
Sbjct: 1   MKRILLFVIRFYRSCISPFLPPMCRYQPTCSAYAMEAIERYGARRGGWMAVRRILRCHPW 60

Query: 115 GSDGFDPV 122
              G+DPV
Sbjct: 61  HEGGYDPV 68


>gi|309805642|ref|ZP_07699683.1| conserved hypothetical protein YidD [Lactobacillus iners LactinV
           09V1-c]
 gi|312871915|ref|ZP_07731997.1| conserved hypothetical protein YidD [Lactobacillus iners LEAF
           2062A-h1]
 gi|312873840|ref|ZP_07733883.1| conserved hypothetical protein YidD [Lactobacillus iners LEAF
           2052A-d]
 gi|315653734|ref|ZP_07906654.1| alpha-hemolysin [Lactobacillus iners ATCC 55195]
 gi|325911707|ref|ZP_08174114.1| YidD family protein [Lactobacillus iners UPII 143-D]
 gi|308165002|gb|EFO67244.1| conserved hypothetical protein YidD [Lactobacillus iners LactinV
           09V1-c]
 gi|311090622|gb|EFQ49023.1| conserved hypothetical protein YidD [Lactobacillus iners LEAF
           2052A-d]
 gi|311092492|gb|EFQ50854.1| conserved hypothetical protein YidD [Lactobacillus iners LEAF
           2062A-h1]
 gi|315489096|gb|EFU78738.1| alpha-hemolysin [Lactobacillus iners ATCC 55195]
 gi|325476473|gb|EGC79632.1| YidD family protein [Lactobacillus iners UPII 143-D]
          Length = 104

 Score =  101 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 48/80 (60%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
            L + + I ++ IYQ   S +F  +CRY PTCS+Y   AI+++G  +G  + + R+I+CN
Sbjct: 9   KLMKKLLINMVIIYQKCISPLFPPTCRYYPTCSKYMITAISKHGCILGIIMGVARIIRCN 68

Query: 113 PLGSDGFDPVPDDLPPKKNN 132
           P    G DPVPD    ++N 
Sbjct: 69  PFVRGGVDPVPDFFTIRRNP 88


>gi|326202769|ref|ZP_08192636.1| protein of unknown function DUF37 [Clostridium papyrosolvens DSM
           2782]
 gi|325986846|gb|EGD47675.1| protein of unknown function DUF37 [Clostridium papyrosolvens DSM
           2782]
          Length = 71

 Score =  101 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/71 (43%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNV-FGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           + + I I +IR YQ   S +    +CR+ PTCS+Y  EA+ +YG   GS+L L R++KC+
Sbjct: 1   MLKRILIALIRFYQKFISPLKMRPTCRFYPTCSQYAIEAVIKYGCIKGSYLALKRILKCH 60

Query: 113 PLGSDGFDPVP 123
           P    GFDPV 
Sbjct: 61  PFHPGGFDPVK 71


>gi|259501671|ref|ZP_05744573.1| conserved hypothetical protein [Lactobacillus iners DSM 13335]
 gi|259166956|gb|EEW51451.1| conserved hypothetical protein [Lactobacillus iners DSM 13335]
          Length = 119

 Score =  101 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 48/80 (60%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
            L + + I ++ IYQ   S +F  +CRY PTCS+Y   AI+++G  +G  + + R+I+CN
Sbjct: 24  KLMKKLLINMVIIYQKCISPLFPPTCRYYPTCSKYMITAISKHGCILGIIMGVARIIRCN 83

Query: 113 PLGSDGFDPVPDDLPPKKNN 132
           P    G DPVPD    ++N 
Sbjct: 84  PFVRGGVDPVPDFFTIRRNP 103


>gi|194291288|ref|YP_002007195.1| hypothetical protein RALTA_A3218 [Cupriavidus taiwanensis LMG
           19424]
 gi|226703759|sp|B3R884|Y3218_CUPTR RecName: Full=UPF0161 protein RALTA_A3218
 gi|193225123|emb|CAQ71134.1| conserved hypothetical protein, DUF37 [Cupriavidus taiwanensis LMG
           19424]
          Length = 93

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/69 (40%), Positives = 44/69 (63%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I + ++R+Y++  S   G+ CR+LPTCS+Y  +AI  +G   GSW+   RL +C+P 
Sbjct: 1   MKRILLALLRVYKIALSPYLGSQCRFLPTCSDYARDAIVHHGAARGSWMAACRLCRCHPF 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  AQGGYDPVP 69


>gi|56695450|ref|YP_165798.1| hypothetical protein SPO0536 [Ruegeria pomeroyi DSS-3]
 gi|81350678|sp|Q5LW07|Y536_SILPO RecName: Full=UPF0161 protein SPO0536
 gi|56677187|gb|AAV93853.1| conserved hypothetical protein TIGR00278 [Ruegeria pomeroyi DSS-3]
          Length = 85

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 50/81 (61%), Gaps = 2/81 (2%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           T    I    +R Y+LIFS   G +CRY PTCS Y  EA+ ++G   GSWL   R+ +C+
Sbjct: 2   TPLAHILALPVRAYRLIFSPWVGFNCRYQPTCSAYALEALEKHGALRGSWLAARRIGRCH 61

Query: 113 PLGSDGFDPVPDDLPPKKNNP 133
           PLGSDG+DPVP+  P  +  P
Sbjct: 62  PLGSDGYDPVPE--PKDRKPP 80


>gi|239930178|ref|ZP_04687131.1| hypothetical protein SghaA1_18253 [Streptomyces ghanaensis ATCC
           14672]
 gi|291438520|ref|ZP_06577910.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672]
 gi|291341415|gb|EFE68371.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672]
          Length = 124

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 43/75 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   + +I+IYQ   S + G  C+Y P+CS YGY AI R+G   G+ LT  R+++CNP 
Sbjct: 1   MKYPLLALIKIYQWTISPLLGPVCKYYPSCSHYGYTAIDRHGAIKGTALTAWRILRCNPW 60

Query: 115 GSDGFDPVPDDLPPK 129
              G D VP    P+
Sbjct: 61  SLGGVDHVPPRKRPR 75


>gi|302346027|ref|YP_003814380.1| conserved hypothetical protein YidD [Prevotella melaninogenica ATCC
           25845]
 gi|302149615|gb|ADK95877.1| conserved hypothetical protein YidD [Prevotella melaninogenica ATCC
           25845]
          Length = 100

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 30/67 (44%), Positives = 42/67 (62%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            + I  I  Y+   S     SCR+ PTCSEYG +AI ++G + G  LT+ R+++CNP G 
Sbjct: 34  WLLILPILFYRQFISPFTPPSCRFTPTCSEYGRQAILKHGPFKGLALTIWRILRCNPWGG 93

Query: 117 DGFDPVP 123
            G+DPVP
Sbjct: 94  SGYDPVP 100


>gi|51894473|ref|YP_077164.1| putative alpha-hemolysin [Symbiobacterium thermophilum IAM 14863]
 gi|81387782|sp|Q67J30|Y3339_SYMTH RecName: Full=UPF0161 protein STH3339
 gi|51858162|dbj|BAD42320.1| putative alpha-hemolysin [Symbiobacterium thermophilum IAM 14863]
          Length = 70

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 46/70 (65%), Gaps = 1/70 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFG-NSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
              + + ++R YQ   S + G  +CR+ P+CS+Y YEA+A+YG   G+WL + R+++C+P
Sbjct: 1   MTRLLMLLVRFYQRYLSPLKGGPTCRFTPSCSQYAYEALAKYGAIKGTWLAVRRVLRCHP 60

Query: 114 LGSDGFDPVP 123
               G+DPVP
Sbjct: 61  FHPGGYDPVP 70


>gi|163739496|ref|ZP_02146906.1| hypothetical protein RGBS107_08050 [Phaeobacter gallaeciensis
           BS107]
 gi|163740289|ref|ZP_02147683.1| hypothetical protein RG210_09317 [Phaeobacter gallaeciensis 2.10]
 gi|161386147|gb|EDQ10522.1| hypothetical protein RG210_09317 [Phaeobacter gallaeciensis 2.10]
 gi|161387249|gb|EDQ11608.1| hypothetical protein RGBS107_08050 [Phaeobacter gallaeciensis
           BS107]
          Length = 90

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 34/82 (41%), Positives = 48/82 (58%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           T    +    +R Y+L+FS   G +CRY PTCS Y  EA+ ++G   G+WLT  R+ +C+
Sbjct: 2   TPLAHLFALPVRAYRLLFSPWVGFNCRYQPTCSAYALEALEKHGAIRGAWLTARRIGRCH 61

Query: 113 PLGSDGFDPVPDDLPPKKNNPK 134
           PLG DG+DPVP   P      +
Sbjct: 62  PLGGDGYDPVPGCDPEHDRRTR 83


>gi|126695768|ref|YP_001090654.1| hypothetical protein P9301_04301 [Prochlorococcus marinus str. MIT
           9301]
 gi|166227244|sp|A3PBC8|Y430_PROM0 RecName: Full=UPF0161 protein P9301_04301
 gi|126542811|gb|ABO17053.1| Uncharacterized conserved protein [Prochlorococcus marinus str. MIT
           9301]
          Length = 78

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 38/67 (56%), Positives = 46/67 (68%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
           I + +I  YQ  FS  FG  CR++P+CS YGYEAI R+G W G WLTL RL +C+PL   
Sbjct: 12  ILLLLISFYQKWFSPFFGPRCRFIPSCSSYGYEAITRHGPWKGGWLTLKRLSRCHPLTPC 71

Query: 118 GFDPVPD 124
           G DPVPD
Sbjct: 72  GCDPVPD 78


>gi|255657636|ref|ZP_05403045.1| hypothetical protein CdifQCD-2_18491 [Clostridium difficile
           QCD-23m63]
 gi|296452683|ref|ZP_06894374.1| alpha-hemolysin [Clostridium difficile NAP08]
 gi|296258465|gb|EFH05369.1| alpha-hemolysin [Clostridium difficile NAP08]
          Length = 83

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 27/65 (41%), Positives = 41/65 (63%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            + I ++R YQ   S + G +CR+ PTCS+Y  EA  +YG   G +LT+ R++KC+P   
Sbjct: 17  NLCIYLVRFYQKYISPLKGPTCRFYPTCSQYSIEAFKKYGFIKGMYLTIRRILKCHPFHP 76

Query: 117 DGFDP 121
            G+DP
Sbjct: 77  GGYDP 81


>gi|73543143|ref|YP_297663.1| hypothetical protein Reut_A3461 [Ralstonia eutropha JMP134]
 gi|116256230|sp|Q46VL5|Y3461_RALEJ RecName: Full=UPF0161 protein Reut_A3461
 gi|72120556|gb|AAZ62819.1| Protein of unknown function DUF37 [Ralstonia eutropha JMP134]
          Length = 98

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/69 (40%), Positives = 44/69 (63%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I + ++RIY++  S   G+ CR+ PTCS+Y  EA+ ++G   GSW+   RL +C+P 
Sbjct: 1   MKRILLALLRIYKIALSPYLGSRCRFWPTCSDYAREAVIQHGAARGSWMAACRLCRCHPF 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  TQGGYDPVP 69


>gi|332883432|gb|EGK03715.1| hypothetical protein HMPREF9456_01782 [Dysgonomonas mossii DSM
           22836]
          Length = 73

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 32/73 (43%), Positives = 42/73 (57%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            K L   I +  +  Y+   S +   SCRY PTCSEY  +AI +YG + G WL   R+ +
Sbjct: 1   MKKLLSWILLLPVYFYKYSISPMLPPSCRYTPTCSEYAIQAIKKYGPFKGFWLATKRIAR 60

Query: 111 CNPLGSDGFDPVP 123
           CNP G  G+DPVP
Sbjct: 61  CNPWGGHGYDPVP 73


>gi|257095988|ref|YP_003169629.1| hypothetical protein CAP2UW1_4473 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257048512|gb|ACV37700.1| protein of unknown function DUF37 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 69

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 26/69 (37%), Positives = 42/69 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + + ++  Y+   S + G  CR+ P+CSEY  EA+ ++G   GS L++ RL +C+P 
Sbjct: 1   MKQLLLALLGFYRYAISPMLGRRCRFFPSCSEYAAEAVEKHGAVRGSCLSVRRLFRCHPW 60

Query: 115 GSDGFDPVP 123
              GFDPVP
Sbjct: 61  NPGGFDPVP 69


>gi|298483301|ref|ZP_07001480.1| toxin-antitoxin system toxin component [Bacteroides sp. D22]
 gi|298270618|gb|EFI12200.1| toxin-antitoxin system toxin component [Bacteroides sp. D22]
          Length = 91

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 26/75 (34%), Positives = 43/75 (57%)

Query: 49  KFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRL 108
              + +   + +  I  Y++  S +   SCR+ PTCS Y  EAI ++G   G +L + R+
Sbjct: 17  GILRKVFSFLLLVPIYFYRVCISPLTPPSCRFTPTCSAYAVEAIKKHGPVKGLYLAVRRI 76

Query: 109 IKCNPLGSDGFDPVP 123
           ++C+P G  G+DPVP
Sbjct: 77  LRCHPWGGSGYDPVP 91


>gi|254476167|ref|ZP_05089553.1| conserved hypothetical protein TIGR00278 [Ruegeria sp. R11]
 gi|214030410|gb|EEB71245.1| conserved hypothetical protein TIGR00278 [Ruegeria sp. R11]
          Length = 106

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 34/71 (47%), Positives = 46/71 (64%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           T    +    +R Y+LIFS   G +CRY PTCS Y  EA+ ++G   G+WLTL R+ +C+
Sbjct: 2   TPLAHLFALPVRAYRLIFSPWVGFNCRYQPTCSAYALEALEKHGAIRGTWLTLRRIGRCH 61

Query: 113 PLGSDGFDPVP 123
           P G DG+DPVP
Sbjct: 62  PFGGDGYDPVP 72


>gi|258616671|ref|ZP_05714441.1| UPF0161 protein yrcB [Enterococcus faecium DO]
          Length = 87

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 40/79 (50%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I ++R YQ   S  F  SCRY PTCS Y  +AI  +G   G+ +   R+++C+P 
Sbjct: 1   MKKILIYLVRGYQRFISPAFPPSCRYYPTCSNYMIKAIQTHGALKGTVMGTARILRCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNNP 133
              G D VP      +N  
Sbjct: 61  VKGGIDYVPLTFRLTRNKK 79


>gi|257437739|ref|ZP_05613494.1| putative alpha-hemolysin [Faecalibacterium prausnitzii A2-165]
 gi|257200046|gb|EEU98330.1| putative alpha-hemolysin [Faecalibacterium prausnitzii A2-165]
          Length = 99

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 34/70 (48%), Positives = 40/70 (57%)

Query: 56  RLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLG 115
           R      IR YQ   S   G +CR+ PTCS+YG EAI  +G   G  LT  R+ +CNPLG
Sbjct: 9   RNALCAPIRFYQRFISPGLGRNCRFTPTCSQYGIEAIQTHGCIKGLLLTAWRIARCNPLG 68

Query: 116 SDGFDPVPDD 125
             GFDPVP  
Sbjct: 69  RWGFDPVPPK 78


>gi|146300022|ref|YP_001194613.1| hypothetical protein Fjoh_2267 [Flavobacterium johnsoniae UW101]
 gi|146154440|gb|ABQ05294.1| protein of unknown function DUF37 [Flavobacterium johnsoniae UW101]
          Length = 79

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 27/73 (36%), Positives = 43/73 (58%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            + ++R YQ   S     SCR+ PTCS Y  +A+  +GL+ G +L + R++ C+P G  G
Sbjct: 7   FVLLVRFYQTAISPFTPASCRFEPTCSTYMIQALQIHGLFYGGYLGMKRILSCHPWGRTG 66

Query: 119 FDPVPDDLPPKKN 131
           +DPVP+     K+
Sbjct: 67  YDPVPEKKCSHKH 79


>gi|313623473|gb|EFR93676.1| conserved hypothetical protein [Listeria innocua FSL J1-023]
          Length = 88

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 30/74 (40%), Positives = 40/74 (54%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + IG IR+YQ   S     +CR+ PTCS YG EAI  +G   GS+L + R+ KC+P 
Sbjct: 1   MKKMLIGGIRLYQKYISRFTPATCRFYPTCSAYGIEAIETHGALKGSYLAIRRISKCHPF 60

Query: 115 GSDGFDPVPDDLPP 128
              G D VP     
Sbjct: 61  HKGGLDFVPPKKDK 74


>gi|304407080|ref|ZP_07388734.1| protein of unknown function DUF37 [Paenibacillus curdlanolyticus
           YK9]
 gi|304344067|gb|EFM09907.1| protein of unknown function DUF37 [Paenibacillus curdlanolyticus
           YK9]
          Length = 78

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 27/72 (37%), Positives = 41/72 (56%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            +    +R Y+   S +   SCRY PTCS Y  EA+ ++G   GSWL + R+ +C+P  +
Sbjct: 4   KVLQAPVRFYRRAISPLKPPSCRYYPTCSSYALEALEKHGAARGSWLAVKRICRCHPFHT 63

Query: 117 DGFDPVPDDLPP 128
            G+DPVP+    
Sbjct: 64  GGYDPVPEPRSK 75


>gi|89053131|ref|YP_508582.1| hypothetical protein Jann_0640 [Jannaschia sp. CCS1]
 gi|116256258|sp|Q28UQ5|Y640_JANSC RecName: Full=UPF0161 protein Jann_0640
 gi|88862680|gb|ABD53557.1| protein of unknown function DUF37 [Jannaschia sp. CCS1]
          Length = 73

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 40/62 (64%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           IR Y+L+ S +  ++CRY PTCS Y  EA+ ++G   G+WL   R+ +C+P G  G D V
Sbjct: 12  IRFYRLVISPMIASNCRYTPTCSSYAMEALRKHGAIKGTWLAARRVSRCHPWGGSGIDNV 71

Query: 123 PD 124
           PD
Sbjct: 72  PD 73


>gi|295135613|ref|YP_003586289.1| hypothetical protein ZPR_3787 [Zunongwangia profunda SM-A87]
 gi|294983628|gb|ADF54093.1| protein of unknown function DUF37 [Zunongwangia profunda SM-A87]
          Length = 74

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 40/65 (61%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            I +++ YQ   S +   +CRY PTCS Y   A+ ++GL+ G WL L R+  C+P G  G
Sbjct: 10  FIILVKCYQNFISPLTPATCRYTPTCSNYTIAALQKHGLFKGGWLALKRIFSCHPWGGSG 69

Query: 119 FDPVP 123
           +DPVP
Sbjct: 70  YDPVP 74


>gi|296283115|ref|ZP_06861113.1| hypothetical protein CbatJ_05815 [Citromicrobium bathyomarinum
           JL354]
          Length = 65

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 41/65 (63%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            + +IR +QL  S +   SCR+ P+CS+Y  EAI ++G   G WL   R+++C+P G  G
Sbjct: 1   MVLLIRGWQLGPSAILPPSCRFQPSCSQYAIEAIEKHGPIKGGWLGFKRIMRCHPWGGHG 60

Query: 119 FDPVP 123
            DPVP
Sbjct: 61  PDPVP 65


>gi|282879067|ref|ZP_06287827.1| conserved hypothetical protein YidD [Prevotella buccalis ATCC
           35310]
 gi|281298801|gb|EFA91210.1| conserved hypothetical protein YidD [Prevotella buccalis ATCC
           35310]
          Length = 72

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 42/70 (60%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + I +  I  YQ   +     SCR+ PTCSEY  +AI ++G + G  L + R+++CNP
Sbjct: 3   ILQGILLAPILFYQKFITPYTPPSCRFTPTCSEYARQAIIKHGPFKGLALAVWRILRCNP 62

Query: 114 LGSDGFDPVP 123
            G  G+DPVP
Sbjct: 63  WGGSGYDPVP 72


>gi|218246562|ref|YP_002371933.1| hypothetical protein PCC8801_1730 [Cyanothece sp. PCC 8801]
 gi|257059602|ref|YP_003137490.1| hypothetical protein Cyan8802_1754 [Cyanothece sp. PCC 8802]
 gi|226736432|sp|B7JWS8|Y1730_CYAP8 RecName: Full=UPF0161 protein PCC8801_1730
 gi|218167040|gb|ACK65777.1| protein of unknown function DUF37 [Cyanothece sp. PCC 8801]
 gi|256589768|gb|ACV00655.1| protein of unknown function DUF37 [Cyanothece sp. PCC 8802]
          Length = 79

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 46/78 (58%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I +I+ Y+   S +F  SCR+ PTCS+Y  EA+ R+G+  G  L + R+++C+P 
Sbjct: 1   MKTLLIVLIKGYRNFISPLFPPSCRFQPTCSKYALEAVERFGVLHGGSLAIKRILRCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G+DPVP      K +
Sbjct: 61  HPGGYDPVPLVDSSSKRS 78


>gi|218960872|ref|YP_001740647.1| hypothetical protein CLOAM0545 [Candidatus Cloacamonas
           acidaminovorans]
 gi|167729529|emb|CAO80440.1| conserved hypothetical protein [Candidatus Cloacamonas
           acidaminovorans]
          Length = 76

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 41/70 (58%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
              L+ + +IR YQL  S     SCR+ P+CS Y YEA  +Y  +   +LT  R+++CNP
Sbjct: 7   FPNLLFLALIRFYQLALSPFLPASCRFEPSCSVYSYEAFKKYNFFKAFYLTAWRILRCNP 66

Query: 114 LGSDGFDPVP 123
               G+DP+P
Sbjct: 67  FHKGGYDPLP 76


>gi|254515873|ref|ZP_05127933.1| conserved hypothetical protein TIGR00278 [gamma proteobacterium
           NOR5-3]
 gi|219675595|gb|EED31961.1| conserved hypothetical protein TIGR00278 [gamma proteobacterium
           NOR5-3]
          Length = 80

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 29/62 (46%), Positives = 38/62 (61%)

Query: 62  IIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDP 121
           +IR Y+LI S   G+ CR+ PTCS Y  EAI  +G   GS L   R+++C+P    G DP
Sbjct: 12  LIRGYKLILSPFMGHHCRFYPTCSSYAIEAIEEHGALKGSKLAAQRILRCHPWHEGGADP 71

Query: 122 VP 123
           VP
Sbjct: 72  VP 73


>gi|295697834|ref|YP_003591072.1| protein of unknown function DUF37 [Bacillus tusciae DSM 2912]
 gi|295413436|gb|ADG07928.1| protein of unknown function DUF37 [Bacillus tusciae DSM 2912]
          Length = 74

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 32/70 (45%), Positives = 41/70 (58%)

Query: 56  RLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLG 115
           R + I  +R YQ   S +   SCR+ PTCSEY  +AI  +GL  GS+L   RL+KC P  
Sbjct: 5   RRLAILPLRGYQRFVSPLTPPSCRFYPTCSEYAVQAITIHGLGKGSFLAAKRLLKCGPWH 64

Query: 116 SDGFDPVPDD 125
             G+DPVP  
Sbjct: 65  PGGYDPVPPK 74


>gi|125623604|ref|YP_001032087.1| hypothetical protein llmg_0750 [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|166228852|sp|A2RJA2|Y750_LACLM RecName: Full=UPF0161 protein llmg_0750
 gi|124492412|emb|CAL97354.1| conserved hypothetical protein [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|300070370|gb|ADJ59770.1| hypothetical protein LLNZ_03905 [Lactococcus lactis subsp. cremoris
           NZ9000]
          Length = 90

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 24/85 (28%), Positives = 43/85 (50%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + +  +  YQ   S     +CRY PTCS Y  +AI ++G   G  +   R+++C+P 
Sbjct: 1   MKKVLVKAVHCYQRWISPALPPACRYYPTCSNYMIQAIEKHGPDKGLAMGTARILRCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNNPKLLSKK 139
              G+D VP+    ++N  +   K+
Sbjct: 61  CQPGYDLVPEHFSLRRNWAEPEKKE 85


>gi|294630335|ref|ZP_06708895.1| conserved hypothetical protein [Streptomyces sp. e14]
 gi|292833668|gb|EFF92017.1| conserved hypothetical protein [Streptomyces sp. e14]
          Length = 117

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 43/75 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   + +I++YQ   S + G  C+Y P+CS YGY AI R+G   G+ LT  R+++CNP 
Sbjct: 1   MKYPLLALIKLYQWTISPLLGPVCKYYPSCSHYGYTAIDRHGAIKGTALTAWRILRCNPW 60

Query: 115 GSDGFDPVPDDLPPK 129
              G D VP    P+
Sbjct: 61  SLGGVDHVPPRKRPR 75


>gi|291005727|ref|ZP_06563700.1| hypothetical protein SeryN2_14499 [Saccharopolyspora erythraea NRRL
           2338]
          Length = 102

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 40/80 (50%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
             +    + +  + +Y+ + S +   SCR+ P+CS Y  EA+  +G   G WLT  RL++
Sbjct: 13  RASPLAWVLLVPVHVYRKVISPLLPPSCRFYPSCSAYAVEALTVHGALRGGWLTARRLLR 72

Query: 111 CNPLGSDGFDPVPDDLPPKK 130
           C P    G DPVP      +
Sbjct: 73  CGPWHPGGLDPVPPRRTSGR 92


>gi|257785165|ref|YP_003180382.1| hypothetical protein Apar_1367 [Atopobium parvulum DSM 20469]
 gi|257473672|gb|ACV51791.1| protein of unknown function DUF37 [Atopobium parvulum DSM 20469]
          Length = 78

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 43/72 (59%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           K+    + + +IR YQ   S +F   C Y PTCSEY  +AI +YG   GSWL   R+++C
Sbjct: 7   KSFLANLFLSVIRFYQRNISPLFKPHCIYRPTCSEYAVQAIQKYGAKKGSWLAFKRIVRC 66

Query: 112 NPLGSDGFDPVP 123
           +P    G+DPVP
Sbjct: 67  HPFHKGGYDPVP 78


>gi|218767520|ref|YP_002342032.1| hypothetical protein NMA0549 [Neisseria meningitidis Z2491]
 gi|11279382|pir||E81973 hypothetical protein NMA0549 [imported] - Neisseria meningitidis
           (strain Z2491 serogroup A)
 gi|121051528|emb|CAM07825.1| hypothetical protein NMA0549 [Neisseria meningitidis Z2491]
 gi|308390000|gb|ADO32320.1| hypothetical protein NMBB_2173 [Neisseria meningitidis alpha710]
 gi|319409784|emb|CBY90092.1| UPF0161 protein BLi03210/BL05307 [Neisseria meningitidis WUE 2594]
          Length = 96

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/61 (45%), Positives = 37/61 (60%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           IR YQ   S +    CRY PTCS+Y  EA+ +YG + G  L + R+ +C+P G  G DPV
Sbjct: 36  IRFYQYCISPLIPPRCRYTPTCSQYAVEAVKKYGAFKGGRLAIKRIARCHPFGGHGHDPV 95

Query: 123 P 123
           P
Sbjct: 96  P 96


>gi|56798243|dbj|BAD82886.1| hypothetical protein [Burkholderia multivorans]
          Length = 81

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 24/76 (31%), Positives = 43/76 (56%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + +   ++R Y++  S + GN CR+ P+CS+Y  EAI  +G   G++L + R+ +C+P 
Sbjct: 1   MKTVLTALLRFYKVAVSPLLGNRCRFYPSCSDYAREAIQYHGAARGTYLAVRRVCRCHPF 60

Query: 115 GSDGFDPVPDDLPPKK 130
            + G D VP      +
Sbjct: 61  SAGGIDLVPPPNSDTR 76


>gi|332531206|ref|ZP_08407119.1| hypothetical protein HGR_14639 [Hylemonella gracilis ATCC 19624]
 gi|332039313|gb|EGI75726.1| hypothetical protein HGR_14639 [Hylemonella gracilis ATCC 19624]
          Length = 92

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 26/73 (35%), Positives = 44/73 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              + + +++ Y+   S   G++CR+ PTCS Y  +A+  +G   GS LT+ RL++C+P 
Sbjct: 4   PARMLMALVQGYRYFLSPWLGSACRFEPTCSRYALQALDAHGAVAGSALTVARLLRCHPW 63

Query: 115 GSDGFDPVPDDLP 127
            + G DPVP+  P
Sbjct: 64  CAGGHDPVPEQKP 76


>gi|268598159|ref|ZP_06132326.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Neisseria
           gonorrhoeae MS11]
 gi|268600503|ref|ZP_06134670.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Neisseria
           gonorrhoeae PID18]
 gi|268681285|ref|ZP_06148147.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Neisseria
           gonorrhoeae PID332]
 gi|268683456|ref|ZP_06150318.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Neisseria
           gonorrhoeae SK-92-679]
 gi|268685762|ref|ZP_06152624.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Neisseria
           gonorrhoeae SK-93-1035]
 gi|268582290|gb|EEZ46966.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Neisseria
           gonorrhoeae MS11]
 gi|268584634|gb|EEZ49310.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Neisseria
           gonorrhoeae PID18]
 gi|268621569|gb|EEZ53969.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Neisseria
           gonorrhoeae PID332]
 gi|268623740|gb|EEZ56140.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Neisseria
           gonorrhoeae SK-92-679]
 gi|268626046|gb|EEZ58446.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Neisseria
           gonorrhoeae SK-93-1035]
          Length = 95

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/61 (45%), Positives = 37/61 (60%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           IR YQ   S +    CRY PTCS+Y  EA+ +YG + G  L + R+ +C+P G  G DPV
Sbjct: 35  IRFYQYCISPLIPPRCRYTPTCSQYAVEAVKKYGAFKGLRLAIKRIARCHPFGGHGHDPV 94

Query: 123 P 123
           P
Sbjct: 95  P 95


>gi|29830856|ref|NP_825490.1| hypothetical protein SAV_4313 [Streptomyces avermitilis MA-4680]
 gi|47606272|sp|Q82FE1|Y4313_STRAW RecName: Full=UPF0161 protein SAV_4313
 gi|29607969|dbj|BAC72025.1| hypothetical protein [Streptomyces avermitilis MA-4680]
          Length = 117

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 44/75 (58%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   + +I++YQ   S + G  C+Y P+CS YGY+AI R+G   G+ LT  R+++CNP 
Sbjct: 1   MKYPLLALIKLYQWTISPLLGPVCKYYPSCSHYGYQAIDRHGAIKGTALTAWRILRCNPW 60

Query: 115 GSDGFDPVPDDLPPK 129
              G D VP    P+
Sbjct: 61  SLGGVDHVPPRKRPR 75


>gi|315506966|ref|YP_004085853.1| hypothetical protein ML5_6259 [Micromonospora sp. L5]
 gi|315413585|gb|ADU11702.1| protein of unknown function DUF37 [Micromonospora sp. L5]
          Length = 79

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 26/75 (34%), Positives = 43/75 (57%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
           + +  I  Y+   S      CR+ P+CS Y  EA++R+G   G+WLT+ RL +C+P    
Sbjct: 1   MLLAPIIAYRRWISPALPARCRFYPSCSAYAVEAVSRHGALRGAWLTVRRLSRCHPFHPG 60

Query: 118 GFDPVPDDLPPKKNN 132
           G DPVP+    ++++
Sbjct: 61  GHDPVPEPGDRRRSD 75


>gi|167038672|ref|YP_001666250.1| hypothetical protein Teth39_2293 [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|167041022|ref|YP_001664007.1| hypothetical protein Teth514_2412 [Thermoanaerobacter sp. X514]
 gi|300913767|ref|ZP_07131084.1| protein of unknown function DUF37 [Thermoanaerobacter sp. X561]
 gi|307725547|ref|YP_003905298.1| hypothetical protein Thet_2461 [Thermoanaerobacter sp. X513]
 gi|320117064|ref|YP_004187223.1| hypothetical protein Thebr_2338 [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
 gi|226701245|sp|B0K8I2|Y2293_THEP3 RecName: Full=UPF0161 protein Teth39_2293
 gi|226701432|sp|B0K5N7|Y2412_THEPX RecName: Full=UPF0161 protein Teth514_2412
 gi|166855262|gb|ABY93671.1| protein of unknown function DUF37 [Thermoanaerobacter sp. X514]
 gi|166857506|gb|ABY95914.1| protein of unknown function DUF37 [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|300890452|gb|EFK85597.1| protein of unknown function DUF37 [Thermoanaerobacter sp. X561]
 gi|307582608|gb|ADN56007.1| protein of unknown function DUF37 [Thermoanaerobacter sp. X513]
 gi|319930155|gb|ADV80840.1| protein of unknown function DUF37 [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
          Length = 69

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/69 (40%), Positives = 45/69 (65%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I +I++YQ   S +   SCR+ PTCS+Y  EAI++YGL  G  +++ R+++CNP 
Sbjct: 1   MKNVVIFLIKLYQRYISPMKPRSCRFYPTCSQYSIEAISKYGLLKGGIMSIWRILRCNPF 60

Query: 115 GSDGFDPVP 123
              G+DPV 
Sbjct: 61  NPGGYDPVK 69


>gi|270308302|ref|YP_003330360.1| hypothetical protein DhcVS_912 [Dehalococcoides sp. VS]
 gi|270154194|gb|ACZ62032.1| hypothetical protein DhcVS_912 [Dehalococcoides sp. VS]
          Length = 70

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 32/70 (45%), Positives = 50/70 (71%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + + +IR+YQ  +S    +SCR++PTCS+Y YEAI R+G++ G WL + RL +C+PL
Sbjct: 1   MKKLALKLIRLYQNTYSKTAPSSCRFIPTCSQYTYEAIERFGIFRGIWLGVKRLSRCHPL 60

Query: 115 GSDGFDPVPD 124
              G+DPVP+
Sbjct: 61  NKGGYDPVPE 70


>gi|254492910|ref|ZP_05106081.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Neisseria
           gonorrhoeae 1291]
 gi|268602736|ref|ZP_06136903.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Neisseria
           gonorrhoeae PID1]
 gi|226511950|gb|EEH61295.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Neisseria
           gonorrhoeae 1291]
 gi|268586867|gb|EEZ51543.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Neisseria
           gonorrhoeae PID1]
          Length = 95

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/61 (45%), Positives = 37/61 (60%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           IR YQ   S +    CRY PTCS+Y  EA+ +YG + G  L + R+ +C+P G  G DPV
Sbjct: 35  IRFYQYCISPLIPPRCRYTPTCSQYAVEAVKKYGAFKGLRLAIKRIARCHPFGGHGHDPV 94

Query: 123 P 123
           P
Sbjct: 95  P 95


>gi|120437077|ref|YP_862763.1| hypothetical protein GFO_2742 [Gramella forsetii KT0803]
 gi|117579227|emb|CAL67696.1| protein containing DUF37 [Gramella forsetii KT0803]
          Length = 82

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 27/72 (37%), Positives = 41/72 (56%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
           I   +++ Y+   S +   +CRY P+CS Y  +AI  +G + G WL + R+ +CNP G  
Sbjct: 9   ILTSLVQFYKKFISPLTPATCRYEPSCSSYMLKAIETHGAFKGFWLGIKRIARCNPWGGC 68

Query: 118 GFDPVPDDLPPK 129
           G+DPVP     K
Sbjct: 69  GYDPVPGKSEDK 80


>gi|297200936|ref|ZP_06918333.1| conserved hypothetical protein [Streptomyces sviceus ATCC 29083]
 gi|197716892|gb|EDY60926.1| conserved hypothetical protein [Streptomyces sviceus ATCC 29083]
          Length = 116

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 44/75 (58%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   + +I++YQ   S + G  C+Y P+CS YGY+AI R+G   G+ LT  R+++CNP 
Sbjct: 1   MKYPLLALIKLYQWTISPLLGPVCKYYPSCSHYGYQAIDRHGAIKGTALTAWRILRCNPW 60

Query: 115 GSDGFDPVPDDLPPK 129
              G D VP    P+
Sbjct: 61  SLGGVDHVPPRRRPR 75


>gi|85709449|ref|ZP_01040514.1| hypothetical protein NAP1_11228 [Erythrobacter sp. NAP1]
 gi|85688159|gb|EAQ28163.1| hypothetical protein NAP1_11228 [Erythrobacter sp. NAP1]
          Length = 69

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 41/69 (59%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I I R +QL  S +   +CRY P+CS+Y  EA+ +YG   G WL   RL +C+P 
Sbjct: 1   MKHVLIFIARFWQLGPSRILPPTCRYSPSCSQYAIEALRKYGALKGGWLAAKRLGRCHPW 60

Query: 115 GSDGFDPVP 123
           G  G DPVP
Sbjct: 61  GGHGHDPVP 69


>gi|83854929|ref|ZP_00948459.1| hypothetical protein NAS141_09376 [Sulfitobacter sp. NAS-14.1]
 gi|83842772|gb|EAP81939.1| hypothetical protein NAS141_09376 [Sulfitobacter sp. NAS-14.1]
          Length = 70

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 48/71 (67%), Gaps = 1/71 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + R++ +  ++ Y+L+FS   G++CRY PTCS Y  EA+AR+G   G WLTL R+ +C+P
Sbjct: 1   MARVLAL-PVKGYRLVFSPWVGHNCRYHPTCSAYALEALARHGGIKGGWLTLRRIARCHP 59

Query: 114 LGSDGFDPVPD 124
            G  G D VPD
Sbjct: 60  WGDSGIDNVPD 70


>gi|124269010|ref|YP_001023014.1| hypothetical protein Mpe_A3826 [Methylibium petroleiphilum PM1]
 gi|124261785|gb|ABM96779.1| conserved hypothetical protein [Methylibium petroleiphilum PM1]
          Length = 120

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 33/74 (44%), Positives = 49/74 (66%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           L + + IG+++ Y+L FS   G+ CR+ P+CS Y  EA+ R+G   GS+LT  RL++C+P
Sbjct: 14  LPQRLLIGVVQGYRLFFSAWLGSGCRFTPSCSVYSIEALERHGALSGSYLTTRRLLRCHP 73

Query: 114 LGSDGFDPVPDDLP 127
             + G DPVPD  P
Sbjct: 74  GCAGGHDPVPDRPP 87


>gi|229918017|ref|YP_002886663.1| hypothetical protein EAT1b_2296 [Exiguobacterium sp. AT1b]
 gi|259646614|sp|C4L2G6|Y2296_EXISA RecName: Full=UPF0161 protein EAT1b_2296
 gi|229469446|gb|ACQ71218.1| protein of unknown function DUF37 [Exiguobacterium sp. AT1b]
          Length = 89

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 42/75 (56%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + +  I+ YQ   S +   +CR+ P+CS YG EAI ++G   GS+LT  RLI+C P 
Sbjct: 1   MKRVLVKGIQGYQRFISPLKPPTCRFYPSCSHYGIEAIEKHGAVKGSYLTARRLIRCQPF 60

Query: 115 GSDGFDPVPDDLPPK 129
              G D VPD    K
Sbjct: 61  HPGGLDYVPDTFDWK 75


>gi|307687873|ref|ZP_07630319.1| hypothetical protein Ccel74_06925 [Clostridium cellulovorans 743B]
          Length = 70

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 28/69 (40%), Positives = 46/69 (66%), Gaps = 1/69 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFG-NSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
            + I I II+ Y+   S + G  +C++LPTCS+Y  EA+ ++G+  G ++ L R+++CNP
Sbjct: 1   MKRILIKIIKFYRKYISPLKGTPTCKFLPTCSQYAIEALEKHGVIRGGFMALKRVLRCNP 60

Query: 114 LGSDGFDPV 122
             S G+DPV
Sbjct: 61  FSSGGYDPV 69


>gi|260427647|ref|ZP_05781626.1| conserved hypothetical protein [Citreicella sp. SE45]
 gi|260422139|gb|EEX15390.1| conserved hypothetical protein [Citreicella sp. SE45]
          Length = 78

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 28/76 (36%), Positives = 42/76 (55%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           +    +    +R Y+L+FS   G+ CRY PTCS Y  EA+ ++G   G WL   R+++C+
Sbjct: 2   SPLAHVAALPVRFYRLVFSPWVGHGCRYQPTCSAYALEALEKHGALRGCWLAARRILRCH 61

Query: 113 PLGSDGFDPVPDDLPP 128
           P G  G D VP+    
Sbjct: 62  PWGGHGIDNVPEPRSK 77


>gi|160884935|ref|ZP_02065938.1| hypothetical protein BACOVA_02925 [Bacteroides ovatus ATCC 8483]
 gi|260172700|ref|ZP_05759112.1| hypothetical protein BacD2_12606 [Bacteroides sp. D2]
 gi|299145186|ref|ZP_07038254.1| putative toxin-antitoxin system, toxin component [Bacteroides sp.
           3_1_23]
 gi|156109970|gb|EDO11715.1| hypothetical protein BACOVA_02925 [Bacteroides ovatus ATCC 8483]
 gi|298515677|gb|EFI39558.1| putative toxin-antitoxin system, toxin component [Bacteroides sp.
           3_1_23]
          Length = 91

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 26/75 (34%), Positives = 42/75 (56%)

Query: 49  KFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRL 108
              + +     +  I  Y++  S +   SCR+ PTCS Y  EAI ++G   G +L + R+
Sbjct: 17  GILRKVFSFFLLVPIYFYRICISPLTPPSCRFTPTCSAYALEAIKKHGPIKGLYLAVRRI 76

Query: 109 IKCNPLGSDGFDPVP 123
           ++C+P G  G+DPVP
Sbjct: 77  LRCHPWGGSGYDPVP 91


>gi|82703890|ref|YP_413456.1| hypothetical protein Nmul_A2777 [Nitrosospira multiformis ATCC
           25196]
 gi|116256213|sp|Q2Y5A7|Y2777_NITMU RecName: Full=UPF0161 protein Nmul_A2777
 gi|82411955|gb|ABB76064.1| Protein of unknown function DUF37 [Nitrosospira multiformis ATCC
           25196]
          Length = 71

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 42/66 (63%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
           + I  IR+YQ   S   G SCR+ P+CS Y  EA+AR+G   G  L++ R+++CNP    
Sbjct: 1   MIIAFIRLYQYCLSPFLGPSCRFSPSCSHYACEALARHGATRGLVLSVWRIMRCNPWSRG 60

Query: 118 GFDPVP 123
           G+DPVP
Sbjct: 61  GYDPVP 66


>gi|85703242|ref|ZP_01034346.1| hypothetical protein ROS217_20912 [Roseovarius sp. 217]
 gi|85672170|gb|EAQ27027.1| hypothetical protein ROS217_20912 [Roseovarius sp. 217]
          Length = 82

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 31/71 (43%), Positives = 42/71 (59%), Gaps = 2/71 (2%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           IR Y+L+ S   G  CRY PTCS Y  EA+ ++G   G  L   R+++CNP G  G DPV
Sbjct: 12  IRAYRLLLSPWVGWHCRYHPTCSHYALEALEKHGALRGGALAAWRILRCNPWGQCGHDPV 71

Query: 123 PDDLPPKKNNP 133
           P+  P  + +P
Sbjct: 72  PE--PGHRRDP 80


>gi|323705846|ref|ZP_08117418.1| protein of unknown function DUF37 [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323534842|gb|EGB24621.1| protein of unknown function DUF37 [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 69

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 28/69 (40%), Positives = 42/69 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I +I+ YQ   S +   SCR+ PTCS+Y  +AI +YG+  G  + L R+++CNP 
Sbjct: 1   MKYIFIYLIKFYQKFISPMKPKSCRFYPTCSQYAIDAIMKYGILKGGMMALWRILRCNPF 60

Query: 115 GSDGFDPVP 123
              G+DPV 
Sbjct: 61  NPGGYDPVK 69


>gi|330818732|ref|YP_004362437.1| hypothetical protein bgla_1g38840 [Burkholderia gladioli BSR3]
 gi|327371125|gb|AEA62481.1| hypothetical protein bgla_1g38840 [Burkholderia gladioli BSR3]
          Length = 88

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 41/69 (59%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I ++R Y++  S   G+ CR+ P+CS+Y  EAI  +G   G++L   RL +C+P 
Sbjct: 1   MQTVLIALLRFYKVAVSPFLGSRCRFYPSCSDYAREAIQYHGAARGTYLAARRLCRCHPF 60

Query: 115 GSDGFDPVP 123
            + G D VP
Sbjct: 61  SAGGIDLVP 69


>gi|295837760|ref|ZP_06824693.1| conserved hypothetical protein [Streptomyces sp. SPB74]
 gi|197698916|gb|EDY45849.1| conserved hypothetical protein [Streptomyces sp. SPB74]
          Length = 131

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 43/75 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   + +I++YQ   S + G  C+Y P+CS YG+ AI R+G   G+ LT  R+++CNP 
Sbjct: 1   MKYPLLALIKLYQWTISPLLGPVCKYYPSCSHYGFTAIDRHGAIKGTALTAWRILRCNPW 60

Query: 115 GSDGFDPVPDDLPPK 129
              G D VP    P+
Sbjct: 61  SHGGVDHVPPRKRPR 75


>gi|149202700|ref|ZP_01879672.1| hypothetical protein RTM1035_08784 [Roseovarius sp. TM1035]
 gi|149143982|gb|EDM32016.1| hypothetical protein RTM1035_08784 [Roseovarius sp. TM1035]
          Length = 82

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 40/67 (59%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           IR Y+LI S   G  CRY PTCS+Y  +A+ ++G   G  L   R+++CNP G  G DPV
Sbjct: 12  IRAYRLILSPWVGWHCRYHPTCSQYALDALEKHGALRGGLLAGWRILRCNPWGQCGHDPV 71

Query: 123 PDDLPPK 129
           P+    +
Sbjct: 72  PEPRKRR 78


>gi|323143417|ref|ZP_08078102.1| conserved hypothetical protein YidD [Succinatimonas hippei YIT
           12066]
 gi|322416822|gb|EFY07471.1| conserved hypothetical protein YidD [Succinatimonas hippei YIT
           12066]
          Length = 69

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 44/73 (60%), Gaps = 4/73 (5%)

Query: 62  IIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDP 121
           +IR YQ + S + G  CR+ P+CS+Y  EAI  +GL  GS+L   R+ +C+PL   G DP
Sbjct: 1   MIRTYQKLISPLLGQHCRFYPSCSQYTLEAIKEWGLIRGSYLGAKRICRCHPLNPGGIDP 60

Query: 122 VPDDLPPKKNNPK 134
           VP     K  NPK
Sbjct: 61  VPK----KNINPK 69


>gi|254977340|ref|ZP_05273812.1| hypothetical protein CdifQC_18600 [Clostridium difficile QCD-66c26]
 gi|255094670|ref|ZP_05324148.1| hypothetical protein CdifC_18731 [Clostridium difficile CIP 107932]
 gi|255316424|ref|ZP_05358007.1| hypothetical protein CdifQCD-7_18799 [Clostridium difficile
           QCD-76w55]
 gi|255519084|ref|ZP_05386760.1| hypothetical protein CdifQCD-_18333 [Clostridium difficile
           QCD-97b34]
 gi|255652267|ref|ZP_05399169.1| hypothetical protein CdifQCD_18915 [Clostridium difficile
           QCD-37x79]
 gi|306521982|ref|ZP_07408329.1| hypothetical protein CdifQ_21356 [Clostridium difficile QCD-32g58]
          Length = 83

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 41/65 (63%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            + I ++R YQ   S + G +CR+ PTCS+Y  EA  +YG   G +LT+ RL+KC+P   
Sbjct: 17  NLCIYLVRFYQKYISPLKGPTCRFYPTCSQYSIEAFKKYGFVKGMYLTIRRLLKCHPFHP 76

Query: 117 DGFDP 121
            G+DP
Sbjct: 77  GGYDP 81


>gi|255102897|ref|ZP_05331874.1| hypothetical protein CdifQCD-6_18941 [Clostridium difficile
           QCD-63q42]
 gi|255308717|ref|ZP_05352888.1| hypothetical protein CdifA_19146 [Clostridium difficile ATCC 43255]
          Length = 83

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 27/65 (41%), Positives = 41/65 (63%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            + I ++R YQ   S + G +CR+ PTCS+Y  EA  +YG   G +LT+ R++KC+P   
Sbjct: 17  NLCIYLVRFYQKYISPLKGPTCRFYPTCSQYSIEAFKKYGFVKGMYLTIRRILKCHPFHP 76

Query: 117 DGFDP 121
            G+DP
Sbjct: 77  GGYDP 81


>gi|325299417|ref|YP_004259334.1| hypothetical protein Bacsa_2313 [Bacteroides salanitronis DSM
           18170]
 gi|324318970|gb|ADY36861.1| UPF0161 protein yidD [Bacteroides salanitronis DSM 18170]
          Length = 73

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 43/73 (58%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            K +   + +  I  Y+   S     SCR+ PTCSEY  +AI ++G + G +L + RL++
Sbjct: 1   MKKILSFLLLLPIYFYRNCISPFTPPSCRFTPTCSEYAVQAIKKHGPFKGLYLAIRRLLR 60

Query: 111 CNPLGSDGFDPVP 123
           C+P G  G+DPVP
Sbjct: 61  CHPWGGSGYDPVP 73


>gi|194335114|ref|YP_002016974.1| hypothetical protein Paes_2336 [Prosthecochloris aestuarii DSM 271]
 gi|194312932|gb|ACF47327.1| protein of unknown function DUF37 [Prosthecochloris aestuarii DSM
           271]
          Length = 92

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 43/77 (55%), Gaps = 4/77 (5%)

Query: 60  IGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGF 119
           I +I  Y+   S + G SCR+ PTCS Y  +A  ++  +   +LT+ R+++CNP    G+
Sbjct: 15  IFLITFYRSYISPLTGPSCRFHPTCSRYAIDAFEQHNFFYAFYLTVWRVLRCNPFSRGGY 74

Query: 120 DPVP----DDLPPKKNN 132
           DPVP         K++N
Sbjct: 75  DPVPLPGNTSNSKKRDN 91


>gi|306834129|ref|ZP_07467249.1| alpha-hemolysin family protein [Streptococcus bovis ATCC 700338]
 gi|304423702|gb|EFM26848.1| alpha-hemolysin family protein [Streptococcus bovis ATCC 700338]
          Length = 87

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 1/86 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + + I +++ YQ   S +   SCRY P+CS Y   AI ++G   G  + + R+++C+P
Sbjct: 1   MIKKLLIALVKWYQKRISPITPPSCRYRPSCSYYMIVAIEKHG-LKGVIMGVARILRCHP 59

Query: 114 LGSDGFDPVPDDLPPKKNNPKLLSKK 139
               G DPVPD    ++N      K+
Sbjct: 60  FVEGGDDPVPDYFTLRRNKDYRKKKE 85


>gi|225028841|ref|ZP_03718033.1| hypothetical protein EUBHAL_03128 [Eubacterium hallii DSM 3353]
 gi|224953837|gb|EEG35046.1| hypothetical protein EUBHAL_03128 [Eubacterium hallii DSM 3353]
          Length = 70

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 31/70 (44%), Positives = 43/70 (61%), Gaps = 1/70 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFG-NSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
            ++I I IIR YQ   S + G  +C Y PTCS+Y  EAI ++G+  G  L   R+++CNP
Sbjct: 1   MKIILIKIIRFYQKYLSALKGRATCIYTPTCSQYAIEAIEKHGVLKGGLLAAWRILRCNP 60

Query: 114 LGSDGFDPVP 123
               G+DPVP
Sbjct: 61  FSKGGYDPVP 70


>gi|300866896|ref|ZP_07111570.1| conserved hypothetical protein [Oscillatoria sp. PCC 6506]
 gi|300335085|emb|CBN56732.1| conserved hypothetical protein [Oscillatoria sp. PCC 6506]
          Length = 74

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 26/71 (36%), Positives = 46/71 (64%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +++ IG+I+ Y+++ S     +CR+ PTCS+Y  EAI R+G+  G  + + R+++C+P 
Sbjct: 1   MKILLIGLIKGYKILISPHLPRACRFQPTCSQYAVEAIERFGVLQGGQMAISRILRCHPF 60

Query: 115 GSDGFDPVPDD 125
              G+DPVP  
Sbjct: 61  HPGGYDPVPPK 71


>gi|269797066|ref|YP_003316521.1| hypothetical protein Sked_38040 [Sanguibacter keddieii DSM 10542]
 gi|269099251|gb|ACZ23687.1| conserved hypothetical protein TIGR00278 [Sanguibacter keddieii DSM
           10542]
          Length = 100

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 28/108 (25%), Positives = 46/108 (42%), Gaps = 21/108 (19%)

Query: 20  QSSYALPIQKKGSPLLLKNNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCR 79
           Q+    P +++  P+                          G++R+YQ   S +    CR
Sbjct: 8   QTPPGQPARRRRRPVTS---------------------ALRGLVRLYQRYVSPLSPPRCR 46

Query: 80  YLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVPDDLP 127
           + P+CS Y   A+  +G   G+ L + R+++CNP  S G D VP   P
Sbjct: 47  FYPSCSAYAVLALEEHGALRGTRLAVWRVLRCNPWNSGGVDDVPGTGP 94


>gi|293191009|ref|ZP_06609053.1| putative toxin-antitoxin system, toxin component [Actinomyces
           odontolyticus F0309]
 gi|292820696|gb|EFF79662.1| putative toxin-antitoxin system, toxin component [Actinomyces
           odontolyticus F0309]
          Length = 121

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 27/69 (39%), Positives = 34/69 (49%)

Query: 56  RLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLG 115
           R +    I  YQ   S   G  CRY P+CS Y  +AI  +G   G  L   RL++CNP  
Sbjct: 9   RALMSAPIVAYQRYISPALGPRCRYAPSCSTYALQAIRVHGPIKGLILGTWRLLRCNPWS 68

Query: 116 SDGFDPVPD 124
             G D VP+
Sbjct: 69  HGGVDHVPE 77


>gi|290959007|ref|YP_003490189.1| hypothetical protein SCAB_45851 [Streptomyces scabiei 87.22]
 gi|260648533|emb|CBG71644.1| conserved hypothetical protein [Streptomyces scabiei 87.22]
          Length = 117

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 43/75 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   + +I++YQ   S + G  C+Y P+CS YGY AI R+G   G+ LT  R+++CNP 
Sbjct: 1   MKYPLLALIKLYQWTISPLLGPVCKYYPSCSHYGYTAIDRHGAIKGTALTAWRILRCNPW 60

Query: 115 GSDGFDPVPDDLPPK 129
              G D VP    P+
Sbjct: 61  SLGGVDHVPPRKRPR 75


>gi|163842274|ref|YP_001626679.1| putative cytoplasmic protein [Renibacterium salmoninarum ATCC
           33209]
 gi|162955750|gb|ABY25265.1| hypothetical cytosolic protein [Renibacterium salmoninarum ATCC
           33209]
          Length = 128

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 25/75 (33%), Positives = 42/75 (56%)

Query: 49  KFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRL 108
           +    L R I I ++  Y+ + S ++G  CRY P+CS Y  EA   +G   GS+  + R+
Sbjct: 9   RLIWRLPRNILILLLTGYRAVISPLYGQVCRYFPSCSSYALEAFTLHGAVKGSFFAIRRI 68

Query: 109 IKCNPLGSDGFDPVP 123
           ++C+P  + G D +P
Sbjct: 69  LRCHPWAAGGIDNLP 83


>gi|296115058|ref|ZP_06833700.1| hypothetical protein GXY_04739 [Gluconacetobacter hansenii ATCC
           23769]
 gi|295978395|gb|EFG85131.1| hypothetical protein GXY_04739 [Gluconacetobacter hansenii ATCC
           23769]
          Length = 81

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 44/63 (69%)

Query: 61  GIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFD 120
            +IR YQL+   V G +CR+ P+CS Y  +A+AR+G W G  ++L R+++CNP  + G+D
Sbjct: 3   AMIRAYQLVIRPVIGANCRFTPSCSHYARDALARHGAWRGGLMSLWRIMRCNPWNAGGYD 62

Query: 121 PVP 123
           PVP
Sbjct: 63  PVP 65


>gi|291294534|ref|YP_003505932.1| hypothetical protein Mrub_0132 [Meiothermus ruber DSM 1279]
 gi|290469493|gb|ADD26912.1| protein of unknown function DUF37 [Meiothermus ruber DSM 1279]
          Length = 85

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 30/80 (37%), Positives = 47/80 (58%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           +  L   G +R Y+   S +   +CR+ PTCS Y  EA+ R+G + G +L++ R++KC+P
Sbjct: 1   MINLFLKGSVRFYRRFISPLKPPTCRFYPTCSHYALEALERHGPFWGLYLSVKRILKCHP 60

Query: 114 LGSDGFDPVPDDLPPKKNNP 133
           L   G D VP + P  + NP
Sbjct: 61  LHPGGLDYVPTERPRVRWNP 80


>gi|110638809|ref|YP_679018.1| hypothetical protein CHU_2420 [Cytophaga hutchinsonii ATCC 33406]
 gi|123163402|sp|Q11SD8|Y2420_CYTH3 RecName: Full=UPF0161 protein CHU_2420
 gi|110281490|gb|ABG59676.1| conserved hypothetical protein [Cytophaga hutchinsonii ATCC 33406]
          Length = 79

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 31/68 (45%), Positives = 41/68 (60%)

Query: 56  RLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLG 115
           + + I  ++IYQ   S +   +CRY PTCSEY  +AI +YG   G WL   R+  CNP G
Sbjct: 12  KQVFIIPVKIYQYSISPLLPGACRYTPTCSEYCVQAIEKYGPLKGIWLGTKRICSCNPWG 71

Query: 116 SDGFDPVP 123
             G+DPVP
Sbjct: 72  GSGYDPVP 79


>gi|293393718|ref|ZP_06638026.1| conserved hypothetical protein [Serratia odorifera DSM 4582]
 gi|291423762|gb|EFE96983.1| conserved hypothetical protein [Serratia odorifera DSM 4582]
          Length = 70

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 32/70 (45%), Positives = 46/70 (65%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           +R YQL+ S + G  CR+ PTCS Y  EA++R+G+  GSWLT+ R++KC+PL   G DPV
Sbjct: 1   MRAYQLVISPLLGPRCRFQPTCSHYAIEALSRFGMIKGSWLTVKRVLKCHPLNPGGDDPV 60

Query: 123 PDDLPPKKNN 132
           P      + +
Sbjct: 61  PPKTDDNREH 70


>gi|269798911|ref|YP_003312811.1| hypothetical protein Vpar_1857 [Veillonella parvula DSM 2008]
 gi|269095540|gb|ACZ25531.1| protein of unknown function DUF37 [Veillonella parvula DSM 2008]
          Length = 73

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 30/67 (44%), Positives = 42/67 (62%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
           ++   +IR YQL  S +    CRY PTCS Y  +AI +YG   GSW+ L R+++C+P   
Sbjct: 7   MLLRLLIRFYQLAISPLKPGCCRYYPTCSTYTLQAIEKYGPLKGSWMGLKRILRCHPFHK 66

Query: 117 DGFDPVP 123
            G+DPVP
Sbjct: 67  GGYDPVP 73


>gi|302552692|ref|ZP_07305034.1| conserved hypothetical protein [Streptomyces viridochromogenes DSM
           40736]
 gi|302470310|gb|EFL33403.1| conserved hypothetical protein [Streptomyces viridochromogenes DSM
           40736]
          Length = 124

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 43/75 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   + +I++YQ   S + G  C+Y P+CS YGY AI R+G   G+ LT  R+++CNP 
Sbjct: 1   MKYPLLALIKLYQWTISPLLGPVCKYYPSCSHYGYTAIDRHGAIKGTALTAWRILRCNPW 60

Query: 115 GSDGFDPVPDDLPPK 129
              G D VP    P+
Sbjct: 61  SLGGVDHVPPRKRPR 75


>gi|255326484|ref|ZP_05367566.1| conserved hypothetical protein [Rothia mucilaginosa ATCC 25296]
 gi|255296524|gb|EET75859.1| conserved hypothetical protein [Rothia mucilaginosa ATCC 25296]
          Length = 157

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 28/71 (39%), Positives = 44/71 (61%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           L + + I  ++ Y+ + S ++GN CRY PTCS Y  EA+  +G   G  LT+ R+++C P
Sbjct: 54  LPQNLLIACMKAYRKVVSPLYGNVCRYYPTCSAYALEALTTHGAMGGLSLTVRRILRCVP 113

Query: 114 LGSDGFDPVPD 124
             + G DPVP+
Sbjct: 114 WATGGIDPVPE 124


>gi|126737060|ref|ZP_01752795.1| hypothetical protein RSK20926_11534 [Roseobacter sp. SK209-2-6]
 gi|126721645|gb|EBA18348.1| hypothetical protein RSK20926_11534 [Roseobacter sp. SK209-2-6]
          Length = 77

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 35/76 (46%), Positives = 48/76 (63%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           +    I    +R Y+LIFS   G +CRY PTCS Y  EA+ ++G   G+WLT  R+ +C+
Sbjct: 2   SPLAHILALPVRAYRLIFSPWVGFNCRYQPTCSAYALEALEKHGGLKGAWLTARRIGRCH 61

Query: 113 PLGSDGFDPVPDDLPP 128
           PLG DG+DPVP+   P
Sbjct: 62  PLGGDGYDPVPERKDP 77


>gi|302535576|ref|ZP_07287918.1| conserved hypothetical protein [Streptomyces sp. C]
 gi|302444471|gb|EFL16287.1| conserved hypothetical protein [Streptomyces sp. C]
          Length = 93

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 43/75 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   + +I++YQ   S + G  CRY P+CS YG+ AI R+G   G+ LT  R+++CNP 
Sbjct: 1   MKYPLLALIKLYQWTISPLLGPVCRYYPSCSHYGFTAIDRHGAVKGTALTAWRILRCNPW 60

Query: 115 GSDGFDPVPDDLPPK 129
              G D VP    P+
Sbjct: 61  SPGGVDHVPPRKRPR 75


>gi|228471816|ref|ZP_04056589.1| conserved hypothetical protein [Capnocytophaga gingivalis ATCC
           33624]
 gi|228276969|gb|EEK15664.1| conserved hypothetical protein [Capnocytophaga gingivalis ATCC
           33624]
          Length = 77

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 30/70 (42%), Positives = 43/70 (61%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           L     I ++R YQ+  S +   +CR+ PTCS Y  EA+ +YGL  G  L L R+++C+P
Sbjct: 8   LLTYPFILLVRFYQVAISPLKPPTCRFSPTCSTYALEALKKYGLLKGGRLALRRIMRCHP 67

Query: 114 LGSDGFDPVP 123
            G  G+DPVP
Sbjct: 68  WGGSGYDPVP 77


>gi|32130461|sp|Q9PEN9|Y989_XYLFA RecName: Full=UPF0161 protein XF_0989
          Length = 92

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 47/75 (62%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            I +++IY+ + S + G  CR+ P+CSEY   AIAR+G   G WL   RL +C PL   G
Sbjct: 9   LILLLKIYKRLISPLLGPHCRFEPSCSEYAMGAIARFGTLRGIWLAARRLARCQPLQPGG 68

Query: 119 FDPVPDDLPPKKNNP 133
           +DPVPD++  + N P
Sbjct: 69  YDPVPDNISTQVNPP 83


>gi|33866225|ref|NP_897784.1| hypothetical protein SYNW1693 [Synechococcus sp. WH 8102]
 gi|47606262|sp|Q7U5L0|Y1693_SYNPX RecName: Full=UPF0161 protein SYNW1693
 gi|33639200|emb|CAE08208.1| conserved hypothetical protein [Synechococcus sp. WH 8102]
          Length = 66

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 32/66 (48%), Positives = 41/66 (62%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            +  I  Y+   S + G  CR+ PTCS YG EAI R+G W G WLT+ RL++C+P    G
Sbjct: 1   MLAGIGFYRRFISPLIGPRCRFTPTCSAYGLEAIQRHGPWKGGWLTVKRLLRCHPFTPCG 60

Query: 119 FDPVPD 124
            DPVPD
Sbjct: 61  CDPVPD 66


>gi|34763008|ref|ZP_00143984.1| Hypothetical Cytosolic Protein [Fusobacterium nucleatum subsp.
           vincentii ATCC 49256]
 gi|237741005|ref|ZP_04571486.1| alpha-hemolysin [Fusobacterium sp. 4_1_13]
 gi|256846681|ref|ZP_05552137.1| conserved hypothetical protein [Fusobacterium sp. 3_1_36A2]
 gi|294784388|ref|ZP_06749679.1| alpha-hemolysin [Fusobacterium sp. 3_1_27]
 gi|27887309|gb|EAA24403.1| Hypothetical Cytosolic Protein [Fusobacterium nucleatum subsp.
           vincentii ATCC 49256]
 gi|229431049|gb|EEO41261.1| alpha-hemolysin [Fusobacterium sp. 4_1_13]
 gi|256717901|gb|EEU31458.1| conserved hypothetical protein [Fusobacterium sp. 3_1_36A2]
 gi|294487960|gb|EFG35315.1| alpha-hemolysin [Fusobacterium sp. 3_1_27]
          Length = 82

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 31/74 (41%), Positives = 42/74 (56%), Gaps = 5/74 (6%)

Query: 66  YQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVPDD 125
           YQ   S +F   CR+ PTCS+Y  EAI  YG   G++L + R++KC+P    G+DPVP  
Sbjct: 12  YQKFISPMFPAKCRFYPTCSQYTLEAIKEYGAIKGTYLGIKRILKCHPFHEGGYDPVP-- 69

Query: 126 LPPKKNNPKLLSKK 139
              K+ N     KK
Sbjct: 70  ---KRKNKNSEGKK 80


>gi|89897804|ref|YP_521291.1| hypothetical protein DSY5058 [Desulfitobacterium hafniense Y51]
 gi|116256250|sp|Q24M95|Y5058_DESHY RecName: Full=UPF0161 protein DSY5058
 gi|89337252|dbj|BAE86847.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 69

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 32/69 (46%), Positives = 47/69 (68%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + + IG+IRIYQ   S +   SCR+ PTCSEY  +AI +YG+  G W +L+R++KC+P
Sbjct: 1   MMKRLLIGMIRIYQRYISPLKRPSCRFYPTCSEYSIQAIQKYGVVKGCWKSLVRILKCHP 60

Query: 114 LGSDGFDPV 122
               G+DPV
Sbjct: 61  FHPGGYDPV 69


>gi|288905990|ref|YP_003431212.1| hypothetical protein GALLO_1799 [Streptococcus gallolyticus UCN34]
 gi|288732716|emb|CBI14290.1| conserved hypothetical protein [Streptococcus gallolyticus UCN34]
          Length = 86

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 28/85 (32%), Positives = 45/85 (52%), Gaps = 1/85 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   I +++ YQ   S +   SCRY PTCS Y   AI ++G   G  + + R+++C+P 
Sbjct: 1   MKKSLIALVKWYQKRISPMSPPSCRYRPTCSNYMIGAIEKHG-LKGVLMGIARILRCHPF 59

Query: 115 GSDGFDPVPDDLPPKKNNPKLLSKK 139
            + G DPVPD    ++N      K+
Sbjct: 60  VTGGDDPVPDYFTLRRNKDFRTKKE 84


>gi|302520510|ref|ZP_07272852.1| conserved hypothetical protein [Streptomyces sp. SPB78]
 gi|318058973|ref|ZP_07977696.1| hypothetical protein SSA3_13581 [Streptomyces sp. SA3_actG]
 gi|333025723|ref|ZP_08453787.1| hypothetical protein STTU_3227 [Streptomyces sp. Tu6071]
 gi|302429405|gb|EFL01221.1| conserved hypothetical protein [Streptomyces sp. SPB78]
 gi|332745575|gb|EGJ76016.1| hypothetical protein STTU_3227 [Streptomyces sp. Tu6071]
          Length = 131

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 44/75 (58%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   + +I++YQ I S + G  C+Y P+CS YG+ AI R+G   G+ LT  R+++CNP 
Sbjct: 1   MKYPLLALIKLYQWIISPLLGPVCKYYPSCSHYGFTAIDRHGAIKGTALTAWRILRCNPW 60

Query: 115 GSDGFDPVPDDLPPK 129
              G D VP    P+
Sbjct: 61  SHGGVDHVPPRKRPR 75


>gi|281424609|ref|ZP_06255522.1| putative toxin-antitoxin system, toxin component [Prevotella oris
           F0302]
 gi|281401280|gb|EFB32111.1| putative toxin-antitoxin system, toxin component [Prevotella oris
           F0302]
          Length = 83

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 27/65 (41%), Positives = 39/65 (60%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            +  I  YQ + S     SCR+ PTCSEY  +A+ ++G   G  L + R+++CNP G  G
Sbjct: 19  LLLPILFYQHVISPFTPPSCRFTPTCSEYARQALMKHGPLKGLALAVWRILRCNPWGGSG 78

Query: 119 FDPVP 123
           +DPVP
Sbjct: 79  YDPVP 83


>gi|329929637|ref|ZP_08283336.1| YidD family protein [Paenibacillus sp. HGF5]
 gi|328936014|gb|EGG32468.1| YidD family protein [Paenibacillus sp. HGF5]
          Length = 85

 Score =  100 bits (250), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 26/69 (37%), Positives = 35/69 (50%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R +    I  Y+   S +   +CR+ PTCS Y  EAI  +G   GSWL   R+ +C+P 
Sbjct: 4   ARRVVKVPIHFYRKFISPLKPATCRFYPTCSAYALEAIEVHGALKGSWLAAKRIARCHPF 63

Query: 115 GSDGFDPVP 123
              G D VP
Sbjct: 64  HPGGIDLVP 72


>gi|302559669|ref|ZP_07312011.1| conserved hypothetical protein [Streptomyces griseoflavus Tu4000]
 gi|302477287|gb|EFL40380.1| conserved hypothetical protein [Streptomyces griseoflavus Tu4000]
          Length = 124

 Score =  100 bits (250), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 43/75 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   + +I+IYQ   S + G  C+Y P+CS YGY AI R+G   G+ LT  R+++CNP 
Sbjct: 1   MKYPLLALIKIYQWTISPLLGPVCKYYPSCSHYGYTAIDRHGAIKGTALTAWRILRCNPW 60

Query: 115 GSDGFDPVPDDLPPK 129
              G D VP    P+
Sbjct: 61  SLGGVDHVPPRKRPR 75


>gi|319945015|ref|ZP_08019277.1| hypothetical protein HMPREF0551_2125 [Lautropia mirabilis ATCC
           51599]
 gi|319741585|gb|EFV94010.1| hypothetical protein HMPREF0551_2125 [Lautropia mirabilis ATCC
           51599]
          Length = 105

 Score =  100 bits (250), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 34/75 (45%), Positives = 45/75 (60%)

Query: 49  KFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRL 108
              +         +++ YQ  FS+VF  SCRY P+CSEY  EA+  +G+  GSWLTL RL
Sbjct: 14  SVARRPLVRALTAVVKGYQRGFSSVFPPSCRYWPSCSEYAIEALQLHGVARGSWLTLRRL 73

Query: 109 IKCNPLGSDGFDPVP 123
            +C+P G  G DPVP
Sbjct: 74  CRCHPWGGHGVDPVP 88


>gi|21222289|ref|NP_628068.1| hypothetical protein SCO3882 [Streptomyces coelicolor A3(2)]
 gi|256786610|ref|ZP_05525041.1| hypothetical protein SlivT_19146 [Streptomyces lividans TK24]
 gi|289770502|ref|ZP_06529880.1| UPF0161 protein [Streptomyces lividans TK24]
 gi|14286028|sp|O54625|Y3882_STRCO RecName: Full=UPF0161 protein SCO3882
 gi|6539749|gb|AAF16009.1|AF187159_9 Orf124 [Streptomyces coelicolor A3(2)]
 gi|2898108|gb|AAC03488.1| 9-10kDa protein-like [Streptomyces coelicolor A3(2)]
 gi|4808378|emb|CAB42698.1| hypothetical protein [Streptomyces coelicolor A3(2)]
 gi|289700701|gb|EFD68130.1| UPF0161 protein [Streptomyces lividans TK24]
          Length = 124

 Score =  100 bits (250), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 43/75 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   + +I++YQ   S + G  C+Y P+CS YGY AI R+G   G+ LT  R+++CNP 
Sbjct: 1   MKYPLLALIKLYQWTISPLLGPVCKYYPSCSHYGYTAIDRHGAVKGTALTAWRILRCNPW 60

Query: 115 GSDGFDPVPDDLPPK 129
              G D VP    P+
Sbjct: 61  SLGGVDHVPPRKRPR 75


>gi|39936457|ref|NP_948733.1| hypothetical protein RPA3394 [Rhodopseudomonas palustris CGA009]
 gi|39650312|emb|CAE28835.1| DUF37 [Rhodopseudomonas palustris CGA009]
          Length = 152

 Score =  100 bits (250), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 39/98 (39%), Positives = 56/98 (57%), Gaps = 1/98 (1%)

Query: 32  SPLLLKNNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEA 91
              LL     +  +W  +  + L R  G G+I +Y+   S + G +CR+ PTCS YG EA
Sbjct: 19  KRHLLMQLPSRGTDWIAQVLR-LPRNAGRGLIWLYRHTLSPLVGYNCRHYPTCSMYGDEA 77

Query: 92  IARYGLWIGSWLTLLRLIKCNPLGSDGFDPVPDDLPPK 129
           I ++GLW G W+TL RL++C P G+ G D VP   P +
Sbjct: 78  IRKFGLWAGGWMTLARLLRCQPWGTSGIDLVPQTAPSR 115


>gi|116873104|ref|YP_849885.1| hypothetical protein lwe1688 [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|123463881|sp|A0AJC4|Y1688_LISW6 RecName: Full=UPF0161 protein lwe1688
 gi|116741982|emb|CAK21106.1| conserved hypothetical protein [Listeria welshimeri serovar 6b str.
           SLCC5334]
          Length = 73

 Score =  100 bits (250), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 40/71 (56%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + IG IR+YQ   S     +CR+ PTCS YG EAI  +G   GS+L + R+ KC+P 
Sbjct: 1   MKKMLIGGIRLYQKYISRFTPATCRFYPTCSAYGIEAIETHGALKGSYLAIKRISKCHPF 60

Query: 115 GSDGFDPVPDD 125
              G D VP  
Sbjct: 61  HKGGLDFVPPK 71


>gi|34540056|ref|NP_904535.1| hypothetical protein PG0200 [Porphyromonas gingivalis W83]
 gi|188994172|ref|YP_001928424.1| hypothetical protein PGN_0308 [Porphyromonas gingivalis ATCC 33277]
 gi|47606106|sp|Q7MXI5|Y200_PORGI RecName: Full=UPF0161 protein PG_0200
 gi|226703698|sp|B2RHI2|Y308_PORG3 RecName: Full=UPF0161 protein PGN_0308
 gi|34396367|gb|AAQ65434.1| conserved hypothetical protein TIGR00278 [Porphyromonas gingivalis
           W83]
 gi|188593852|dbj|BAG32827.1| conserved hypothetical protein [Porphyromonas gingivalis ATCC
           33277]
          Length = 76

 Score =  100 bits (250), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 26/76 (34%), Positives = 42/76 (55%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
            +  K     + +  I  Y+   S +   SCR+ P+CS Y  EA+ +YG   G  L++ R
Sbjct: 1   MRLIKAFLVQLLLLPIFFYKRFISPLTPPSCRFTPSCSSYAIEALRKYGPGKGLLLSIKR 60

Query: 108 LIKCNPLGSDGFDPVP 123
           +++C+P G  G+DPVP
Sbjct: 61  ILRCHPWGGSGYDPVP 76


>gi|34499860|ref|NP_904075.1| hypothetical protein CV_4405 [Chromobacterium violaceum ATCC 12472]
 gi|34105710|gb|AAQ62064.1| conserved hypothetical protein [Chromobacterium violaceum ATCC
           12472]
          Length = 62

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 27/62 (43%), Positives = 37/62 (59%)

Query: 62  IIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDP 121
           +IR YQL  S      CR+ PTCS Y  EA++++G   G  L   R+ +C+P G  G+DP
Sbjct: 1   MIRFYQLAISPWLAPRCRFQPTCSGYAIEAVSKHGALKGGCLAARRICRCHPWGGSGYDP 60

Query: 122 VP 123
           VP
Sbjct: 61  VP 62


>gi|325106612|ref|YP_004267680.1| hypothetical protein Plabr_0026 [Planctomyces brasiliensis DSM
           5305]
 gi|324966880|gb|ADY57658.1| UPF0161 protein yidD [Planctomyces brasiliensis DSM 5305]
          Length = 79

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 44/73 (60%)

Query: 49  KFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRL 108
           +F   L   I I ++RIYQ   S + G  CR+ PTCS Y   A+ +YG   GSW  L+R+
Sbjct: 6   RFLWNLPGEILIFLVRIYQWTLSPLIGRQCRFQPTCSHYYIGAVRKYGAIRGSWKGLVRI 65

Query: 109 IKCNPLGSDGFDP 121
           I+CNP G  G+DP
Sbjct: 66  IRCNPWGGSGYDP 78


>gi|255693351|ref|ZP_05417026.1| putative toxin-antitoxin system, toxin component [Bacteroides
           finegoldii DSM 17565]
 gi|260620928|gb|EEX43799.1| putative toxin-antitoxin system, toxin component [Bacteroides
           finegoldii DSM 17565]
          Length = 91

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 27/67 (40%), Positives = 42/67 (62%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            + +  I  Y++  S +   SCR+ PTCS Y  EAI ++G   G +LT+ R+++C+P G 
Sbjct: 25  FLLLIPIYFYRVCISPLTPPSCRFTPTCSAYAVEAIKKHGPVKGLYLTVRRILRCHPWGG 84

Query: 117 DGFDPVP 123
            G+DPVP
Sbjct: 85  SGYDPVP 91


>gi|254423253|ref|ZP_05036971.1| conserved hypothetical protein TIGR00278 [Synechococcus sp. PCC
           7335]
 gi|196190742|gb|EDX85706.1| conserved hypothetical protein TIGR00278 [Synechococcus sp. PCC
           7335]
          Length = 83

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 44/74 (59%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +L  + +++ Y+ + S +F   CR+ PTCS Y  +AI R+G   G+WLT  R  +C+PL
Sbjct: 9   MKLTLLLLVKGYRQLISPLFPPMCRFEPTCSRYALDAIDRFGPLQGTWLTAKRFCRCHPL 68

Query: 115 GSDGFDPVPDDLPP 128
              G+DPVP+    
Sbjct: 69  HPGGYDPVPEKKSV 82


>gi|251781835|ref|YP_002996137.1| hypothetical protein SDEG_0421 [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
 gi|242390464|dbj|BAH80923.1| hypothetical protein SDEG_0421 [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
          Length = 83

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
           + +  ++ YQ   S +F  +CRY PTCS Y   AI ++G   G  + L R+++C+P  + 
Sbjct: 5   LLVAPVKAYQRYISPLFPPTCRYRPTCSAYMITAIEKHGA-KGVLMGLARILRCHPFVAG 63

Query: 118 GFDPVPDDLPPKKNNPKLLS 137
           G D VPD    K+NN  L  
Sbjct: 64  GDDSVPDHFSLKRNNKALKK 83


>gi|29376441|ref|NP_815595.1| hypothetical protein EF1913 [Enterococcus faecalis V583]
 gi|227519260|ref|ZP_03949309.1| alpha-hemolysin [Enterococcus faecalis TX0104]
 gi|255972441|ref|ZP_05423027.1| conserved hypothetical protein [Enterococcus faecalis T1]
 gi|255975541|ref|ZP_05426127.1| conserved hypothetical protein [Enterococcus faecalis T2]
 gi|256619395|ref|ZP_05476241.1| conserved hypothetical protein [Enterococcus faecalis ATCC 4200]
 gi|256762851|ref|ZP_05503431.1| conserved hypothetical protein [Enterococcus faecalis T3]
 gi|256853435|ref|ZP_05558805.1| conserved hypothetical protein [Enterococcus faecalis T8]
 gi|256959233|ref|ZP_05563404.1| conserved hypothetical protein [Enterococcus faecalis DS5]
 gi|256961590|ref|ZP_05565761.1| conserved hypothetical protein [Enterococcus faecalis Merz96]
 gi|256964806|ref|ZP_05568977.1| conserved hypothetical protein [Enterococcus faecalis HIP11704]
 gi|257079301|ref|ZP_05573662.1| conserved hypothetical protein [Enterococcus faecalis JH1]
 gi|257082260|ref|ZP_05576621.1| conserved hypothetical protein [Enterococcus faecalis E1Sol]
 gi|257084877|ref|ZP_05579238.1| conserved hypothetical protein [Enterococcus faecalis Fly1]
 gi|257087126|ref|ZP_05581487.1| conserved hypothetical protein [Enterococcus faecalis D6]
 gi|257090203|ref|ZP_05584564.1| conserved hypothetical protein [Enterococcus faecalis CH188]
 gi|257416356|ref|ZP_05593350.1| conserved hypothetical protein [Enterococcus faecalis AR01/DG]
 gi|257419605|ref|ZP_05596599.1| conserved hypothetical protein [Enterococcus faecalis T11]
 gi|257422289|ref|ZP_05599279.1| conserved hypothetical protein [Enterococcus faecalis X98]
 gi|294779797|ref|ZP_06745184.1| conserved hypothetical protein YidD [Enterococcus faecalis PC1.1]
 gi|300860830|ref|ZP_07106917.1| conserved hypothetical protein YidD [Enterococcus faecalis TUSoD
           Ef11]
 gi|47606273|sp|Q833N1|Y1913_ENTFA RecName: Full=UPF0161 protein EF_1913
 gi|29343905|gb|AAO81665.1| conserved hypothetical protein TIGR00278 [Enterococcus faecalis
           V583]
 gi|227073272|gb|EEI11235.1| alpha-hemolysin [Enterococcus faecalis TX0104]
 gi|255963459|gb|EET95935.1| conserved hypothetical protein [Enterococcus faecalis T1]
 gi|255968413|gb|EET99035.1| conserved hypothetical protein [Enterococcus faecalis T2]
 gi|256598922|gb|EEU18098.1| conserved hypothetical protein [Enterococcus faecalis ATCC 4200]
 gi|256684102|gb|EEU23797.1| conserved hypothetical protein [Enterococcus faecalis T3]
 gi|256711894|gb|EEU26932.1| conserved hypothetical protein [Enterococcus faecalis T8]
 gi|256949729|gb|EEU66361.1| conserved hypothetical protein [Enterococcus faecalis DS5]
 gi|256952086|gb|EEU68718.1| conserved hypothetical protein [Enterococcus faecalis Merz96]
 gi|256955302|gb|EEU71934.1| conserved hypothetical protein [Enterococcus faecalis HIP11704]
 gi|256987331|gb|EEU74633.1| conserved hypothetical protein [Enterococcus faecalis JH1]
 gi|256990290|gb|EEU77592.1| conserved hypothetical protein [Enterococcus faecalis E1Sol]
 gi|256992907|gb|EEU80209.1| conserved hypothetical protein [Enterococcus faecalis Fly1]
 gi|256995156|gb|EEU82458.1| conserved hypothetical protein [Enterococcus faecalis D6]
 gi|256999015|gb|EEU85535.1| conserved hypothetical protein [Enterococcus faecalis CH188]
 gi|257158184|gb|EEU88144.1| conserved hypothetical protein [Enterococcus faecalis ARO1/DG]
 gi|257161433|gb|EEU91393.1| conserved hypothetical protein [Enterococcus faecalis T11]
 gi|257164113|gb|EEU94073.1| conserved hypothetical protein [Enterococcus faecalis X98]
 gi|294453171|gb|EFG21586.1| conserved hypothetical protein YidD [Enterococcus faecalis PC1.1]
 gi|295113198|emb|CBL31835.1| conserved hypothetical protein TIGR00278 [Enterococcus sp. 7L76]
 gi|300849869|gb|EFK77619.1| conserved hypothetical protein YidD [Enterococcus faecalis TUSoD
           Ef11]
 gi|327535431|gb|AEA94265.1| alpha-hemolysin-like protein [Enterococcus faecalis OG1RF]
          Length = 100

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 40/81 (49%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   IG +R YQ   S      CRY PTCS+Y  +AI  +G   G+ + + R+++C+P 
Sbjct: 1   MKNPLIGGVRFYQRFISPGLPARCRYYPTCSQYMIDAIHTHGSVKGTTMGVARILRCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNNPKL 135
              G D VP      KN  + 
Sbjct: 61  VKGGIDYVPLKFRLTKNPDET 81


>gi|229816222|ref|ZP_04446532.1| hypothetical protein COLINT_03272 [Collinsella intestinalis DSM
           13280]
 gi|229808230|gb|EEP44022.1| hypothetical protein COLINT_03272 [Collinsella intestinalis DSM
           13280]
          Length = 70

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 42/70 (60%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + +   I  I  YQ   S +  ++C Y+PTCS+Y  EAI  YG+  G WL L R+++C P
Sbjct: 1   MFKRAVIAAIHWYQRCVSPLLPDACIYIPTCSQYAVEAIQAYGVIKGCWLGLRRILRCVP 60

Query: 114 LGSDGFDPVP 123
             + G+DPVP
Sbjct: 61  THAGGYDPVP 70


>gi|254452262|ref|ZP_05065699.1| conserved hypothetical protein TIGR00278 [Octadecabacter
           antarcticus 238]
 gi|198266668|gb|EDY90938.1| conserved hypothetical protein TIGR00278 [Octadecabacter
           antarcticus 238]
          Length = 77

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 33/72 (45%), Positives = 45/72 (62%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           +   LI    IR Y+L+FS   G+ CR+ PTCS Y  EA+ ++G   G+ LT+ R+I+CN
Sbjct: 6   SPLALIASLPIRFYRLVFSPWVGHGCRFHPTCSAYAMEALRKHGGIKGTALTIRRVIRCN 65

Query: 113 PLGSDGFDPVPD 124
           P G  G D VPD
Sbjct: 66  PWGGSGVDNVPD 77


>gi|282858212|ref|ZP_06267402.1| conserved hypothetical protein [Pyramidobacter piscolens W5455]
 gi|282583943|gb|EFB89321.1| conserved hypothetical protein [Pyramidobacter piscolens W5455]
          Length = 72

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 26/71 (36%), Positives = 38/71 (53%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            +  IR Y+   S + G+ CR+ P+CS Y  EA+  +G   G  L + RL++C P    G
Sbjct: 1   MVLPIRGYKRWISPLLGHRCRFYPSCSSYAIEALKVHGPVRGLLLAVWRLLRCGPWSEGG 60

Query: 119 FDPVPDDLPPK 129
           FDPVP     +
Sbjct: 61  FDPVPPARKRR 71


>gi|126728221|ref|ZP_01744037.1| hypothetical protein SSE37_19562 [Sagittula stellata E-37]
 gi|126711186|gb|EBA10236.1| hypothetical protein SSE37_19562 [Sagittula stellata E-37]
          Length = 73

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 40/62 (64%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           +R Y+L+ S   G+ CRY PTCS Y  EA+ ++G   G+WL + R+ +C+P G  G D V
Sbjct: 12  VRAYRLVGSPWVGHGCRYHPTCSAYAMEALEKHGALKGAWLAIRRIGRCHPWGGSGIDNV 71

Query: 123 PD 124
           PD
Sbjct: 72  PD 73


>gi|94495882|ref|ZP_01302461.1| hypothetical protein SKA58_14907 [Sphingomonas sp. SKA58]
 gi|94424574|gb|EAT09596.1| hypothetical protein SKA58_14907 [Sphingomonas sp. SKA58]
          Length = 70

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 31/67 (46%), Positives = 43/67 (64%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            + I I R +QL  S +   +CRY P+CSEY  +A+ +YG   GSWL   RL++C+P G 
Sbjct: 4   RLLILIARFWQLGPSRILPPTCRYAPSCSEYAIQAVRKYGAIKGSWLGFKRLMRCHPWGG 63

Query: 117 DGFDPVP 123
            G+DPVP
Sbjct: 64  SGYDPVP 70


>gi|326560697|gb|EGE11065.1| hypothetical protein E9M_07209 [Moraxella catarrhalis 46P47B1]
 gi|326561740|gb|EGE12075.1| hypothetical protein E9G_01483 [Moraxella catarrhalis 7169]
 gi|326562319|gb|EGE12645.1| hypothetical protein E9K_08072 [Moraxella catarrhalis 103P14B1]
 gi|326563096|gb|EGE13369.1| hypothetical protein E9O_09399 [Moraxella catarrhalis 12P80B1]
 gi|326569039|gb|EGE19108.1| hypothetical protein E9Q_03403 [Moraxella catarrhalis BC1]
 gi|326571728|gb|EGE21741.1| hypothetical protein E9U_02236 [Moraxella catarrhalis BC8]
 gi|326571817|gb|EGE21823.1| hypothetical protein E9S_01789 [Moraxella catarrhalis BC7]
 gi|326573505|gb|EGE23471.1| hypothetical protein EA1_08954 [Moraxella catarrhalis O35E]
 gi|326574358|gb|EGE24301.1| hypothetical protein E9W_05534 [Moraxella catarrhalis CO72]
 gi|326575523|gb|EGE25448.1| hypothetical protein E9Y_03641 [Moraxella catarrhalis 101P30B1]
          Length = 106

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 26/70 (37%), Positives = 39/70 (55%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + I + +I IY+   S +    CRY PTCS Y  +AI  +G   G  L++ R+ +C+P
Sbjct: 1   MLKNILLILIEIYRRWISPMMTPRCRYYPTCSAYSRQAIIWHGAIKGLRLSIWRIGRCHP 60

Query: 114 LGSDGFDPVP 123
            G  G D VP
Sbjct: 61  WGGCGIDFVP 70


>gi|296131545|ref|YP_003638795.1| protein of unknown function DUF37 [Cellulomonas flavigena DSM
           20109]
 gi|296023360|gb|ADG76596.1| protein of unknown function DUF37 [Cellulomonas flavigena DSM
           20109]
          Length = 98

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 45/82 (54%), Gaps = 2/82 (2%)

Query: 44  RNWNGKFP--KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGS 101
            +W+  F   + +   + + ++ +Y+ + S +   +CR+ P+CS+Y   A+ R+G   G 
Sbjct: 1   MSWSAVFRVVRGVPAGVLLALLWVYRRVISPLTPPTCRFYPSCSQYAVTAVRRHGAARGG 60

Query: 102 WLTLLRLIKCNPLGSDGFDPVP 123
           WL + R+ +C+P    G D VP
Sbjct: 61  WLAVRRVARCHPWNPGGVDDVP 82


>gi|260887481|ref|ZP_05898744.1| putative toxin-antitoxin system, toxin component [Selenomonas
           sputigena ATCC 35185]
 gi|260862768|gb|EEX77268.1| putative toxin-antitoxin system, toxin component [Selenomonas
           sputigena ATCC 35185]
          Length = 66

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 28/66 (42%), Positives = 43/66 (65%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
           + + +IR Y+   S +   SCRY+PTCSEY   A+ +YG   GS+L + R+++C+P    
Sbjct: 1   MLLLLIRFYRGFLSPLKPPSCRYIPTCSEYAMIAVEKYGAAKGSFLAIKRILRCHPFHKG 60

Query: 118 GFDPVP 123
           G+DPVP
Sbjct: 61  GYDPVP 66


>gi|227500989|ref|ZP_03931038.1| alpha-hemolysin [Anaerococcus tetradius ATCC 35098]
 gi|227216762|gb|EEI82160.1| alpha-hemolysin [Anaerococcus tetradius ATCC 35098]
          Length = 71

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 24/70 (34%), Positives = 41/70 (58%), Gaps = 1/70 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFG-NSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           +   + I II+ YQ   S   G + C++ PTCS+Y  EA  ++G     ++++ R+++CN
Sbjct: 1   MLNKLFIAIIKFYQRFISPQLGYSKCKFQPTCSQYALEAFRKHGFLKAFFMSVWRILRCN 60

Query: 113 PLGSDGFDPV 122
           P    G+DPV
Sbjct: 61  PFSKGGYDPV 70


>gi|326329126|ref|ZP_08195454.1| alpha-hemolysin [Nocardioidaceae bacterium Broad-1]
 gi|325953013|gb|EGD45025.1| alpha-hemolysin [Nocardioidaceae bacterium Broad-1]
          Length = 107

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 47/75 (62%), Gaps = 1/75 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           L   + IG++ +++ + S ++G+ CRY P+CS YG EA+  +G W GSWLT  RL +C P
Sbjct: 18  LVASVLIGLLHVWRTLVSPLYGDVCRYYPSCSAYGLEAVRTHGPWRGSWLTARRLARCVP 77

Query: 114 LGS-DGFDPVPDDLP 127
                GFDPVP   P
Sbjct: 78  WAKTRGFDPVPTKTP 92


>gi|15837591|ref|NP_298279.1| hypothetical protein XF0989 [Xylella fastidiosa 9a5c]
 gi|9105923|gb|AAF83799.1|AE003937_3 conserved hypothetical protein [Xylella fastidiosa 9a5c]
          Length = 87

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 47/75 (62%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            I +++IY+ + S + G  CR+ P+CSEY   AIAR+G   G WL   RL +C PL   G
Sbjct: 4   LILLLKIYKRLISPLLGPHCRFEPSCSEYAMGAIARFGTLRGIWLAARRLARCQPLQPGG 63

Query: 119 FDPVPDDLPPKKNNP 133
           +DPVPD++  + N P
Sbjct: 64  YDPVPDNISTQVNPP 78


>gi|296141905|ref|YP_003649148.1| hypothetical protein Tpau_4241 [Tsukamurella paurometabola DSM
           20162]
 gi|296030039|gb|ADG80809.1| protein of unknown function DUF37 [Tsukamurella paurometabola DSM
           20162]
          Length = 74

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 30/74 (40%), Positives = 47/74 (63%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            + L R   IG+++ Y+   S +   +CR++PTCSEY  EA++R+G   G +L+ +RL+K
Sbjct: 1   MRQLPRRTLIGLVQWYRTWISPMRPPTCRFMPTCSEYAVEALSRHGALRGVYLSTIRLLK 60

Query: 111 CNPLGSDGFDPVPD 124
           C P    G+DPVP 
Sbjct: 61  CGPWHRGGWDPVPQ 74


>gi|154483920|ref|ZP_02026368.1| hypothetical protein EUBVEN_01626 [Eubacterium ventriosum ATCC
           27560]
 gi|149735411|gb|EDM51297.1| hypothetical protein EUBVEN_01626 [Eubacterium ventriosum ATCC
           27560]
          Length = 84

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 33/80 (41%), Positives = 49/80 (61%), Gaps = 2/80 (2%)

Query: 45  NWNGKFPKTLGRLIGIGIIRIYQLIFSNVFG-NSCRYLPTCSEYGYEAIARYGLWIGSWL 103
           N    F K L   I IG+++ Y++  S + G   CRY+PTCS+Y  EA+ +YG   GS+L
Sbjct: 6   NIVKGFGKAL-NFILIGMVKFYRIFLSPLKGQPCCRYIPTCSQYALEALQKYGPLKGSYL 64

Query: 104 TLLRLIKCNPLGSDGFDPVP 123
            + R+++CN     G+DPVP
Sbjct: 65  AIRRILRCNHFHKGGYDPVP 84


>gi|296114114|ref|YP_003628052.1| hypothetical protein MCR_1903 [Moraxella catarrhalis RH4]
 gi|295921808|gb|ADG62159.1| conserved hypothetical protein [Moraxella catarrhalis RH4]
          Length = 106

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 26/70 (37%), Positives = 40/70 (57%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + I + +I IY+   S +    CRY PTCS Y  +AI  +G+  G  L++ R+ +C+P
Sbjct: 1   MLKNILLILIEIYRRWISPMMTPRCRYYPTCSAYSRQAIIWHGVIKGLRLSIWRIGRCHP 60

Query: 114 LGSDGFDPVP 123
            G  G D VP
Sbjct: 61  WGGCGIDFVP 70


>gi|269836198|ref|YP_003318426.1| hypothetical protein Sthe_0165 [Sphaerobacter thermophilus DSM
           20745]
 gi|269785461|gb|ACZ37604.1| protein of unknown function DUF37 [Sphaerobacter thermophilus DSM
           20745]
          Length = 69

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 30/68 (44%), Positives = 44/68 (64%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + +  IR YQ + S     SCR+ P+CSEYGY+AI +YG+  G W+T  R+++CNP 
Sbjct: 1   MKKLALWSIRFYQRVISPGLPASCRFYPSCSEYGYQAIDKYGIIKGGWMTAWRILRCNPF 60

Query: 115 GSDGFDPV 122
              G+DPV
Sbjct: 61  SRGGYDPV 68


>gi|323481057|gb|ADX80496.1| conserved hypothetical protein [Enterococcus faecalis 62]
          Length = 100

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 40/81 (49%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   IG +R YQ   S      CRY PTCS+Y  +AI  +G   G+ + + R+++C+P 
Sbjct: 1   MKNPLIGGVRFYQRFISPGLPARCRYYPTCSQYMIDAIHTHGSVKGTTMGVARILRCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNNPKL 135
              G D VP      KN  + 
Sbjct: 61  VKGGIDYVPLKFRLTKNPDET 81


>gi|283458992|ref|YP_003363642.1| hypothetical protein RMDY18_19900 [Rothia mucilaginosa DY-18]
 gi|283135057|dbj|BAI65822.1| uncharacterized conserved protein [Rothia mucilaginosa DY-18]
          Length = 157

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 27/71 (38%), Positives = 44/71 (61%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           L + + I  ++ Y+ + S ++G+ CRY PTCS Y  EA+  +G   G  LT+ R+++C P
Sbjct: 54  LPQNLLIACMKAYRKVVSPLYGDVCRYYPTCSAYALEALTTHGAMGGLSLTVRRILRCVP 113

Query: 114 LGSDGFDPVPD 124
             + G DPVP+
Sbjct: 114 WATGGIDPVPE 124


>gi|256398144|ref|YP_003119708.1| hypothetical protein Caci_9054 [Catenulispora acidiphila DSM 44928]
 gi|256364370|gb|ACU77867.1| protein of unknown function DUF37 [Catenulispora acidiphila DSM
           44928]
          Length = 134

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 27/72 (37%), Positives = 46/72 (63%), Gaps = 3/72 (4%)

Query: 55  GRLIGIGIIRIYQLIFSN---VFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
            + + +G+IR+YQ++ S      G  C++ P+CS YGY+A+  +G   G  +T+ R+++C
Sbjct: 1   MKYVLMGLIRLYQIVLSPVVNWRGPVCKFEPSCSHYGYDAVRIHGAIKGGGMTVWRVLRC 60

Query: 112 NPLGSDGFDPVP 123
           NP  S G+DPV 
Sbjct: 61  NPWSSGGYDPVK 72


>gi|254438059|ref|ZP_05051553.1| conserved hypothetical protein TIGR00278 [Octadecabacter
           antarcticus 307]
 gi|198253505|gb|EDY77819.1| conserved hypothetical protein TIGR00278 [Octadecabacter
           antarcticus 307]
          Length = 77

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 33/72 (45%), Positives = 45/72 (62%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           +   LI    IR Y+L+FS   G+ CR+ PTCS Y  EA+ ++G   G+ LT+ R+I+CN
Sbjct: 6   SPLALIASLPIRFYRLVFSPWVGHGCRFHPTCSAYAMEALRKHGGIKGTALTIRRVIRCN 65

Query: 113 PLGSDGFDPVPD 124
           P G  G D VPD
Sbjct: 66  PWGGSGVDNVPD 77


>gi|113478072|ref|YP_724133.1| hypothetical protein Tery_4697 [Trichodesmium erythraeum IMS101]
 gi|123351706|sp|Q10VR4|Y4697_TRIEI RecName: Full=UPF0161 protein Tery_4697
 gi|110169120|gb|ABG53660.1| protein of unknown function DUF37 [Trichodesmium erythraeum IMS101]
          Length = 72

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 26/71 (36%), Positives = 48/71 (67%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +++ + +I+ Y++  S +   SCR+ PTCSEY  EAI R+G++ G+ + ++R+++C+P 
Sbjct: 1   MKVLLVRLIKGYKIFISPILPPSCRFQPTCSEYAMEAIERFGIFKGTAMAVMRILRCHPF 60

Query: 115 GSDGFDPVPDD 125
              G+DPVP  
Sbjct: 61  HPGGYDPVPPK 71


>gi|326334741|ref|ZP_08200947.1| alpha-hemolysin [Capnocytophaga sp. oral taxon 338 str. F0234]
 gi|325693054|gb|EGD34987.1| alpha-hemolysin [Capnocytophaga sp. oral taxon 338 str. F0234]
          Length = 74

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 45/72 (62%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           + L     I ++R YQ+  S +   +CR+ PTCS Y  EA+ +YGL+ G  L + R+++C
Sbjct: 3   RKLITYPFIWMVRFYQVAISPLKPPTCRFTPTCSSYTLEALRKYGLFKGGRLAIKRIMRC 62

Query: 112 NPLGSDGFDPVP 123
           +P G  G+DPVP
Sbjct: 63  HPWGRSGYDPVP 74


>gi|296314152|ref|ZP_06864093.1| putative toxin-antitoxin system, toxin component [Neisseria
           polysaccharea ATCC 43768]
 gi|296839186|gb|EFH23124.1| putative toxin-antitoxin system, toxin component [Neisseria
           polysaccharea ATCC 43768]
          Length = 73

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 29/61 (47%), Positives = 37/61 (60%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           IR YQ   S +    CRY PTCS+Y  EA+ +YG + G  L   R+ +C+PLG  G DPV
Sbjct: 13  IRFYQYCISPLIPPRCRYTPTCSQYAVEAVKKYGAFKGGLLAAKRIARCHPLGGHGHDPV 72

Query: 123 P 123
           P
Sbjct: 73  P 73


>gi|261378188|ref|ZP_05982761.1| putative toxin-antitoxin system, toxin component [Neisseria cinerea
           ATCC 14685]
 gi|269145657|gb|EEZ72075.1| putative toxin-antitoxin system, toxin component [Neisseria cinerea
           ATCC 14685]
          Length = 73

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 29/61 (47%), Positives = 37/61 (60%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           IR YQ   S +    CRY PTCS+Y  EA+ +YG + G  L   R+ +C+PLG  G DPV
Sbjct: 13  IRFYQYCISPLIPPRCRYTPTCSQYAVEAVKKYGAFKGGLLAAKRIARCHPLGGHGHDPV 72

Query: 123 P 123
           P
Sbjct: 73  P 73


>gi|209884758|ref|YP_002288615.1| hypothetical protein OCAR_5619 [Oligotropha carboxidovorans OM5]
 gi|209872954|gb|ACI92750.1| hypothetical protein OCAR_5619 [Oligotropha carboxidovorans OM5]
          Length = 112

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 53/79 (67%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            +   R  G G+I +Y+  FS + G +CR++PTCS YG EAI R+GLW G W+TL RL++
Sbjct: 14  ARNAPRKAGRGLIWLYRATFSPLIGFNCRHVPTCSAYGDEAIGRFGLWAGGWMTLARLLR 73

Query: 111 CNPLGSDGFDPVPDDLPPK 129
           C+P G+ G D VP   PP+
Sbjct: 74  CHPWGTSGLDFVPKQKPPR 92


>gi|282859935|ref|ZP_06269023.1| conserved hypothetical protein YidD [Prevotella bivia JCVIHMP010]
 gi|282587338|gb|EFB92555.1| conserved hypothetical protein YidD [Prevotella bivia JCVIHMP010]
          Length = 91

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 33/87 (37%), Positives = 47/87 (54%), Gaps = 5/87 (5%)

Query: 41  PKSRNWNGKF----PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYG 96
            K+ NW  +       TL  L+ + I+  YQ   S     SCR+ P+CS Y  EAI ++G
Sbjct: 6   DKNTNWVKRIVHFVSHTLSWLLCVPIV-FYQQFISPFTPPSCRFTPSCSAYAKEAIMKHG 64

Query: 97  LWIGSWLTLLRLIKCNPLGSDGFDPVP 123
              G  L + R+++CNP G  G+DPVP
Sbjct: 65  PIKGLALAIWRILRCNPWGGSGYDPVP 91


>gi|325139559|gb|EGC62099.1| hypothetical protein TIGR00278 [Neisseria meningitidis CU385]
          Length = 73

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 29/61 (47%), Positives = 37/61 (60%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           IR YQ   S +    CRY PTCS+Y  EA+ +YG + G  L   R+ +C+PLG  G DPV
Sbjct: 13  IRFYQYCISPLIPPRCRYTPTCSQYAVEAVKKYGAFKGGLLAAKRISRCHPLGGHGHDPV 72

Query: 123 P 123
           P
Sbjct: 73  P 73


>gi|261405921|ref|YP_003242162.1| hypothetical protein GYMC10_2074 [Paenibacillus sp. Y412MC10]
 gi|261282384|gb|ACX64355.1| protein of unknown function DUF37 [Paenibacillus sp. Y412MC10]
          Length = 85

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 26/69 (37%), Positives = 35/69 (50%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R +    I  Y+   S +   +CR+ PTCS Y  EAI  +G   GSWL   R+ +C+P 
Sbjct: 4   ARRVVKVPIHFYRKFISPLKPATCRFYPTCSAYALEAIEVHGALKGSWLAAKRIARCHPF 63

Query: 115 GSDGFDPVP 123
              G D VP
Sbjct: 64  HPGGIDLVP 72


>gi|322373878|ref|ZP_08048413.1| putative toxin-antitoxin system, toxin component [Streptococcus sp.
           C150]
 gi|321277250|gb|EFX54320.1| putative toxin-antitoxin system, toxin component [Streptococcus sp.
           C150]
          Length = 83

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + +   I ++R YQ   S +F  SCR+ PTCS Y  +AI ++G   G  + + R+++C+P
Sbjct: 1   MIKRFLIVLVRAYQRWISPLFPPSCRFRPTCSVYMIQAIEKHG-LKGVLMGIARILRCHP 59

Query: 114 LGSDGFDPVPDDLPPKKNNPKL 135
               G DPVPD    K++   L
Sbjct: 60  FSETGEDPVPDYFSLKRHKTPL 81


>gi|254384777|ref|ZP_05000114.1| conserved hypothetical protein [Streptomyces sp. Mg1]
 gi|194343659|gb|EDX24625.1| conserved hypothetical protein [Streptomyces sp. Mg1]
          Length = 93

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 43/75 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   + +I++YQ   S + G  CRY P+CS YG+ AI R+G   G+ LT  R+++CNP 
Sbjct: 1   MKYPLLALIKLYQWTISPLLGPVCRYYPSCSRYGFTAIDRHGAVKGTVLTAWRILRCNPW 60

Query: 115 GSDGFDPVPDDLPPK 129
              G D VP    P+
Sbjct: 61  SPGGVDHVPPRKRPR 75


>gi|116256238|sp|Q31CC8|Y406_PROM9 RecName: Full=UPF0161 protein PMT9312_0406
          Length = 78

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 38/67 (56%), Positives = 46/67 (68%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
           I + +I  YQ  FS  FG  CR++P+CS YGYEAI R+G W G WLTL RL +C+PL   
Sbjct: 12  ILLFMISFYQKWFSPFFGPRCRFIPSCSSYGYEAITRHGPWKGGWLTLRRLSRCHPLTPC 71

Query: 118 GFDPVPD 124
           G DPVPD
Sbjct: 72  GCDPVPD 78


>gi|153209758|ref|ZP_01947496.1| conserved hypothetical protein TIGR00278 [Coxiella burnetii 'MSU
           Goat Q177']
 gi|161829801|ref|YP_001597735.1| hypothetical protein COXBURSA331_A2121 [Coxiella burnetii RSA 331]
 gi|165922512|ref|ZP_02219683.1| conserved hypothetical protein TIGR00278 [Coxiella burnetii RSA
           334]
 gi|1176310|sp|P45649|Y1919_COXBU RecName: Full=UPF0161 protein CBU_1919
 gi|189039434|sp|A9KBT2|Y202_COXBN RecName: Full=UPF0161 protein CBUD_0202
 gi|189039465|sp|A9NBA4|Y2121_COXBR RecName: Full=UPF0161 protein COXBURSA331_A2121
 gi|511458|gb|AAA56918.1| 9 kDa protein [Coxiella burnetii]
 gi|120575261|gb|EAX31885.1| conserved hypothetical protein TIGR00278 [Coxiella burnetii 'MSU
           Goat Q177']
 gi|161761668|gb|ABX77310.1| conserved hypothetical protein TIGR00278 [Coxiella burnetii RSA
           331]
 gi|165916717|gb|EDR35321.1| conserved hypothetical protein TIGR00278 [Coxiella burnetii RSA
           334]
          Length = 88

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 27/70 (38%), Positives = 45/70 (64%)

Query: 56  RLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLG 115
           + + +G+I+ Y+ + S V  +SCR+ P+CS Y   A+ R+G+  GS LT+ RL++C+P  
Sbjct: 14  QTLLLGLIKSYRYLISPVLMSSCRFYPSCSCYAETALKRFGVIKGSGLTVWRLLRCHPFH 73

Query: 116 SDGFDPVPDD 125
             G D VP+ 
Sbjct: 74  PGGVDFVPEK 83


>gi|257470417|ref|ZP_05634508.1| hypothetical protein FulcA4_13822 [Fusobacterium ulcerans ATCC
           49185]
 gi|317064625|ref|ZP_07929110.1| ribonuclease P [Fusobacterium ulcerans ATCC 49185]
 gi|313690301|gb|EFS27136.1| ribonuclease P [Fusobacterium ulcerans ATCC 49185]
          Length = 81

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 31/69 (44%), Positives = 45/69 (65%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I + +IR YQ   S   G +CR++PTCS Y YEA+ ++G+  G +L + R+IKC+P 
Sbjct: 1   MKKIILCMIRFYQKYISIFLGKNCRFIPTCSAYTYEAVEKFGVVKGVYLGIKRIIKCHPF 60

Query: 115 GSDGFDPVP 123
              GFDPVP
Sbjct: 61  NPGGFDPVP 69


>gi|329902524|ref|ZP_08273134.1| YidD [Oxalobacteraceae bacterium IMCC9480]
 gi|327548752|gb|EGF33391.1| YidD [Oxalobacteraceae bacterium IMCC9480]
          Length = 81

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 26/63 (41%), Positives = 37/63 (58%)

Query: 62  IIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDP 121
           ++R Y+L  S   G +CR+LP+CS+Y  +AI  +G   G  L   RL +C+P    G DP
Sbjct: 2   LLRAYKLGISPFLGQNCRFLPSCSDYAAQAITEHGALKGGILAAKRLARCHPWHPGGLDP 61

Query: 122 VPD 124
           VP 
Sbjct: 62  VPQ 64


>gi|49475538|ref|YP_033579.1| hypothetical protein BH07670 [Bartonella henselae str. Houston-1]
 gi|81647941|sp|Q6G3K0|Y767_BARHE RecName: Full=UPF0161 protein BH07670
 gi|49238344|emb|CAF27568.1| hypothetical protein BH07670 [Bartonella henselae str. Houston-1]
          Length = 117

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 47/85 (55%), Positives = 63/85 (74%)

Query: 42  KSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGS 101
           ++RN+ G + KT GRL+G+ +IR YQ+  S   GN CR+LPTCSEY YEAIAR+GLW G+
Sbjct: 12  QTRNYTGPWRKTPGRLLGLLLIRFYQITLSGFIGNQCRHLPTCSEYTYEAIARHGLWAGA 71

Query: 102 WLTLLRLIKCNPLGSDGFDPVPDDL 126
           W+   R+I+C P G+ GF+PVP  L
Sbjct: 72  WMGFFRIIRCGPFGTHGFEPVPTSL 96


>gi|323126648|gb|ADX23945.1| hypothetical protein SDE12394_02015 [Streptococcus dysgalactiae
           subsp. equisimilis ATCC 12394]
          Length = 88

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
           + +  ++ YQ   S +F  +CRY PTCS Y   AI ++G   G  + L R+++C+P  + 
Sbjct: 5   LLVAPVKAYQRYISPLFPPTCRYRPTCSAYMITAIEKHGA-KGVLMGLARILRCHPFVAG 63

Query: 118 GFDPVPDDLPPKKNNPKLLS 137
           G D VPD    K+NN  L  
Sbjct: 64  GDDSVPDHFSLKRNNKALKK 83


>gi|325678534|ref|ZP_08158145.1| YidD family protein [Ruminococcus albus 8]
 gi|324109753|gb|EGC03958.1| YidD family protein [Ruminococcus albus 8]
          Length = 87

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 43/85 (50%), Gaps = 5/85 (5%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           +    I    I+ Y+   S V    C+Y P+CS Y   A  ++G + G+ LT+ RL++CN
Sbjct: 2   SPLAWIARLPIKFYRKFISPVLPPQCKYYPSCSCYALNAYEKHGFFKGTLLTVWRLLRCN 61

Query: 113 PLGSDGFDPVPDDLP-----PKKNN 132
           P    G D VPD +       KKN+
Sbjct: 62  PWSRGGVDYVPDKVTIDYFRVKKNS 86


>gi|167753930|ref|ZP_02426057.1| hypothetical protein ALIPUT_02215 [Alistipes putredinis DSM 17216]
 gi|167658555|gb|EDS02685.1| hypothetical protein ALIPUT_02215 [Alistipes putredinis DSM 17216]
          Length = 63

 Score =   99 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 31/62 (50%), Positives = 41/62 (66%)

Query: 62  IIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDP 121
           +++ YQ   S     SCRY PTCS+Y  EA+ +YG   G+WLTL RL +C+P G  G+DP
Sbjct: 2   LVKFYQRCISPFTPASCRYTPTCSQYALEALRKYGPLKGTWLTLKRLSRCHPWGGSGYDP 61

Query: 122 VP 123
           VP
Sbjct: 62  VP 63


>gi|291278770|ref|YP_003495605.1| hypothetical protein DEFDS_0348 [Deferribacter desulfuricans SSM1]
 gi|290753472|dbj|BAI79849.1| conserved hypothetical protein [Deferribacter desulfuricans SSM1]
          Length = 75

 Score =   99 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 30/72 (41%), Positives = 42/72 (58%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           K       I +I  YQ++ S   G +CRY PTCS+Y  EAI + G+  G  L+L R+++C
Sbjct: 4   KHFLTTFLIKLIDFYQILLSPFLGRNCRYYPTCSQYAKEAIVKKGILRGLLLSLWRILRC 63

Query: 112 NPLGSDGFDPVP 123
           NP    G+DPV 
Sbjct: 64  NPFSKGGYDPVK 75


>gi|126733907|ref|ZP_01749654.1| hypothetical protein RCCS2_07109 [Roseobacter sp. CCS2]
 gi|126716773|gb|EBA13637.1| hypothetical protein RCCS2_07109 [Roseobacter sp. CCS2]
          Length = 73

 Score =   99 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 42/62 (67%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           +R Y+L+ S   G SCRY PTCS Y  EA+ ++G   GS+LT+ R+++C+P G  G D V
Sbjct: 12  VRAYRLVLSPWVGMSCRYHPTCSAYSLEALEKHGAIKGSYLTIRRILRCHPWGGSGIDNV 71

Query: 123 PD 124
           PD
Sbjct: 72  PD 73


>gi|116242846|sp|Q8A2S7|Y3228_BACTN RecName: Full=UPF0161 protein BT_3228
          Length = 79

 Score =   99 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (59%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           + +   + +  I  Y++  S +   SCR+ PTCS Y  EAI ++G   G +L + R+++C
Sbjct: 8   RKVFSFLLLIPIYFYRVCISPLTPPSCRFTPTCSAYAVEAIKKHGPVKGLYLAVRRILRC 67

Query: 112 NPLGSDGFDPVP 123
           +P G  G+DPVP
Sbjct: 68  HPWGGSGYDPVP 79


>gi|89902990|ref|YP_525461.1| hypothetical protein Rfer_4243 [Rhodoferax ferrireducens T118]
 gi|116256242|sp|Q21QM3|Y4243_RHOFD RecName: Full=UPF0161 protein Rfer_4243
 gi|89347727|gb|ABD71930.1| protein of unknown function DUF37 [Rhodoferax ferrireducens T118]
          Length = 94

 Score =   99 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 51/78 (65%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + R + +GI++ Y+L+ S   G+SCR+ PTCS Y  +A+  +G   GS+LTL RL +C+P
Sbjct: 1   MIRDVLVGIVKGYRLLLSPWLGSSCRFEPTCSAYSLQALQTHGAAAGSYLTLTRLARCHP 60

Query: 114 LGSDGFDPVPDDLPPKKN 131
             + G DPVP + P  K+
Sbjct: 61  WCAGGSDPVPSEKPRFKS 78


>gi|310816965|ref|YP_003964929.1| hypothetical protein EIO_2549 [Ketogulonicigenium vulgare Y25]
 gi|308755700|gb|ADO43629.1| conserved hypothetical protein [Ketogulonicigenium vulgare Y25]
          Length = 93

 Score =   99 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 34/80 (42%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           L RL  +  ++ Y+L+ S   G  CRY PTCS Y  EA+ ++G   G WLTL RL +C+P
Sbjct: 4   LARLFAL-PVKAYRLVLSPWIGQYCRYHPTCSTYALEALEKHGGLKGGWLTLRRLARCHP 62

Query: 114 LGSDGFDPVPDDLPPKKNNP 133
            G  G D VP+     K  P
Sbjct: 63  WGGSGIDNVPEPKAKPKAKP 82


>gi|238926594|ref|ZP_04658354.1| alpha-hemolysin [Selenomonas flueggei ATCC 43531]
 gi|238885540|gb|EEQ49178.1| alpha-hemolysin [Selenomonas flueggei ATCC 43531]
          Length = 69

 Score =   99 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 42/69 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + + +IR Y+   S +F   CRY PTCS Y  EA+ RYG W G  + L R+++C+P 
Sbjct: 1   MKHLLLLLIRFYRAAISPLFLPHCRYYPTCSAYALEAVTRYGAWRGGRMALRRILRCHPF 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  HKGGYDPVP 69


>gi|288803475|ref|ZP_06408907.1| putative toxin-antitoxin system, toxin component [Prevotella
           melaninogenica D18]
 gi|288334085|gb|EFC72528.1| putative toxin-antitoxin system, toxin component [Prevotella
           melaninogenica D18]
          Length = 90

 Score =   99 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 34/85 (40%), Positives = 49/85 (57%), Gaps = 3/85 (3%)

Query: 42  KSRNWNGKFPKTLGR---LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLW 98
           +S+N   K  +   R    + I  I  Y+   S     SCR+ PTCSEYG +AI ++G +
Sbjct: 6   QSQNVFAKLWRLFTRVLSWLLILPILFYRQFISPFTPPSCRFTPTCSEYGRQAILKHGPF 65

Query: 99  IGSWLTLLRLIKCNPLGSDGFDPVP 123
            G  LT+ R+++CNP G  G+DPVP
Sbjct: 66  KGLALTIWRILRCNPWGGSGYDPVP 90


>gi|312144702|ref|YP_003996148.1| protein of unknown function DUF37 [Halanaerobium sp. 'sapolanicus']
 gi|311905353|gb|ADQ15794.1| protein of unknown function DUF37 [Halanaerobium sp. 'sapolanicus']
          Length = 69

 Score =   99 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 29/68 (42%), Positives = 40/68 (58%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I +  I IYQ I S     SCR+ PTCSEY   AI ++G   G W+ L R+++C+P 
Sbjct: 1   MKKILLFFITIYQKIISPWTPKSCRFRPTCSEYSKIAIKKHGALKGVWMGLKRILRCHPF 60

Query: 115 GSDGFDPV 122
              G+DPV
Sbjct: 61  HPGGYDPV 68


>gi|257455162|ref|ZP_05620400.1| conserved hypothetical protein [Enhydrobacter aerosaccus SK60]
 gi|257447495|gb|EEV22500.1| conserved hypothetical protein [Enhydrobacter aerosaccus SK60]
          Length = 99

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/76 (36%), Positives = 38/76 (50%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
              L     + +I  YQ + S      CR+ PTCS YG EA+  +G + G  LT  R+ +
Sbjct: 1   MNKLLAKFLLFMIIFYQRLISPWLAPRCRFYPTCSSYGLEAVRLHGGYRGGLLTAKRIAR 60

Query: 111 CNPLGSDGFDPVPDDL 126
           C+P G  G D VP  L
Sbjct: 61  CHPWGGHGIDFVPKPL 76


>gi|91070342|gb|ABE11259.1| conserved hypothetical protein [uncultured Prochlorococcus marinus
           clone HF10-88F10]
          Length = 78

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 39/67 (58%), Positives = 46/67 (68%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
           I + +I  YQ  FS  FG  CR++P+CS YGYEAI R+G W G WLTL RL KC+PL   
Sbjct: 12  ILLFMISFYQKWFSPFFGPRCRFIPSCSSYGYEAITRHGPWKGGWLTLKRLSKCHPLTPC 71

Query: 118 GFDPVPD 124
           G DPVPD
Sbjct: 72  GCDPVPD 78


>gi|291303915|ref|YP_003515193.1| hypothetical protein Snas_6485 [Stackebrandtia nassauensis DSM
           44728]
 gi|290573135|gb|ADD46100.1| protein of unknown function DUF37 [Stackebrandtia nassauensis DSM
           44728]
          Length = 91

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 27/63 (42%), Positives = 34/63 (53%)

Query: 61  GIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFD 120
             I  Y+   S      CR+ P+CS Y  EA+  +G   G WL+L RL +C P  S GFD
Sbjct: 12  WPIMAYRRWISPTLPARCRFYPSCSAYALEAVRVHGAVRGGWLSLKRLGRCQPFHSGGFD 71

Query: 121 PVP 123
           PVP
Sbjct: 72  PVP 74


>gi|330470830|ref|YP_004408573.1| hypothetical protein VAB18032_04455 [Verrucosispora maris
           AB-18-032]
 gi|328813801|gb|AEB47973.1| hypothetical protein VAB18032_04455 [Verrucosispora maris
           AB-18-032]
          Length = 95

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 29/73 (39%), Positives = 40/73 (54%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
           P TLG  +    I  Y+   S      CR+ P+CS Y  EA+ R+G   G+ LT+ RL +
Sbjct: 10  PATLGARMLALPIIAYRRWISPALPARCRFYPSCSAYALEAVTRHGALRGAGLTVRRLSR 69

Query: 111 CNPLGSDGFDPVP 123
           C+P    G+DPVP
Sbjct: 70  CHPFNPGGYDPVP 82


>gi|302336544|ref|YP_003801751.1| protein of unknown function DUF37 [Olsenella uli DSM 7084]
 gi|301320384|gb|ADK68871.1| protein of unknown function DUF37 [Olsenella uli DSM 7084]
          Length = 80

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 27/68 (39%), Positives = 38/68 (55%)

Query: 56  RLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLG 115
           +   + +I+ Y+   S +    C Y PTCSEY  EAI RYG   G  L   R+++C+P  
Sbjct: 13  QRASLCLIKGYRKYASPLLAPRCIYSPTCSEYALEAIERYGAARGMMLAAKRILRCHPFH 72

Query: 116 SDGFDPVP 123
             G+DPVP
Sbjct: 73  KGGYDPVP 80


>gi|226355227|ref|YP_002784967.1| hypothetical protein Deide_03875 [Deinococcus deserti VCD115]
 gi|259647024|sp|C1CZW1|Y3875_DEIDV RecName: Full=UPF0161 protein Deide_03875
 gi|226317217|gb|ACO45213.1| Conserved hypothetical protein [Deinococcus deserti VCD115]
          Length = 84

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFG-NSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           +L     + +IR YQ   S      +CR++PTCS+Y  EAI R+G   G WL   R+++C
Sbjct: 2   SLASRGLVRVIRAYQRELSPRKPSPTCRFIPTCSQYAVEAIERHGALKGGWLATWRIMRC 61

Query: 112 NPLGSDGFDPVPDDLPPKKN 131
           NPL   G DPVP+  P  + 
Sbjct: 62  NPLVPGGVDPVPERFPQGRK 81


>gi|291044697|ref|ZP_06570406.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|293397798|ref|ZP_06642004.1| hypothetical protein NGNG_00790 [Neisseria gonorrhoeae F62]
 gi|291011591|gb|EFE03587.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|291611744|gb|EFF40813.1| hypothetical protein NGNG_00790 [Neisseria gonorrhoeae F62]
          Length = 90

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/61 (45%), Positives = 37/61 (60%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           IR YQ   S +    CRY PTCS+Y  EA+ +YG + G  L + R+ +C+P G  G DPV
Sbjct: 30  IRFYQYCISPLIPPRCRYTPTCSQYAVEAVKKYGAFKGLRLAIKRIARCHPFGGHGHDPV 89

Query: 123 P 123
           P
Sbjct: 90  P 90


>gi|84499794|ref|ZP_00998082.1| hypothetical protein OB2597_07685 [Oceanicola batsensis HTCC2597]
 gi|84392938|gb|EAQ05149.1| hypothetical protein OB2597_07685 [Oceanicola batsensis HTCC2597]
          Length = 80

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 1/71 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           L RL+ +  +R Y+LI S   G+ CR+ PTCS Y  EA+ ++G   GSWL L R+ +C+P
Sbjct: 4   LARLVAL-PVRAYRLILSPWVGHGCRFQPTCSAYALEALEKHGGVRGSWLALRRIARCHP 62

Query: 114 LGSDGFDPVPD 124
            G  G+DPVP+
Sbjct: 63  FGQSGYDPVPE 73


>gi|20809128|ref|NP_624299.1| hypothetical protein TTE2800 [Thermoanaerobacter tengcongensis MB4]
 gi|25009634|sp|Q8R6K5|Y2800_THETN RecName: Full=UPF0161 protein TTE2800
 gi|20517808|gb|AAM25903.1| conserved hypothetical protein [Thermoanaerobacter tengcongensis
           MB4]
          Length = 69

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/69 (40%), Positives = 44/69 (63%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   I +IR+YQ   S +   +CR+ PTCS+Y  EAI++YGL  G  +++ R+++CNP 
Sbjct: 1   MKNFVIFLIRLYQKYISPMKPRTCRFYPTCSQYSIEAISKYGLLKGGLMSIWRILRCNPF 60

Query: 115 GSDGFDPVP 123
              G+DPV 
Sbjct: 61  NPGGYDPVK 69


>gi|290968157|ref|ZP_06559702.1| conserved hypothetical protein YidD [Megasphaera genomosp. type_1
           str. 28L]
 gi|290781832|gb|EFD94415.1| conserved hypothetical protein YidD [Megasphaera genomosp. type_1
           str. 28L]
          Length = 69

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 42/69 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I +I+ YQ   S +    CR+ PTCS Y  EA+ +YG+  GS+ TL R+ KC+P 
Sbjct: 1   MKNIFIILIQFYQQWLSPLHRPCCRFYPTCSAYAIEALQKYGVVKGSYFTLRRIAKCHPF 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  HPGGYDPVP 69


>gi|114778884|ref|ZP_01453681.1| hypothetical protein SPV1_12080 [Mariprofundus ferrooxydans PV-1]
 gi|114550853|gb|EAU53419.1| hypothetical protein SPV1_12080 [Mariprofundus ferrooxydans PV-1]
          Length = 69

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/69 (44%), Positives = 43/69 (62%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R   + ++R YQL  S V  + C Y P+CS Y  EAI RYG+  G+WL + RL++C+P 
Sbjct: 1   MRKFSLMLVRAYQLFISPVLPSRCIYTPSCSHYMIEAIQRYGVCRGAWLGIKRLLRCHPF 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  CKGGYDPVP 69


>gi|103485503|ref|YP_615064.1| hypothetical protein Sala_0005 [Sphingopyxis alaskensis RB2256]
 gi|116256127|sp|Q1GN72|Y005_SPHAL RecName: Full=UPF0161 protein Sala_0005
 gi|98975580|gb|ABF51731.1| protein of unknown function DUF37 [Sphingopyxis alaskensis RB2256]
          Length = 70

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/67 (44%), Positives = 41/67 (61%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            + I I R +QL  S V   +CRY P+CSEY   A+ R+G   G W+   RL++C+P G 
Sbjct: 4   RLLILIARAWQLGPSRVLPPTCRYAPSCSEYAIVALRRHGAIKGGWIATKRLLRCHPWGG 63

Query: 117 DGFDPVP 123
            G+DPVP
Sbjct: 64  HGYDPVP 70


>gi|307294063|ref|ZP_07573907.1| protein of unknown function DUF37 [Sphingobium chlorophenolicum
           L-1]
 gi|306880214|gb|EFN11431.1| protein of unknown function DUF37 [Sphingobium chlorophenolicum
           L-1]
          Length = 70

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 45/67 (67%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            I I I R +Q+  S +   SCRY P+CSEY  +AI++YG+  GSWL   RL++C+P G 
Sbjct: 4   RILILIARFWQIGPSRILPPSCRYAPSCSEYAIQAISKYGVVKGSWLAAKRLMRCHPWGG 63

Query: 117 DGFDPVP 123
            G+DPVP
Sbjct: 64  SGYDPVP 70


>gi|299823079|ref|ZP_07054965.1| alpha-hemolysin [Listeria grayi DSM 20601]
 gi|299816608|gb|EFI83846.1| alpha-hemolysin [Listeria grayi DSM 20601]
          Length = 83

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 29/71 (40%), Positives = 39/71 (54%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I IG IR+YQ   S     +CR+ PTCS Y  EAI  +G   G  L+++R+ KC+P 
Sbjct: 1   MKHILIGAIRLYQKYISRFTPRTCRFYPTCSAYSVEAIQEHGALKGLLLSIIRISKCHPF 60

Query: 115 GSDGFDPVPDD 125
              G D VP  
Sbjct: 61  HKGGIDFVPQK 71


>gi|29348637|ref|NP_812140.1| hypothetical protein BT_3228 [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|253569020|ref|ZP_04846430.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
 gi|29340542|gb|AAO78334.1| conserved hypothetical protein [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|251841039|gb|EES69120.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
          Length = 91

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (59%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           + +   + +  I  Y++  S +   SCR+ PTCS Y  EAI ++G   G +L + R+++C
Sbjct: 20  RKVFSFLLLIPIYFYRVCISPLTPPSCRFTPTCSAYAVEAIKKHGPVKGLYLAVRRILRC 79

Query: 112 NPLGSDGFDPVP 123
           +P G  G+DPVP
Sbjct: 80  HPWGGSGYDPVP 91


>gi|86131787|ref|ZP_01050384.1| conserved hypothetical protein [Dokdonia donghaensis MED134]
 gi|85817609|gb|EAQ38783.1| conserved hypothetical protein [Dokdonia donghaensis MED134]
          Length = 84

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/69 (44%), Positives = 42/69 (60%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            +GII  YQ   S+   ++CRY PTCS Y   A+ R+GL  G  L L R++ C+P G  G
Sbjct: 12  FLGIIWFYQKFISSWTPSTCRYSPTCSHYTKTALQRHGLLTGGKLALKRILSCHPWGGQG 71

Query: 119 FDPVPDDLP 127
           +DPVP+  P
Sbjct: 72  YDPVPEKEP 80


>gi|316933348|ref|YP_004108330.1| hypothetical protein Rpdx1_1988 [Rhodopseudomonas palustris DX-1]
 gi|315601062|gb|ADU43597.1| protein of unknown function DUF37 [Rhodopseudomonas palustris DX-1]
          Length = 133

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 39/86 (45%), Positives = 53/86 (61%), Gaps = 1/86 (1%)

Query: 44  RNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWL 103
            NW     + L R  G G+I +Y+   S + G +CR+ P+CS YG EAI R+GLW G W+
Sbjct: 8   TNWIDPVLR-LPRNAGRGLIWLYRHTLSPLVGYNCRHYPSCSMYGDEAIGRFGLWAGGWM 66

Query: 104 TLLRLIKCNPLGSDGFDPVPDDLPPK 129
           TL RL++C P G+ G D VP   PP+
Sbjct: 67  TLARLLRCQPFGTSGIDLVPQVPPPR 92


>gi|255994568|ref|ZP_05427703.1| putative toxin-antitoxin system, toxin component [Eubacterium
           saphenum ATCC 49989]
 gi|255993281|gb|EEU03370.1| putative toxin-antitoxin system, toxin component [Eubacterium
           saphenum ATCC 49989]
          Length = 72

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 40/67 (59%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +++ I +++ YQ   S +    CR+ PTCS Y  +A+ +YG   GS L + R+++C+P 
Sbjct: 4   MKIVLIKLVKAYQRFISPLSAPRCRFYPTCSNYFLQAVEKYGAIKGSMLGIKRILRCHPF 63

Query: 115 GSDGFDP 121
              G+DP
Sbjct: 64  SKGGYDP 70


>gi|114765431|ref|ZP_01444546.1| hypothetical protein 1100011001294_R2601_17242 [Pelagibaca
           bermudensis HTCC2601]
 gi|114542274|gb|EAU45304.1| hypothetical protein R2601_17242 [Roseovarius sp. HTCC2601]
          Length = 69

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 46/69 (66%), Gaps = 2/69 (2%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           +R Y+L+FS   G+ CR+ PTCS Y  EA+ ++G + GSWL   R+++C+P G  G D V
Sbjct: 3   VRFYRLVFSPWVGHGCRFQPTCSAYAMEALEKHGAFKGSWLAACRILRCHPWGGSGIDNV 62

Query: 123 PDDLPPKKN 131
           P+  P K++
Sbjct: 63  PE--PRKRD 69


>gi|47606241|sp|P61471|Y3394_RHOPA RecName: Full=UPF0161 protein RPA3394
          Length = 129

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 37/90 (41%), Positives = 54/90 (60%), Gaps = 1/90 (1%)

Query: 40  TPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWI 99
             +  +W  +  + L R  G G+I +Y+   S + G +CR+ PTCS YG EAI ++GLW 
Sbjct: 4   PSRGTDWIAQVLR-LPRNAGRGLIWLYRHTLSPLVGYNCRHYPTCSMYGDEAIRKFGLWA 62

Query: 100 GSWLTLLRLIKCNPLGSDGFDPVPDDLPPK 129
           G W+TL RL++C P G+ G D VP   P +
Sbjct: 63  GGWMTLARLLRCQPWGTSGIDLVPQTAPSR 92


>gi|303325516|ref|ZP_07355959.1| conserved hypothetical protein YidD [Desulfovibrio sp. 3_1_syn3]
 gi|302863432|gb|EFL86363.1| conserved hypothetical protein YidD [Desulfovibrio sp. 3_1_syn3]
          Length = 87

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 32/69 (46%), Positives = 41/69 (59%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            K L R + +  IRIYQ   S V   +CR+ PTCS Y  EAI R+G+  G WL L RL +
Sbjct: 1   MKMLLRGLCVLPIRIYQRCISPVLPPACRFYPTCSAYAVEAILRHGVLRGGWLALRRLAR 60

Query: 111 CNPLGSDGF 119
           C+P G  G+
Sbjct: 61  CHPWGGSGY 69


>gi|300113401|ref|YP_003759976.1| hypothetical protein Nwat_0699 [Nitrosococcus watsonii C-113]
 gi|299539338|gb|ADJ27655.1| protein of unknown function DUF37 [Nitrosococcus watsonii C-113]
          Length = 78

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 43/78 (55%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I + +I  Y+   S   GN CRY P+CS Y  EAI RYG + G WL L RL++C+P 
Sbjct: 1   MKNILLSLIVFYRYALSPFMGNHCRYYPSCSAYTQEAIQRYGGFRGGWLGLRRLLRCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G D VP+    +  +
Sbjct: 61  CPGGIDLVPEIPEWRSKS 78


>gi|192292243|ref|YP_001992848.1| hypothetical protein Rpal_3875 [Rhodopseudomonas palustris TIE-1]
 gi|226706067|sp|B3QE28|Y3875_RHOPT RecName: Full=UPF0161 protein Rpal_3875
 gi|192285992|gb|ACF02373.1| protein of unknown function DUF37 [Rhodopseudomonas palustris
           TIE-1]
          Length = 129

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 37/90 (41%), Positives = 53/90 (58%), Gaps = 1/90 (1%)

Query: 40  TPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWI 99
             +  +W     + L R  G G+I +Y+   S + G +CR+ PTCS YG EAI ++GLW 
Sbjct: 4   PSRGTDWIAPVLR-LPRNAGRGLIWLYRHTLSPLVGYNCRHYPTCSMYGDEAIRKFGLWA 62

Query: 100 GSWLTLLRLIKCNPLGSDGFDPVPDDLPPK 129
           G W+TL RL++C P G+ G D VP   P +
Sbjct: 63  GGWMTLARLLRCQPWGTSGIDLVPQTAPSR 92


>gi|59802473|ref|YP_209185.1| hypothetical protein NGO2180 [Neisseria gonorrhoeae FA 1090]
 gi|194100145|ref|YP_002003285.1| hypothetical protein NGK_2660 [Neisseria gonorrhoeae NCCP11945]
 gi|239998130|ref|ZP_04718054.1| UPF0161 protein [Neisseria gonorrhoeae 35/02]
 gi|240013311|ref|ZP_04720224.1| UPF0161 protein [Neisseria gonorrhoeae DGI18]
 gi|240015756|ref|ZP_04722296.1| UPF0161 protein [Neisseria gonorrhoeae FA6140]
 gi|240079893|ref|ZP_04724436.1| UPF0161 protein [Neisseria gonorrhoeae FA19]
 gi|240112101|ref|ZP_04726591.1| UPF0161 protein [Neisseria gonorrhoeae MS11]
 gi|240114847|ref|ZP_04728909.1| UPF0161 protein [Neisseria gonorrhoeae PID18]
 gi|240117049|ref|ZP_04731111.1| UPF0161 protein [Neisseria gonorrhoeae PID1]
 gi|240120383|ref|ZP_04733345.1| UPF0161 protein [Neisseria gonorrhoeae PID24-1]
 gi|240122687|ref|ZP_04735643.1| UPF0161 protein [Neisseria gonorrhoeae PID332]
 gi|240124875|ref|ZP_04737761.1| UPF0161 protein [Neisseria gonorrhoeae SK-92-679]
 gi|240127388|ref|ZP_04740049.1| UPF0161 protein [Neisseria gonorrhoeae SK-93-1035]
 gi|260441338|ref|ZP_05795154.1| hypothetical protein NgonDG_09710 [Neisseria gonorrhoeae DGI2]
 gi|268593982|ref|ZP_06128149.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268596036|ref|ZP_06130203.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|75355256|sp|Q5F4W4|Y2180_NEIG1 RecName: Full=UPF0161 protein NGO2180
 gi|226701479|sp|B4RJJ4|Y2660_NEIG2 RecName: Full=UPF0161 protein NGK_2660
 gi|59719368|gb|AAW90773.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
 gi|193935435|gb|ACF31259.1| UPF0161 protein [Neisseria gonorrhoeae NCCP11945]
 gi|268547371|gb|EEZ42789.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268549824|gb|EEZ44843.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|317165573|gb|ADV09114.1| hypothetical protein NGTW08_2166 [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 73

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/61 (45%), Positives = 37/61 (60%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           IR YQ   S +    CRY PTCS+Y  EA+ +YG + G  L + R+ +C+P G  G DPV
Sbjct: 13  IRFYQYCISPLIPPRCRYTPTCSQYAVEAVKKYGAFKGLRLAIKRIARCHPFGGHGHDPV 72

Query: 123 P 123
           P
Sbjct: 73  P 73


>gi|41410446|ref|NP_963282.1| hypothetical protein MAP4348c [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|14286069|sp|Q9L7M0|Y4348_MYCPA RecName: Full=UPF0161 protein MAP_4348c
 gi|6969276|gb|AAF33697.1| unknown [Mycobacterium avium subsp. paratuberculosis]
 gi|41399280|gb|AAS06898.1| hypothetical protein MAP_4348c [Mycobacterium avium subsp.
           paratuberculosis K-10]
          Length = 115

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 32/88 (36%), Positives = 51/88 (57%), Gaps = 3/88 (3%)

Query: 47  NGKFPKTLGRLIG---IGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWL 103
           +G   +  GR +    I +I++Y+ + S +   +CR++PTCS+Y  +A+  YGL  GSWL
Sbjct: 7   SGAAIRGAGRTVARGLIFLIQLYRHMVSPLRPATCRFVPTCSQYAVDALDEYGLIRGSWL 66

Query: 104 TLLRLIKCNPLGSDGFDPVPDDLPPKKN 131
              RL KC P    G+DP+P+    + N
Sbjct: 67  AAARLAKCGPWHQGGWDPIPERPGCRVN 94


>gi|189426686|ref|YP_001953863.1| hypothetical protein Glov_3643 [Geobacter lovleyi SZ]
 gi|189422945|gb|ACD97343.1| protein of unknown function DUF37 [Geobacter lovleyi SZ]
          Length = 70

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/69 (44%), Positives = 43/69 (62%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           +   I I  IR YQL  S +   SCR+ PTCS+Y  ++I RYG + G  LT+ RL++C+P
Sbjct: 1   MLSRILITAIRAYQLCISPLLPGSCRFYPTCSDYSLQSIRRYGPYKGMLLTVSRLLRCHP 60

Query: 114 LGSDGFDPV 122
               G+DPV
Sbjct: 61  WHPGGYDPV 69


>gi|292571961|gb|ADE29876.1| hypothetical protein rpr22_CDS345 [Rickettsia prowazekii Rp22]
          Length = 82

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 33/80 (41%), Positives = 43/80 (53%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            I + II  Y+   S + GN+C + PTCSEY  EAI  +G   G W T  R+IKC P  S
Sbjct: 3   KILLLIITFYKYFISPLLGNNCLFHPTCSEYAKEAITTHGSIKGLWFTFRRIIKCQPFCS 62

Query: 117 DGFDPVPDDLPPKKNNPKLL 136
            G+D VP  +   K   K +
Sbjct: 63  GGYDNVPTSIKNSKTPTKKI 82


>gi|254419442|ref|ZP_05033166.1| conserved hypothetical protein TIGR00278 [Brevundimonas sp. BAL3]
 gi|196185619|gb|EDX80595.1| conserved hypothetical protein TIGR00278 [Brevundimonas sp. BAL3]
          Length = 83

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 32/67 (47%), Positives = 44/67 (65%)

Query: 64  RIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVP 123
           R Y+L  S + G  CR+LPTCS+YG +A+ ++G   G WLT+ RL KC+P G  G+DPVP
Sbjct: 13  RGYKLTLSPLIGQQCRFLPTCSDYGRDALIQHGPLKGGWLTVRRLCKCHPFGGSGYDPVP 72

Query: 124 DDLPPKK 130
                +K
Sbjct: 73  PAKTDEK 79


>gi|83941453|ref|ZP_00953915.1| hypothetical protein EE36_04453 [Sulfitobacter sp. EE-36]
 gi|83847273|gb|EAP85148.1| hypothetical protein EE36_04453 [Sulfitobacter sp. EE-36]
          Length = 70

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 32/71 (45%), Positives = 48/71 (67%), Gaps = 1/71 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + R++ +  ++ Y+L+FS   G++CRY PTCS Y  EA+A++G   G WLTL R+ +C+P
Sbjct: 1   MARVLAL-PVKGYRLVFSPWVGHNCRYHPTCSAYALEALAKHGGIQGGWLTLRRIARCHP 59

Query: 114 LGSDGFDPVPD 124
            G  G D VPD
Sbjct: 60  WGDSGIDNVPD 70


>gi|320095104|ref|ZP_08026813.1| alpha-hemolysin [Actinomyces sp. oral taxon 178 str. F0338]
 gi|319977971|gb|EFW09605.1| alpha-hemolysin [Actinomyces sp. oral taxon 178 str. F0338]
          Length = 115

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/68 (44%), Positives = 39/68 (57%)

Query: 56  RLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLG 115
           R   +  IR+YQ   S + G  CRY PTCS Y  EA+  +G+  G+ L L RL++CNP  
Sbjct: 9   RAAAVWPIRLYQRFVSPLLGPRCRYAPTCSAYAVEAVTVHGIAKGTALALWRLVRCNPWS 68

Query: 116 SDGFDPVP 123
             G D VP
Sbjct: 69  LGGVDCVP 76


>gi|77165897|ref|YP_344422.1| hypothetical protein Noc_2437 [Nitrosococcus oceani ATCC 19707]
 gi|254434169|ref|ZP_05047677.1| conserved hypothetical protein TIGR00278 [Nitrosococcus oceani
           AFC27]
 gi|116256203|sp|Q3J8F4|Y2437_NITOC RecName: Full=UPF0161 protein Noc_2437
 gi|76884211|gb|ABA58892.1| Protein of unknown function DUF37 [Nitrosococcus oceani ATCC 19707]
 gi|207090502|gb|EDZ67773.1| conserved hypothetical protein TIGR00278 [Nitrosococcus oceani
           AFC27]
          Length = 78

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 43/78 (55%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I + +I  Y+   S   GN CRY P+CS Y  EAI RYG + G WL L RL++C+P 
Sbjct: 1   MKNILLSLIIFYRYALSPFMGNHCRYYPSCSVYTQEAIQRYGGFRGGWLGLRRLLRCHPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G D VP+    +  +
Sbjct: 61  CPGGIDQVPEIAKWRSKS 78


>gi|154503053|ref|ZP_02040113.1| hypothetical protein RUMGNA_00875 [Ruminococcus gnavus ATCC 29149]
 gi|153796294|gb|EDN78714.1| hypothetical protein RUMGNA_00875 [Ruminococcus gnavus ATCC 29149]
          Length = 78

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/72 (47%), Positives = 44/72 (61%), Gaps = 1/72 (1%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGN-SCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           T  + I IG+IR YQ   S +     C Y PTCS+YG EAI +YG   G  LT+ R+++C
Sbjct: 7   TQMKKILIGMIRFYQKYLSGLKTTYHCIYTPTCSQYGIEAIEKYGAVKGLALTVWRILRC 66

Query: 112 NPLGSDGFDPVP 123
           NP    G+DPVP
Sbjct: 67  NPFAKGGYDPVP 78


>gi|298387006|ref|ZP_06996560.1| toxin-antitoxin system, toxin component [Bacteroides sp. 1_1_14]
 gi|298260156|gb|EFI03026.1| toxin-antitoxin system, toxin component [Bacteroides sp. 1_1_14]
          Length = 91

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (59%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           + +   + +  I  Y++  S +   SCR+ PTCS Y  EAI ++G   G +L + R+++C
Sbjct: 20  RKVFSFLLLIPIYFYRVCISPLTPPSCRFTPTCSAYAVEAIKKHGPVKGLYLAVRRILRC 79

Query: 112 NPLGSDGFDPVP 123
           +P G  G+DPVP
Sbjct: 80  HPWGGSGYDPVP 91


>gi|254447691|ref|ZP_05061157.1| conserved hypothetical protein TIGR00278 [gamma proteobacterium
           HTCC5015]
 gi|198263034|gb|EDY87313.1| conserved hypothetical protein TIGR00278 [gamma proteobacterium
           HTCC5015]
          Length = 97

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 49/75 (65%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            +T+   I + +++ Y+   S    ++C Y+PTCSEY  EAI ++G + G+WL+  R+ +
Sbjct: 8   MQTVLAHILLLLVKAYRYGVSPFTRSTCGYVPTCSEYAVEAIQQHGPFRGTWLSAKRIAR 67

Query: 111 CNPLGSDGFDPVPDD 125
           C+PL + G+DPVPD 
Sbjct: 68  CHPLKTGGYDPVPDT 82


>gi|160891752|ref|ZP_02072755.1| hypothetical protein BACUNI_04208 [Bacteroides uniformis ATCC 8492]
 gi|270295160|ref|ZP_06201361.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|317478179|ref|ZP_07937348.1| hypothetical protein HMPREF1007_00464 [Bacteroides sp. 4_1_36]
 gi|156859159|gb|EDO52590.1| hypothetical protein BACUNI_04208 [Bacteroides uniformis ATCC 8492]
 gi|270274407|gb|EFA20268.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|316905662|gb|EFV27447.1| hypothetical protein HMPREF1007_00464 [Bacteroides sp. 4_1_36]
          Length = 73

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/61 (45%), Positives = 40/61 (65%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           I  YQ   S + G SCR+ PTCS+Y  EAI ++G + G  L + R+++C+P G  G+DPV
Sbjct: 13  IYFYQKCISPMIGPSCRFTPTCSQYAVEAIKKHGPFKGFCLAVRRILRCHPWGGSGYDPV 72

Query: 123 P 123
           P
Sbjct: 73  P 73


>gi|118465987|ref|YP_884421.1| hypothetical protein MAV_5311 [Mycobacterium avium 104]
 gi|254777660|ref|ZP_05219176.1| hypothetical protein MaviaA2_23726 [Mycobacterium avium subsp.
           avium ATCC 25291]
 gi|166227311|sp|A0QND3|Y5311_MYCA1 RecName: Full=UPF0161 protein MAV_5311
 gi|118167274|gb|ABK68171.1| conserved hypothetical protein, putative [Mycobacterium avium 104]
          Length = 115

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 32/88 (36%), Positives = 51/88 (57%), Gaps = 3/88 (3%)

Query: 47  NGKFPKTLGRLIG---IGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWL 103
           +G   +  GR +    I +I++Y+ + S +   +CR++PTCS+Y  +A+  YGL  GSWL
Sbjct: 7   SGAAIRGAGRTVARGLIFLIQLYRHMVSPLRPATCRFVPTCSQYAVDALDEYGLIRGSWL 66

Query: 104 TLLRLIKCNPLGSDGFDPVPDDLPPKKN 131
              RL KC P    G+DP+P+    + N
Sbjct: 67  AAARLTKCGPWHQGGWDPIPERPGCRVN 94


>gi|15677737|ref|NP_274900.1| hypothetical protein NMB1906 [Neisseria meningitidis MC58]
 gi|161869309|ref|YP_001598476.1| hypothetical protein NMCC_0314 [Neisseria meningitidis 053442]
 gi|254804277|ref|YP_003082498.1| hypothetical protein NMO_0264 [Neisseria meningitidis alpha14]
 gi|304388452|ref|ZP_07370558.1| alpha-hemolysin [Neisseria meningitidis ATCC 13091]
 gi|54040381|sp|P67303|Y1906_NEIMB RecName: Full=UPF0161 protein NMB1906
 gi|54042707|sp|P67302|Y549_NEIMA RecName: Full=UPF0161 protein NMA0549
 gi|189039836|sp|A9M153|Y314_NEIM0 RecName: Full=UPF0161 protein NMCC_0314
 gi|7227163|gb|AAF42236.1| conserved hypothetical protein [Neisseria meningitidis MC58]
 gi|161594862|gb|ABX72522.1| conserved hypothetical protein [Neisseria meningitidis 053442]
 gi|254667819|emb|CBA03806.1| conserved hypothetical protein [Neisseria meningitidis alpha14]
 gi|254670911|emb|CBA07487.1| conserved hypothetical protein [Neisseria meningitidis alpha153]
 gi|304337569|gb|EFM03732.1| alpha-hemolysin [Neisseria meningitidis ATCC 13091]
 gi|316985523|gb|EFV64470.1| conserved hypothetical protein [Neisseria meningitidis H44/76]
 gi|325127481|gb|EGC50410.1| hypothetical protein TIGR00278 [Neisseria meningitidis N1568]
 gi|325133545|gb|EGC56208.1| hypothetical protein TIGR00278 [Neisseria meningitidis M13399]
 gi|325135497|gb|EGC58115.1| hypothetical protein TIGR00278 [Neisseria meningitidis M0579]
 gi|325143617|gb|EGC65936.1| hypothetical protein TIGR00278 [Neisseria meningitidis M01-240013]
 gi|325200958|gb|ADY96413.1| conserved hypothetical protein TIGR00278 [Neisseria meningitidis
           H44/76]
 gi|325201459|gb|ADY96913.1| conserved hypothetical protein TIGR00278 [Neisseria meningitidis
           M01-240149]
 gi|325204857|gb|ADZ00311.1| conserved hypothetical protein TIGR00278 [Neisseria meningitidis
           M01-240355]
 gi|325206813|gb|ADZ02266.1| conserved hypothetical protein TIGR00278 [Neisseria meningitidis
           M04-240196]
 gi|325207440|gb|ADZ02892.1| conserved hypothetical protein TIGR00278 [Neisseria meningitidis
           NZ-05/33]
          Length = 73

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/61 (45%), Positives = 37/61 (60%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           IR YQ   S +    CRY PTCS+Y  EA+ +YG + G  L + R+ +C+P G  G DPV
Sbjct: 13  IRFYQYCISPLIPPRCRYTPTCSQYAVEAVKKYGAFKGGRLAIKRIARCHPFGGHGHDPV 72

Query: 123 P 123
           P
Sbjct: 73  P 73


>gi|304382218|ref|ZP_07364725.1| alpha-hemolysin [Prevotella marshii DSM 16973]
 gi|304336575|gb|EFM02804.1| alpha-hemolysin [Prevotella marshii DSM 16973]
          Length = 79

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/72 (38%), Positives = 41/72 (56%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           +     + +  I  YQ I S     SCR+ PTCSEY  +A+ ++G   G W T+ R+ +C
Sbjct: 8   RLFLTWVLLLPILFYQRIVSPFTPPSCRFTPTCSEYARQALLKHGPIKGLWFTIRRIARC 67

Query: 112 NPLGSDGFDPVP 123
           +P G  G+DPVP
Sbjct: 68  HPWGGSGYDPVP 79


>gi|220906441|ref|YP_002481752.1| hypothetical protein Cyan7425_1005 [Cyanothece sp. PCC 7425]
 gi|219863052|gb|ACL43391.1| protein of unknown function DUF37 [Cyanothece sp. PCC 7425]
          Length = 83

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 44/70 (62%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + + + +I+ Y+   S +F   CRY PTCS Y  EAI R+G+  GS L L R+++C+P
Sbjct: 3   MLKKVLLLLIQAYRQFISPLFLPQCRYQPTCSAYAMEAIERFGVVRGSGLALRRILRCHP 62

Query: 114 LGSDGFDPVP 123
               G+DPVP
Sbjct: 63  FHPGGYDPVP 72


>gi|297621805|ref|YP_003709942.1| hypothetical protein wcw_1590 [Waddlia chondrophila WSU 86-1044]
 gi|297377106|gb|ADI38936.1| conserved hypothetical protein [Waddlia chondrophila WSU 86-1044]
          Length = 69

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 42/69 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + +   +I +YQ     + G +CR+ P+CSEYG EA+ ++G   G WL L RLIKC+P 
Sbjct: 1   MKHLLSFLITLYQWCIRPLLGQNCRFSPSCSEYGKEALIKHGAIKGLWLILKRLIKCHPR 60

Query: 115 GSDGFDPVP 123
              G DPVP
Sbjct: 61  HPGGCDPVP 69


>gi|295111772|emb|CBL28522.1| conserved hypothetical protein TIGR00278 [Synergistetes bacterium
           SGP1]
          Length = 78

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/64 (43%), Positives = 43/64 (67%)

Query: 60  IGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGF 119
           + ++R YQ++ S + G +CR+ PTCS+Y   A+  +GL+ G WLTL RL++C P    G+
Sbjct: 1   MLLVRGYQVLISPLLGRNCRFCPTCSQYALIALRDWGLFRGGWLTLRRLLRCGPWSEGGY 60

Query: 120 DPVP 123
           DP P
Sbjct: 61  DPPP 64


>gi|83950044|ref|ZP_00958777.1| hypothetical protein ISM_03080 [Roseovarius nubinhibens ISM]
 gi|83837943|gb|EAP77239.1| hypothetical protein ISM_03080 [Roseovarius nubinhibens ISM]
          Length = 72

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 32/70 (45%), Positives = 44/70 (62%), Gaps = 1/70 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           L RL+ +  +R Y+L+FS   G+ CRY PTCS Y  EA+ ++G   G WL L R+ +C+P
Sbjct: 4   LARLVAL-PVRAYRLLFSPWVGHGCRYHPTCSAYALEALEKHGGLKGGWLMLRRIARCHP 62

Query: 114 LGSDGFDPVP 123
            G  G D VP
Sbjct: 63  WGGSGIDNVP 72


>gi|108805993|ref|YP_645930.1| hypothetical protein Rxyl_3214 [Rubrobacter xylanophilus DSM 9941]
 gi|116256224|sp|Q1AR60|Y3214_RUBXD RecName: Full=UPF0161 protein Rxyl_3214
 gi|108767236|gb|ABG06118.1| protein of unknown function DUF37 [Rubrobacter xylanophilus DSM
           9941]
          Length = 70

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 29/68 (42%), Positives = 42/68 (61%), Gaps = 1/68 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
           GRL+ I ++R YQ   S +F  SCR+ P+CS+Y  EA+ RYG   G  +   R+++C+P 
Sbjct: 3   GRLV-ILVLRAYQRFVSPLFPPSCRFTPSCSQYAVEAVERYGPLKGGAMAAWRVLRCHPF 61

Query: 115 GSDGFDPV 122
              G DPV
Sbjct: 62  SRGGVDPV 69


>gi|254488336|ref|ZP_05101541.1| conserved hypothetical protein TIGR00278 [Roseobacter sp. GAI101]
 gi|214045205|gb|EEB85843.1| conserved hypothetical protein TIGR00278 [Roseobacter sp. GAI101]
          Length = 66

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 29/62 (46%), Positives = 40/62 (64%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           ++ Y+LIFS   G++CRY PTCS Y  EA+ ++G   G WL   R+ +C+P G  G D V
Sbjct: 5   VKGYRLIFSPWVGHNCRYHPTCSAYALEALRKHGGLKGGWLAARRIARCHPWGDSGIDNV 64

Query: 123 PD 124
           PD
Sbjct: 65  PD 66


>gi|302191121|ref|ZP_07267375.1| hypothetical protein LineA_03857 [Lactobacillus iners AB-1]
          Length = 94

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 47/78 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I ++ IYQ   S +F  +CRY PTCS+Y   AI+++G  +G  + + R+I+CNP 
Sbjct: 1   MKKLLINMVIIYQKCISPLFPPTCRYYPTCSKYMITAISKHGCILGIIMGVARIIRCNPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G DPVPD    ++N 
Sbjct: 61  VRGGVDPVPDFFTIRRNP 78


>gi|154508235|ref|ZP_02043877.1| hypothetical protein ACTODO_00729 [Actinomyces odontolyticus ATCC
           17982]
 gi|153797869|gb|EDN80289.1| hypothetical protein ACTODO_00729 [Actinomyces odontolyticus ATCC
           17982]
          Length = 121

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 26/64 (40%), Positives = 32/64 (50%)

Query: 61  GIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFD 120
             I  YQ   S   G  CRY P+CS Y  +AI  +G   G  L   RL++CNP    G D
Sbjct: 14  APIVAYQRYISPALGPRCRYAPSCSTYALQAIRVHGPIKGLILGTWRLLRCNPWSHGGVD 73

Query: 121 PVPD 124
            VP+
Sbjct: 74  HVPE 77


>gi|303256373|ref|ZP_07342387.1| alpha-hemolysin [Burkholderiales bacterium 1_1_47]
 gi|331001501|ref|ZP_08325119.1| conserved hypothetical protein YidD [Parasutterella
           excrementihominis YIT 11859]
 gi|302859864|gb|EFL82941.1| alpha-hemolysin [Burkholderiales bacterium 1_1_47]
 gi|329568230|gb|EGG50047.1| conserved hypothetical protein YidD [Parasutterella
           excrementihominis YIT 11859]
          Length = 103

 Score = 99.2 bits (246), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 33/74 (44%), Positives = 48/74 (64%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + + + +IR YQ +FS   G++CR+LPTCS+Y Y +I R+G   G WLT  R+++CNP
Sbjct: 1   MIKNLCLFMIRGYQFLFSPWVGHNCRFLPTCSQYSYTSIQRFGALRGVWLTFFRILRCNP 60

Query: 114 LGSDGFDPVPDDLP 127
            G  G D VPD   
Sbjct: 61  FGGSGIDEVPDKFK 74


>gi|85858986|ref|YP_461188.1| putative cytoplasmic protein [Syntrophus aciditrophicus SB]
 gi|116256132|sp|Q2LSG3|Y1141_SYNAS RecName: Full=UPF0161 protein SYNAS_11410
 gi|85722077|gb|ABC77020.1| hypothetical cytosolic protein [Syntrophus aciditrophicus SB]
          Length = 74

 Score = 99.2 bits (246), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/66 (46%), Positives = 44/66 (66%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            I I +IR+YQ++ S +F   CR+ P+CSEY   A+ ++GL  GS L L+RL KC+P   
Sbjct: 8   KILIILIRLYQILISPLFAPCCRFYPSCSEYAIIAVRKHGLSKGSRLALIRLFKCHPFHP 67

Query: 117 DGFDPV 122
            G+DPV
Sbjct: 68  GGYDPV 73


>gi|239980790|ref|ZP_04703314.1| hypothetical protein SalbJ_15197 [Streptomyces albus J1074]
 gi|291452649|ref|ZP_06592039.1| UPF0161 protein [Streptomyces albus J1074]
 gi|291355598|gb|EFE82500.1| UPF0161 protein [Streptomyces albus J1074]
          Length = 129

 Score = 99.2 bits (246), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 43/75 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   + +I++YQ   S + G  C+Y P+CS YGY AI R+G   G+ LT  R+++CNP 
Sbjct: 1   MKYPLLALIKLYQWTISPLLGPVCKYYPSCSHYGYGAIDRHGAIKGTALTAWRILRCNPW 60

Query: 115 GSDGFDPVPDDLPPK 129
              G D VP    P+
Sbjct: 61  SLGGVDHVPPRKRPR 75


>gi|22298107|ref|NP_681354.1| hypothetical protein tsr0564 [Thermosynechococcus elongatus BP-1]
 gi|29428190|sp|Q8DLD1|Y564_THEEB RecName: Full=UPF0161 protein tsr0564
 gi|22294285|dbj|BAC08116.1| tsr0564 [Thermosynechococcus elongatus BP-1]
          Length = 90

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 34/75 (45%), Positives = 46/75 (61%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
              I +IRIYQ   S +F  +CRY P+CS Y  EAIARYG   G++L + R+++C+P   
Sbjct: 7   KALIVLIRIYQRWISPLFLPTCRYTPSCSAYAVEAIARYGAVKGTYLAIRRILRCHPFAV 66

Query: 117 DGFDPVPDDLPPKKN 131
            G+DPVP   P   N
Sbjct: 67  GGYDPVPTTCPDPCN 81


>gi|300087854|ref|YP_003758376.1| hypothetical protein Dehly_0750 [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
 gi|299527587|gb|ADJ26055.1| protein of unknown function DUF37 [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
          Length = 69

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 35/69 (50%), Positives = 46/69 (66%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              + + IIR+YQ   S V  +SCR+LPTCS+Y YEAI +YG+  G WL   RL +C+PL
Sbjct: 1   MSNLALWIIRLYQNSISKVTPSSCRFLPTCSQYTYEAIVKYGVIKGVWLGARRLARCHPL 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  NQGGYDPVP 69


>gi|121634186|ref|YP_974431.1| hypothetical protein NMC0317 [Neisseria meningitidis FAM18]
 gi|166229399|sp|A1KRZ9|Y317_NEIMF RecName: Full=UPF0161 protein NMC0317
 gi|120865892|emb|CAM09628.1| conserved hypothetical protein [Neisseria meningitidis FAM18]
 gi|261393237|emb|CAX50860.1| conserved hypothetical protein [Neisseria meningitidis 8013]
 gi|325131544|gb|EGC54251.1| hypothetical protein TIGR00278 [Neisseria meningitidis M6190]
 gi|325139201|gb|EGC61747.1| hypothetical protein TIGR00278 [Neisseria meningitidis ES14902]
 gi|325197598|gb|ADY93054.1| conserved hypothetical protein TIGR00278 [Neisseria meningitidis
           G2136]
          Length = 73

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/61 (47%), Positives = 38/61 (62%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           IR YQ   S +    CRY PTCS+Y  EA+ +YG + G  L + R+ +C+PLG  G DPV
Sbjct: 13  IRFYQYCISPLIPPRCRYTPTCSQYAVEAVKKYGAFKGGRLAIKRIARCHPLGGHGHDPV 72

Query: 123 P 123
           P
Sbjct: 73  P 73


>gi|15604715|ref|NP_220735.1| hypothetical protein RP351a [Rickettsia prowazekii str. Madrid E]
          Length = 90

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/80 (41%), Positives = 43/80 (53%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            I + II  Y+   S + GN+C + PTCSEY  EAI  +G   G W T  R+IKC P  S
Sbjct: 11  KILLLIITFYKYFISPLLGNNCLFHPTCSEYAKEAITTHGSIKGLWFTFRRIIKCQPFCS 70

Query: 117 DGFDPVPDDLPPKKNNPKLL 136
            G+D VP  +   K   K +
Sbjct: 71  GGYDNVPTSIKNSKTPTKKI 90


>gi|260890877|ref|ZP_05902140.1| putative toxin-antitoxin system, toxin component [Leptotrichia
           hofstadii F0254]
 gi|260859430|gb|EEX73930.1| putative toxin-antitoxin system, toxin component [Leptotrichia
           hofstadii F0254]
          Length = 69

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 42/67 (62%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I + +I+IYQ   S   G  CR+ PTCSEY  +AI +YG   GS+L + R++KC+P 
Sbjct: 1   MKKILLFLIKIYQKGISPYLGRRCRFYPTCSEYSRQAIIKYGAVKGSYLAIKRILKCHPF 60

Query: 115 GSDGFDP 121
              G+DP
Sbjct: 61  HKGGYDP 67


>gi|118620077|ref|YP_908409.1| hypothetical protein MUL_5075 [Mycobacterium ulcerans Agy99]
 gi|183985456|ref|YP_001853747.1| hypothetical protein MMAR_5578 [Mycobacterium marinum M]
 gi|118572187|gb|ABL06938.1| conserved hypothetical protein [Mycobacterium ulcerans Agy99]
 gi|183178782|gb|ACC43892.1| conserved hypothetical protein [Mycobacterium marinum M]
          Length = 102

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 34/76 (44%), Positives = 50/76 (65%), Gaps = 3/76 (3%)

Query: 52  KTLGRLIG---IGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRL 108
           +T GRL     I +I +Y+ + S +   SCR++PTCS+Y  +A++ YGL  GSWLT+ RL
Sbjct: 3   RTSGRLAARGLIYVIELYRHMVSPLRPASCRFIPTCSQYAVDALSEYGLIRGSWLTVARL 62

Query: 109 IKCNPLGSDGFDPVPD 124
            KC P    G+DP+P+
Sbjct: 63  AKCGPWHQGGWDPIPE 78


>gi|313669124|ref|YP_004049408.1| hypothetical protein NLA_18480 [Neisseria lactamica ST-640]
 gi|313006586|emb|CBN88051.1| conserved hypothetical protein [Neisseria lactamica 020-06]
          Length = 73

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/61 (45%), Positives = 37/61 (60%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           +R YQ   S +    CRY PTCS+Y  EA+ +YG + G  L   R+ +C+PLG  G DPV
Sbjct: 13  VRFYQYCISPLIPPRCRYTPTCSQYAVEAVKKYGAFKGGLLAAKRIARCHPLGGHGHDPV 72

Query: 123 P 123
           P
Sbjct: 73  P 73


>gi|254503620|ref|ZP_05115771.1| conserved hypothetical protein TIGR00278, putative [Labrenzia
           alexandrii DFL-11]
 gi|222439691|gb|EEE46370.1| conserved hypothetical protein TIGR00278, putative [Labrenzia
           alexandrii DFL-11]
          Length = 116

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 48/69 (69%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            IG+I IY+   S   G +CRY PTCS+Y  +AI R+G W G WL L R+++CNP G+ G
Sbjct: 22  AIGLIWIYRHTLSLFMGRTCRYAPTCSDYTDQAIRRFGFWAGGWLGLSRILRCNPWGASG 81

Query: 119 FDPVPDDLP 127
           FDP+P+ LP
Sbjct: 82  FDPLPETLP 90


>gi|308234063|ref|ZP_07664800.1| hypothetical protein AvagD15_03394 [Atopobium vaginae DSM 15829]
 gi|328943460|ref|ZP_08240925.1| alpha-hemolysin [Atopobium vaginae DSM 15829]
 gi|327491429|gb|EGF23203.1| alpha-hemolysin [Atopobium vaginae DSM 15829]
          Length = 74

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 42/67 (62%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            + I +IR YQ   S +   SC Y PTCSEY  EA+ RYG   GS+L L R+++C+P   
Sbjct: 8   NVFITLIRGYQKCISPLMRPSCIYSPTCSEYACEALRRYGWLKGSYLALRRILRCHPFHK 67

Query: 117 DGFDPVP 123
            GFDPVP
Sbjct: 68  GGFDPVP 74


>gi|239918805|ref|YP_002958363.1| conserved hypothetical protein TIGR00278 [Micrococcus luteus NCTC
           2665]
 gi|281414968|ref|ZP_06246710.1| hypothetical protein MlutN2_07172 [Micrococcus luteus NCTC 2665]
 gi|289705893|ref|ZP_06502272.1| conserved hypothetical protein YidD [Micrococcus luteus SK58]
 gi|239840012|gb|ACS31809.1| conserved hypothetical protein TIGR00278 [Micrococcus luteus NCTC
           2665]
 gi|289557378|gb|EFD50690.1| conserved hypothetical protein YidD [Micrococcus luteus SK58]
          Length = 122

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 46/81 (56%), Gaps = 2/81 (2%)

Query: 43  SRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSW 102
           SR W     + L   +  G++ +Y+ + S ++G  CR+ P+CS YG EA+  +G   GSW
Sbjct: 14  SREW--GPLRALPSALLAGLLTVYRAVVSPLYGPVCRFFPSCSAYGLEAVHVHGAVKGSW 71

Query: 103 LTLLRLIKCNPLGSDGFDPVP 123
           L   R+ +C+P    G DPVP
Sbjct: 72  LAARRIGRCHPWNDGGVDPVP 92


>gi|323343531|ref|ZP_08083758.1| alpha-hemolysin [Prevotella oralis ATCC 33269]
 gi|323095350|gb|EFZ37924.1| alpha-hemolysin [Prevotella oralis ATCC 33269]
          Length = 83

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 42/74 (56%)

Query: 50  FPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLI 109
           +   L   + +  +  YQ   S    +SCR+ PTCSEY  +A+ ++G   G  L + R++
Sbjct: 10  WIAVLFTWLLLIPVIFYQNFISPYTPSSCRFTPTCSEYARQALLKHGPVKGLILAVWRIL 69

Query: 110 KCNPLGSDGFDPVP 123
           +CNP G  G+DPVP
Sbjct: 70  RCNPWGGSGYDPVP 83


>gi|55820360|ref|YP_138802.1| hypothetical protein stu0263 [Streptococcus thermophilus LMG 18311]
 gi|55822250|ref|YP_140691.1| hypothetical protein str0263 [Streptococcus thermophilus CNRZ1066]
 gi|81559848|sp|Q5M1H7|Y263_STRT1 RecName: Full=UPF0161 protein str0263
 gi|81561024|sp|Q5M619|Y263_STRT2 RecName: Full=UPF0161 protein stu0263
 gi|55736345|gb|AAV59987.1| conserved hypothetical protein [Streptococcus thermophilus LMG
           18311]
 gi|55738235|gb|AAV61876.1| conserved hypothetical protein [Streptococcus thermophilus
           CNRZ1066]
          Length = 83

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/84 (34%), Positives = 47/84 (55%), Gaps = 1/84 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + +   I +++ YQ   S +F  SCR+ PTCS Y  +AI ++G   G  + + R+++C+P
Sbjct: 1   MMKKFLIALVKAYQRWISPLFPLSCRFCPTCSVYMIQAIEKHG-LKGVLMGIARILRCHP 59

Query: 114 LGSDGFDPVPDDLPPKKNNPKLLS 137
           L   G DPVPD    K+    L +
Sbjct: 60  LSETGDDPVPDYFSLKRKKTPLDN 83


>gi|224023480|ref|ZP_03641846.1| hypothetical protein BACCOPRO_00182 [Bacteroides coprophilus DSM
           18228]
 gi|224016702|gb|EEF74714.1| hypothetical protein BACCOPRO_00182 [Bacteroides coprophilus DSM
           18228]
          Length = 73

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 26/61 (42%), Positives = 39/61 (63%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           I  Y+   S     SCR+ PTCS+Y  EA+ ++G + G WL + R+++C+P G  G+DPV
Sbjct: 13  IYFYRNCISPFTPPSCRFTPTCSQYAIEALKKHGPFKGLWLAIRRILRCHPWGGSGYDPV 72

Query: 123 P 123
           P
Sbjct: 73  P 73


>gi|159040589|ref|YP_001539842.1| hypothetical protein Sare_5109 [Salinispora arenicola CNS-205]
 gi|157919424|gb|ABW00852.1| protein of unknown function DUF37 [Salinispora arenicola CNS-205]
          Length = 95

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 41/74 (55%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
           P + G  +  G I  Y+   S      CR+ P+CS Y  EA+ R+G   G+ LT  RL++
Sbjct: 10  PTSPGARVLTGPIIAYRRWISPALPARCRFYPSCSAYALEAVTRHGTLRGAGLTARRLLR 69

Query: 111 CNPLGSDGFDPVPD 124
           C+P    GFDPVP+
Sbjct: 70  CHPFHPGGFDPVPE 83


>gi|19745527|ref|NP_606663.1| hypothetical protein spyM18_0419 [Streptococcus pyogenes MGAS8232]
 gi|25009593|sp|Q8P2C7|Y419_STRP8 RecName: Full=UPF0161 protein spyM18_0419
 gi|19747646|gb|AAL97162.1| conserved hypothetical protein [Streptococcus pyogenes MGAS8232]
          Length = 86

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/86 (32%), Positives = 47/86 (54%), Gaps = 1/86 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + + I  ++ YQ   S +   SCRY PTCS Y   AI ++G   G  + + R+++C+P
Sbjct: 1   MMKKLLIVSVKAYQKYISPLSPPSCRYKPTCSAYMLTAIEKHGT-KGILMGIARILRCHP 59

Query: 114 LGSDGFDPVPDDLPPKKNNPKLLSKK 139
             + G DPVP+D    +N     ++K
Sbjct: 60  FVAGGVDPVPEDFSLMRNKNTSKNEK 85


>gi|153956506|ref|YP_001397271.1| hypothetical protein CKL_3924 [Clostridium kluyveri DSM 555]
 gi|219856809|ref|YP_002473931.1| hypothetical protein CKR_3466 [Clostridium kluyveri NBRC 12016]
 gi|189040261|sp|A5N454|Y3924_CLOK5 RecName: Full=UPF0161 protein CKL_3924
 gi|254801683|sp|B9DXS4|Y3466_CLOK1 RecName: Full=UPF0161 protein CKR_3466
 gi|146349364|gb|EDK35900.1| Conserved hypothetical protein [Clostridium kluyveri DSM 555]
 gi|219570533|dbj|BAH08517.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 69

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 23/69 (33%), Positives = 43/69 (62%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   I +I++Y+   S +    CR+ PTCS+Y  EA+ ++G+  G ++++ R+++CNP 
Sbjct: 1   MKKFLIFLIKVYRKYISPLKVPCCRFYPTCSQYVLEALQKHGIIKGGFMSIKRILRCNPF 60

Query: 115 GSDGFDPVP 123
              G+DPV 
Sbjct: 61  CKGGYDPVK 69


>gi|256372786|ref|YP_003110610.1| protein of unknown function DUF37 [Acidimicrobium ferrooxidans DSM
           10331]
 gi|256009370|gb|ACU54937.1| protein of unknown function DUF37 [Acidimicrobium ferrooxidans DSM
           10331]
          Length = 88

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 35/78 (44%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           + L R  G+G+IR YQ+       + CRY+P+CS+Y YEA+  +GL  GSWL   R+ +C
Sbjct: 8   RALPRRAGMGLIRAYQVARRGR-PSPCRYVPSCSQYAYEAVELHGLARGSWLAAKRVGRC 66

Query: 112 NPLGSDGFDPVPDDLPPK 129
           NP G  G+DPVP     K
Sbjct: 67  NPFGGSGYDPVPPRRSGK 84


>gi|254557138|ref|YP_003063555.1| alpha-hemolysin-like protein [Lactobacillus plantarum JDM1]
 gi|308181141|ref|YP_003925269.1| alpha-hemolysin-like protein [Lactobacillus plantarum subsp.
           plantarum ST-III]
 gi|254046065|gb|ACT62858.1| alpha-hemolysin-like protein [Lactobacillus plantarum JDM1]
 gi|308046632|gb|ADN99175.1| alpha-hemolysin-like protein [Lactobacillus plantarum subsp.
           plantarum ST-III]
          Length = 90

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 42/78 (53%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R + +  IR YQ  FS      CRY PTCS Y  EAI R+G   G  + + R+++C PL
Sbjct: 1   MRRLLMKGIRFYQRAFSAFSPAHCRYYPTCSNYTLEAIDRFGAVKGVLMGVARILRCQPL 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              GFDPVP     ++N 
Sbjct: 61  VKGGFDPVPAHFSLRRNP 78


>gi|323141440|ref|ZP_08076330.1| conserved hypothetical protein YidD [Phascolarctobacterium sp. YIT
           12067]
 gi|322414096|gb|EFY04925.1| conserved hypothetical protein YidD [Phascolarctobacterium sp. YIT
           12067]
          Length = 63

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/61 (47%), Positives = 39/61 (63%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           IR YQ+  S +   +CR+ PTCS Y  EAI + G   G+WL + R+ KC+P  S G+DPV
Sbjct: 3   IRFYQIFISPLKPPTCRFYPTCSAYAIEAIQKKGPVKGTWLAIKRIAKCHPFHSGGYDPV 62

Query: 123 P 123
           P
Sbjct: 63  P 63


>gi|300791164|ref|YP_003771455.1| hypothetical protein AMED_9365 [Amycolatopsis mediterranei U32]
 gi|299800678|gb|ADJ51053.1| conserved hypothetical protein [Amycolatopsis mediterranei U32]
          Length = 114

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 26/86 (30%), Positives = 45/86 (52%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
               + +  I++Y+   S     +CR+ P+CS Y  EA+ R+G   GS+L + RL++C P
Sbjct: 29  PVAWVLLLPIKLYRKAISPFLPPACRFYPSCSAYAVEALTRHGAGRGSYLAVRRLLRCGP 88

Query: 114 LGSDGFDPVPDDLPPKKNNPKLLSKK 139
               G DPVP+    +   P+   ++
Sbjct: 89  WTPPGRDPVPETFSWRHRRPETPIEE 114


>gi|296121795|ref|YP_003629573.1| hypothetical protein Plim_1541 [Planctomyces limnophilus DSM 3776]
 gi|296014135|gb|ADG67374.1| protein of unknown function DUF37 [Planctomyces limnophilus DSM
           3776]
          Length = 117

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 22/68 (32%), Positives = 39/68 (57%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           +   + I  +++YQ   S + G  CR+ P+CS+Y   A+ +YG   G++  L R+ +C+P
Sbjct: 49  ILSFVLIAAVKVYQWTISPLLGPVCRFHPSCSQYFILAVKKYGPIWGTFKGLYRITRCHP 108

Query: 114 LGSDGFDP 121
               G+DP
Sbjct: 109 WNPGGYDP 116


>gi|224140273|ref|XP_002323507.1| predicted protein [Populus trichocarpa]
 gi|222868137|gb|EEF05268.1| predicted protein [Populus trichocarpa]
          Length = 97

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 34/70 (48%), Positives = 45/70 (64%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
            +LG    + ++R Y+   S +  NSCRY+PTCSEY  EA  +YG+  G+ LT  RL +C
Sbjct: 15  NSLGVEAALSMLRFYKREISPLLPNSCRYVPTCSEYSMEAYKKYGVVKGTVLTAWRLCRC 74

Query: 112 NPLGSDGFDP 121
           NPLG  GFDP
Sbjct: 75  NPLGGSGFDP 84


>gi|28198205|ref|NP_778519.1| hypothetical protein PD0282 [Xylella fastidiosa Temecula1]
 gi|32130322|sp|Q87EM1|Y282_XYLFT RecName: Full=UPF0161 protein PD_0282
 gi|28056275|gb|AAO28168.1| alpha-hemolysin [Xylella fastidiosa Temecula1]
          Length = 92

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 45/74 (60%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            I +++IY+ + S + G  CR+ P+CSEY   AIAR+G   G WL   RL +C+PL   G
Sbjct: 9   LILLLKIYKRLISPLLGPHCRFEPSCSEYAMVAIARFGTLRGIWLAARRLARCHPLQLGG 68

Query: 119 FDPVPDDLPPKKNN 132
            DPVPD+   + N 
Sbjct: 69  HDPVPDNTSTQVNP 82


>gi|299068433|emb|CBJ39657.1| conserved protein of unknown function [Ralstonia solanacearum
           CMR15]
          Length = 104

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/69 (40%), Positives = 44/69 (63%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              + + ++RIY++ FS   G  CR+LPTCS+Y  +A+  +G  +GS+L   RL +C+P 
Sbjct: 1   MTRVLLFLLRIYKVAFSPFVGAQCRFLPTCSDYARDAVLTHGPALGSYLAAKRLCRCHPF 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  AQGGYDPVP 69


>gi|94312545|ref|YP_585755.1| hypothetical protein Rmet_3614 [Cupriavidus metallidurans CH34]
 gi|116256232|sp|Q1LH90|Y3614_RALME RecName: Full=UPF0161 protein Rmet_3614
 gi|93356397|gb|ABF10486.1| conserved hypothetical protein YidD [Cupriavidus metallidurans
           CH34]
          Length = 96

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/69 (40%), Positives = 45/69 (65%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I + ++RIY++  S   G+ CR+LPTCS+Y  +AI ++G   G+W+   RL +C+P 
Sbjct: 1   MKRILLALLRIYKIALSPYLGSQCRFLPTCSDYARDAIVQHGAARGTWMAACRLCRCHPF 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  TKGGYDPVP 69


>gi|187930819|ref|YP_001901306.1| hypothetical protein Rpic_3758 [Ralstonia pickettii 12J]
 gi|309780185|ref|ZP_07674936.1| alpha-hemolysin [Ralstonia sp. 5_7_47FAA]
 gi|187727709|gb|ACD28874.1| protein of unknown function DUF37 [Ralstonia pickettii 12J]
 gi|308920888|gb|EFP66534.1| alpha-hemolysin [Ralstonia sp. 5_7_47FAA]
          Length = 145

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/69 (40%), Positives = 43/69 (62%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              + + ++RIY++ FS   G  CR+LPTCS+Y  +A+  +G   GS+L   RL +C+P 
Sbjct: 1   MTRVLLFLLRIYKVAFSPFVGAQCRFLPTCSDYARDAVLTHGPGYGSYLAAKRLCRCHPF 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  AQGGYDPVP 69


>gi|17544722|ref|NP_518124.1| hypothetical protein RSc0003 [Ralstonia solanacearum GMI1000]
 gi|29428229|sp|Q8Y3H7|Y003_RALSO RecName: Full=UPF0161 protein RSc0003
 gi|17427011|emb|CAD13531.1| conserved hypothetical protein [Ralstonia solanacearum GMI1000]
          Length = 104

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/69 (40%), Positives = 44/69 (63%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              + + ++R+Y++ FS   G  CR+LPTCS+Y  +A+  +G  IGS+L   RL +C+P 
Sbjct: 1   MTRVLLFLLRVYKVAFSPFVGAQCRFLPTCSDYARDAVLTHGPAIGSYLAAKRLCRCHPF 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  AQGGYDPVP 69


>gi|171061053|ref|YP_001793402.1| hypothetical protein Lcho_4386 [Leptothrix cholodnii SP-6]
 gi|170778498|gb|ACB36637.1| protein of unknown function DUF37 [Leptothrix cholodnii SP-6]
          Length = 112

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 31/74 (41%), Positives = 47/74 (63%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R + + ++R Y+L  S   G+SCR+ PTCS Y  +A+A++G   G+ LTL RL +C+P 
Sbjct: 11  PRRLLMSLVRGYRLFLSPWLGSSCRFEPTCSAYALQALAQHGAASGTRLTLGRLARCHPW 70

Query: 115 GSDGFDPVPDDLPP 128
            + G DPVP  + P
Sbjct: 71  CAGGCDPVPGTVRP 84


>gi|28378933|ref|NP_785825.1| alpha-hemolysin-like protein [Lactobacillus plantarum WCFS1]
 gi|38258747|sp|Q88UU8|Y2358_LACPL RecName: Full=UPF0161 protein lp_2358
 gi|28271770|emb|CAD64676.1| alpha-hemolysin homolog [Lactobacillus plantarum WCFS1]
          Length = 90

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 42/78 (53%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R + +  IR YQ  FS      CRY PTCS Y  EAI R+G   G  + + R+++C PL
Sbjct: 1   MRRLLMKGIRFYQRAFSAFSPAHCRYYPTCSNYTLEAINRFGAVKGVLMGVARILRCQPL 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              GFDPVP     ++N 
Sbjct: 61  VKGGFDPVPAHFSLRRNP 78


>gi|301167812|emb|CBW27396.1| conserved hypothetical protein [Bacteriovorax marinus SJ]
          Length = 71

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 31/71 (43%), Positives = 46/71 (64%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R + I II+IYQ+  S +FG+ CR+ PTCS Y  EA+A   L+   +L+  R++KC+P 
Sbjct: 1   MRKLLIFIIKIYQVAISPLFGSKCRFHPTCSHYTQEALATLPLYKAFYLSSKRILKCHPF 60

Query: 115 GSDGFDPVPDD 125
              G+DPVP +
Sbjct: 61  HRGGYDPVPKN 71


>gi|302543968|ref|ZP_07296310.1| conserved hypothetical protein YidD [Streptomyces hygroscopicus
           ATCC 53653]
 gi|302461586|gb|EFL24679.1| conserved hypothetical protein YidD [Streptomyces himastatinicus
           ATCC 53653]
          Length = 105

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 42/74 (56%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   + +I++YQ   S + G  C+Y P+CS YGY AI R+G   G+ LT  R+++CNP 
Sbjct: 1   MKYPLLWLIKLYQWTISPMLGPVCKYYPSCSHYGYTAIDRHGAVKGTALTAWRILRCNPW 60

Query: 115 GSDGFDPVPDDLPP 128
              G D VP    P
Sbjct: 61  SLGGVDHVPPRKHP 74


>gi|313675275|ref|YP_004053271.1| hypothetical protein Ftrac_1168 [Marivirga tractuosa DSM 4126]
 gi|312941973|gb|ADR21163.1| protein of unknown function DUF37 [Marivirga tractuosa DSM 4126]
          Length = 81

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 36/75 (48%), Positives = 47/75 (62%), Gaps = 1/75 (1%)

Query: 49  KFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRL 108
           K  KT+ R + I  +  YQ   S +F  SCR+ PTCSEY  +AI +YGL  GS L+  R+
Sbjct: 8   KLTKTI-RKVAIWPVLFYQYGISPLFPASCRFTPTCSEYTKQAILKYGLLKGSKLSAKRI 66

Query: 109 IKCNPLGSDGFDPVP 123
            KC+P G  G+DPVP
Sbjct: 67  SKCHPWGGSGYDPVP 81


>gi|302880139|ref|YP_003848703.1| hypothetical protein Galf_2947 [Gallionella capsiferriformans ES-2]
 gi|302582928|gb|ADL56939.1| protein of unknown function DUF37 [Gallionella capsiferriformans
           ES-2]
          Length = 69

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 43/69 (62%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R I I +I  YQ + S +   +CR+ P+CS Y  +A+ R+GL  GSWL++ R+ +CNP 
Sbjct: 1   MRRILIKVIHGYQYLISPMRPPTCRFTPSCSHYACDALTRHGLITGSWLSIKRIARCNPW 60

Query: 115 GSDGFDPVP 123
              G+DP P
Sbjct: 61  NPGGYDPAP 69


>gi|84497197|ref|ZP_00996019.1| hypothetical protein JNB_13423 [Janibacter sp. HTCC2649]
 gi|84382085|gb|EAP97967.1| hypothetical protein JNB_13423 [Janibacter sp. HTCC2649]
          Length = 97

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/65 (44%), Positives = 43/65 (66%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            + ++R YQL+ S +   +CRY P+CS Y   A+ RYG++ G+WLTL RL +C+P  + G
Sbjct: 11  LVWLVRAYQLVVSPMRPATCRYFPSCSAYAVTALGRYGVFKGTWLTLRRLGRCHPWAAGG 70

Query: 119 FDPVP 123
            D VP
Sbjct: 71  VDHVP 75


>gi|149186357|ref|ZP_01864670.1| hypothetical protein ED21_22748 [Erythrobacter sp. SD-21]
 gi|148829946|gb|EDL48384.1| hypothetical protein ED21_22748 [Erythrobacter sp. SD-21]
          Length = 69

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 43/69 (62%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   I I R++QL  S +   +CR+ P+CS+Y  EA+ ++G   G WLTL RL++C P 
Sbjct: 1   MKYPLIWIARLWQLGPSRILPPTCRFTPSCSQYAIEALQKHGAIKGGWLTLKRLLRCQPW 60

Query: 115 GSDGFDPVP 123
           G  G DPVP
Sbjct: 61  GGCGHDPVP 69


>gi|299142115|ref|ZP_07035249.1| hypothetical protein HMPREF0665_01705 [Prevotella oris C735]
 gi|298576577|gb|EFI48449.1| hypothetical protein HMPREF0665_01705 [Prevotella oris C735]
          Length = 68

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 27/65 (41%), Positives = 39/65 (60%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            +  I  YQ + S     SCR+ PTCSEY  +A+ ++G   G  L + R+++CNP G  G
Sbjct: 4   LLLPILFYQHVISPFTPPSCRFTPTCSEYARQALMKHGPLKGLALAVWRILRCNPWGGSG 63

Query: 119 FDPVP 123
           +DPVP
Sbjct: 64  YDPVP 68


>gi|297158788|gb|ADI08500.1| hypothetical protein SBI_05380 [Streptomyces bingchenggensis BCW-1]
          Length = 105

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 42/74 (56%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   + +I++YQ   S + G  C+Y P+CS YGY AI R+G   G+ LT  R+++CNP 
Sbjct: 1   MKYPLLWLIKLYQWTISPMLGPVCKYYPSCSHYGYTAIDRHGAVKGTALTAWRILRCNPW 60

Query: 115 GSDGFDPVPDDLPP 128
              G D VP    P
Sbjct: 61  SLGGVDHVPPRKRP 74


>gi|94985666|ref|YP_605030.1| hypothetical protein Dgeo_1566 [Deinococcus geothermalis DSM 11300]
 gi|116256138|sp|Q1IY23|Y1566_DEIGD RecName: Full=UPF0161 protein Dgeo_1566
 gi|94555947|gb|ABF45861.1| protein of unknown function DUF37 [Deinococcus geothermalis DSM
           11300]
          Length = 93

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/83 (39%), Positives = 49/83 (59%), Gaps = 2/83 (2%)

Query: 59  GIGIIRIYQLIFSNVFG-NSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
            + +++ YQ   S      +CR+ PTCS+Y  EAI R+G   G+WL   R+++CNPL   
Sbjct: 8   LVRLVKSYQRHLSPRKPAPTCRFTPTCSQYAVEAIERHGALKGAWLAAWRVLRCNPLVPG 67

Query: 118 GFDPVPDDLPPKKN-NPKLLSKK 139
           G DPVP+  P  +  +PK  S+K
Sbjct: 68  GCDPVPEHFPSWRGPHPKTPSRK 90


>gi|166032895|ref|ZP_02235724.1| hypothetical protein DORFOR_02616 [Dorea formicigenerans ATCC
           27755]
 gi|166027252|gb|EDR46009.1| hypothetical protein DORFOR_02616 [Dorea formicigenerans ATCC
           27755]
          Length = 71

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFG-NSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           + + I +GIIR YQ   S   G +SC+Y PTCS Y  EAI +YG + G  L   R+++CN
Sbjct: 1   MMKKILLGIIRFYQKYLSGAKGYSSCKYYPTCSRYAIEAIEKYGAFKGGLLAAWRILRCN 60

Query: 113 PLGSDGFDPVP 123
           P    G+DPVP
Sbjct: 61  PFSKGGYDPVP 71


>gi|260753818|ref|YP_003226711.1| hypothetical protein Za10_1591 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|258553181|gb|ACV76127.1| protein of unknown function DUF37 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 70

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 31/65 (47%), Positives = 40/65 (61%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            I + R++Q   S +  +SCRY P+CS Y   A  RYG   GSWLT+ RL +C+P G  G
Sbjct: 6   LILLARLWQWGPSRLLPSSCRYYPSCSAYAITAWRRYGAIKGSWLTIKRLARCHPWGGCG 65

Query: 119 FDPVP 123
            DPVP
Sbjct: 66  HDPVP 70


>gi|218291091|ref|ZP_03495114.1| protein of unknown function DUF37 [Alicyclobacillus acidocaldarius
           LAA1]
 gi|218238976|gb|EED06183.1| protein of unknown function DUF37 [Alicyclobacillus acidocaldarius
           LAA1]
          Length = 72

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 31/70 (44%), Positives = 42/70 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I +IR YQ   S     +CR+ PTCSEY  +AIAR+G+  G WL + RL+KC P 
Sbjct: 1   MKRLVIALIRFYQRYISPAKLPTCRFTPTCSEYAIQAIARFGVVYGGWLAVRRLVKCGPW 60

Query: 115 GSDGFDPVPD 124
              G D VP+
Sbjct: 61  HPGGVDEVPE 70


>gi|160932431|ref|ZP_02079821.1| hypothetical protein CLOLEP_01266 [Clostridium leptum DSM 753]
 gi|156868390|gb|EDO61762.1| hypothetical protein CLOLEP_01266 [Clostridium leptum DSM 753]
          Length = 81

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 31/69 (44%), Positives = 41/69 (59%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   I +IR YQ   S +    C+Y PTCS YG +AI R+G   G  LTL R+++CNP 
Sbjct: 1   MKRPLIWLIRFYQRAISPLSRPCCKYYPTCSNYGLQAIERFGALKGGLLTLWRILRCNPF 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  SKGGYDPVP 69


>gi|318077327|ref|ZP_07984659.1| hypothetical protein SSA3_11555 [Streptomyces sp. SA3_actF]
          Length = 132

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 44/75 (58%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   + +I++YQ I S + G  C+Y P+CS YG+ AI R+G   G+ LT  R+++CNP 
Sbjct: 1   MKYPLLALIKLYQWIISPLLGPVCKYYPSCSHYGFTAIDRHGAIKGTALTAWRILRCNPW 60

Query: 115 GSDGFDPVPDDLPPK 129
              G D VP    P+
Sbjct: 61  SHGGVDHVPPRKRPR 75


>gi|317504617|ref|ZP_07962585.1| YidD family protein [Prevotella salivae DSM 15606]
 gi|315664266|gb|EFV03965.1| YidD family protein [Prevotella salivae DSM 15606]
          Length = 83

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 41/74 (55%)

Query: 50  FPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLI 109
           +   L     +  I  YQ + S     SCR+ PTCSEY  +A+ ++G   G  L + R++
Sbjct: 10  WLSRLVVGALLLPIYFYQHVISPCTPPSCRFTPTCSEYARQALIKHGPLKGLALAIWRIL 69

Query: 110 KCNPLGSDGFDPVP 123
           +CNP G  G+DPVP
Sbjct: 70  RCNPWGGSGYDPVP 83


>gi|71900823|ref|ZP_00682941.1| Protein of unknown function DUF37 [Xylella fastidiosa Ann-1]
 gi|182680840|ref|YP_001829000.1| hypothetical protein XfasM23_0275 [Xylella fastidiosa M23]
 gi|71729393|gb|EAO31506.1| Protein of unknown function DUF37 [Xylella fastidiosa Ann-1]
 gi|182630950|gb|ACB91726.1| protein of unknown function DUF37 [Xylella fastidiosa M23]
 gi|307579307|gb|ADN63276.1| hypothetical protein XFLM_06780 [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 87

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 45/74 (60%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            I +++IY+ + S + G  CR+ P+CSEY   AIAR+G   G WL   RL +C+PL   G
Sbjct: 4   LILLLKIYKRLISPLLGPHCRFEPSCSEYAMVAIARFGTLRGIWLAARRLARCHPLQLGG 63

Query: 119 FDPVPDDLPPKKNN 132
            DPVPD+   + N 
Sbjct: 64  HDPVPDNTSTQVNP 77


>gi|291521109|emb|CBK79402.1| conserved hypothetical protein TIGR00278 [Coprococcus catus GD/7]
          Length = 72

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 41/69 (59%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              I I +IR Y+   S +    C Y+PTCS+Y  EAI +YG   GS+L   R+++C+P 
Sbjct: 4   MSRILIAMIRFYRKYISPMKRGCCIYIPTCSQYAIEAIMKYGAVKGSYLAARRILRCHPF 63

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 64  AKGGYDPVP 72


>gi|257452993|ref|ZP_05618292.1| hypothetical protein F3_08039 [Fusobacterium sp. 3_1_5R]
 gi|257466626|ref|ZP_05630937.1| hypothetical protein FgonA2_04198 [Fusobacterium gonidiaformans
           ATCC 25563]
 gi|315917781|ref|ZP_07914021.1| ribonuclease P [Fusobacterium gonidiaformans ATCC 25563]
 gi|317059533|ref|ZP_07924018.1| ribonuclease P [Fusobacterium sp. 3_1_5R]
 gi|313685209|gb|EFS22044.1| ribonuclease P [Fusobacterium sp. 3_1_5R]
 gi|313691656|gb|EFS28491.1| ribonuclease P [Fusobacterium gonidiaformans ATCC 25563]
          Length = 69

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 42/69 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + +  IR YQ   S   G +CR+ PTCS+Y YEAI +YG   G +L + R+ KC+P 
Sbjct: 1   MKNMLLFSIRCYQKYISPYLGKNCRFYPTCSQYTYEAIQKYGCLKGIYLGIKRISKCHPF 60

Query: 115 GSDGFDPVP 123
              G+DP+P
Sbjct: 61  HPGGYDPLP 69


>gi|302531355|ref|ZP_07283697.1| UPF0161 protein [Streptomyces sp. AA4]
 gi|302440250|gb|EFL12066.1| UPF0161 protein [Streptomyces sp. AA4]
          Length = 108

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 44/86 (51%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
               + +  +R Y+   S     +CR+ P+CS Y  EA+ R+G   GS+L L RL++C P
Sbjct: 23  PVAWVLLLPVRFYRKAISPFLPPACRFYPSCSAYAVEALTRHGAARGSYLALRRLLRCGP 82

Query: 114 LGSDGFDPVPDDLPPKKNNPKLLSKK 139
               G DPVP+    +   P+   ++
Sbjct: 83  WTPPGRDPVPEKFSWRHRTPETPIEE 108


>gi|332983466|ref|YP_004464907.1| hypothetical protein Mahau_2965 [Mahella australiensis 50-1 BON]
 gi|332701144|gb|AEE98085.1| protein of unknown function DUF37 [Mahella australiensis 50-1 BON]
          Length = 69

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 43/69 (62%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I + IIR YQ   S +   SCR+ PTCS+Y YEAI++YG   G ++ + R++ CNP 
Sbjct: 1   MKYILMYIIRFYQGYISPLKRPSCRFYPTCSQYAYEAISKYGALKGGFMAIKRVLSCNPF 60

Query: 115 GSDGFDPVP 123
              G+DPV 
Sbjct: 61  NPGGYDPVK 69


>gi|118591259|ref|ZP_01548658.1| hypothetical protein SIAM614_16572 [Stappia aggregata IAM 12614]
 gi|118436335|gb|EAV42977.1| hypothetical protein SIAM614_16572 [Stappia aggregata IAM 12614]
          Length = 102

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 36/70 (51%), Positives = 49/70 (70%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            IG+I +Y+   S   G +CRY PTCS+Y  ++I R+G W G W+ L R+++CNP G+ G
Sbjct: 8   AIGLIWLYRHSLSLFMGRTCRYAPTCSDYTEQSIRRFGFWAGGWIGLSRVLRCNPWGASG 67

Query: 119 FDPVPDDLPP 128
           FDPVPD LPP
Sbjct: 68  FDPVPDTLPP 77


>gi|322390065|ref|ZP_08063600.1| alpha-hemolysin [Streptococcus parasanguinis ATCC 903]
 gi|321143192|gb|EFX38635.1| alpha-hemolysin [Streptococcus parasanguinis ATCC 903]
          Length = 80

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 30/77 (38%), Positives = 46/77 (59%), Gaps = 1/77 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I ++R YQ   S +F  SCR+ PTCS Y  +AI R+G+  G  + + R+++C+P 
Sbjct: 1   MKTILIALVRGYQKWISPLFPPSCRFQPTCSTYMIQAIERFGV-KGVLMGIARILRCHPG 59

Query: 115 GSDGFDPVPDDLPPKKN 131
              G DP+PD    K+N
Sbjct: 60  SQAGPDPLPDHFSLKRN 76


>gi|134103815|ref|YP_001109476.1| hypothetical protein SACE_7395 [Saccharopolyspora erythraea NRRL
           2338]
 gi|133916438|emb|CAM06551.1| hypothetical protein SACE_7395 [Saccharopolyspora erythraea NRRL
           2338]
          Length = 83

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 25/73 (34%), Positives = 39/73 (53%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
           + +  + +Y+ + S +   SCR+ P+CS Y  EA+  +G   G WLT  RL++C P    
Sbjct: 1   MLLVPVHVYRKVISPLLPPSCRFYPSCSAYAVEALTVHGALRGGWLTARRLLRCGPWHPG 60

Query: 118 GFDPVPDDLPPKK 130
           G DPVP      +
Sbjct: 61  GLDPVPPRRTSGR 73


>gi|51473546|ref|YP_067303.1| hypothetical protein RT0341 [Rickettsia typhi str. Wilmington]
 gi|81390154|sp|Q68X21|Y341_RICTY RecName: Full=UPF0161 protein RT0341
 gi|51459858|gb|AAU03821.1| conserved hypothetical protein [Rickettsia typhi str. Wilmington]
          Length = 82

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 43/82 (52%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              I +  I  Y+   S + GN+C + PTCSEY  EAI  +G+  G WLT  R+IKC P 
Sbjct: 1   MTKILLLTITFYKYFISPLLGNNCIFSPTCSEYAQEAIITHGIIKGLWLTFRRIIKCQPF 60

Query: 115 GSDGFDPVPDDLPPKKNNPKLL 136
              G+D VP  +   K   K +
Sbjct: 61  CIGGYDNVPTSIKNSKQPTKKI 82


>gi|326383906|ref|ZP_08205590.1| hypothetical protein SCNU_13273 [Gordonia neofelifaecis NRRL
           B-59395]
 gi|326197365|gb|EGD54555.1| hypothetical protein SCNU_13273 [Gordonia neofelifaecis NRRL
           B-59395]
          Length = 105

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 34/92 (36%), Positives = 47/92 (51%), Gaps = 2/92 (2%)

Query: 46  WNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTL 105
           WN  +   L R   I +I +Y+   S     +CR+ PTCS Y  EA+ R+G   GS L  
Sbjct: 4   WNQLYR--LPRTCLIFVIELYRTWISPTRMPTCRFEPTCSGYAVEALQRHGFVWGSVLAT 61

Query: 106 LRLIKCNPLGSDGFDPVPDDLPPKKNNPKLLS 137
            RL+KC P    G+DPVP+  P +    K  +
Sbjct: 62  WRLLKCGPWHKPGYDPVPELGPVEWLRSKTSN 93


>gi|254470045|ref|ZP_05083449.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
 gi|211960356|gb|EEA95552.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
          Length = 117

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 39/78 (50%), Positives = 51/78 (65%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
           P +L    GIG+I IYQ   S + G +CRY P+CS Y  EA+ R+G W G W+ L R+I+
Sbjct: 12  PASLMARFGIGLIWIYQHSLSLILGRACRYQPSCSHYTAEAMTRFGFWRGGWIGLSRIIR 71

Query: 111 CNPLGSDGFDPVPDDLPP 128
           CNP G+ G+DPVP  LP 
Sbjct: 72  CNPYGASGYDPVPLSLPK 89


>gi|241665034|ref|YP_002983394.1| hypothetical protein Rpic12D_3459 [Ralstonia pickettii 12D]
 gi|240867061|gb|ACS64722.1| protein of unknown function DUF37 [Ralstonia pickettii 12D]
          Length = 145

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 28/69 (40%), Positives = 43/69 (62%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              + + ++RIY++ FS   G  CR+LPTCS+Y  +A+  +G   GS+L   RL +C+P 
Sbjct: 1   MTRVLLILLRIYKVAFSPFVGAQCRFLPTCSDYARDAVLAHGPGYGSYLAAKRLCRCHPF 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  AQGGYDPVP 69


>gi|295108624|emb|CBL22577.1| conserved hypothetical protein TIGR00278 [Ruminococcus obeum
           A2-162]
          Length = 69

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 42/69 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I +IR+YQ   S +    C Y+PTCS+YG EAI +YG   G  L   R+++CNP 
Sbjct: 1   MKKLLIKLIRLYQKYISPMKRTKCPYIPTCSQYGLEAIEKYGALKGGLLAAWRILRCNPF 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  SHGGYDPVP 69


>gi|324999879|ref|ZP_08120991.1| hypothetical protein PseP1_13971 [Pseudonocardia sp. P1]
          Length = 139

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 40/70 (57%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
           P++LG    +G +R YQ+  S     SCR+ P+CS Y  EA+  +GL  G  LT  RL++
Sbjct: 31  PRSLGARAAVGAVRWYQVWISPNLMPSCRFHPSCSAYAVEALGVHGLIRGLGLTTWRLLR 90

Query: 111 CNPLGSDGFD 120
           C P    G+D
Sbjct: 91  CAPWHPGGWD 100


>gi|159042887|ref|YP_001531681.1| hypothetical protein Dshi_0331 [Dinoroseobacter shibae DFL 12]
 gi|189039852|sp|A8LMA3|Y331_DINSH RecName: Full=UPF0161 protein Dshi_0331
 gi|157910647|gb|ABV92080.1| protein of unknown function DUF37 [Dinoroseobacter shibae DFL 12]
          Length = 73

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 32/62 (51%), Positives = 42/62 (67%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           +R Y+LIFS   G +CRY PTCS Y  EA+ ++G   G WLTL R+++C+P G  G D V
Sbjct: 12  VRAYRLIFSPWVGFNCRYDPTCSAYAMEALRKHGGVKGGWLTLRRILRCHPWGGTGVDDV 71

Query: 123 PD 124
           PD
Sbjct: 72  PD 73


>gi|270158407|ref|ZP_06187064.1| conserved hypothetical protein [Legionella longbeachae D-4968]
 gi|289166754|ref|YP_003456892.1| hypothetical protein LLO_3449 [Legionella longbeachae NSW150]
 gi|269990432|gb|EEZ96686.1| conserved hypothetical protein [Legionella longbeachae D-4968]
 gi|288859927|emb|CBJ13913.1| putative conserved hypothetical protein [Legionella longbeachae
           NSW150]
          Length = 82

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 41/67 (61%)

Query: 56  RLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLG 115
           R I    I+IYQ + S +   SCRY P+CS+Y   AI + G+  G W+ L RL++C+P  
Sbjct: 9   RKIVCFPIKIYQFLISPLLKPSCRYYPSCSQYAESAIMQCGITKGVWMALKRLLRCHPWS 68

Query: 116 SDGFDPV 122
             G+DPV
Sbjct: 69  KGGYDPV 75


>gi|21909806|ref|NP_664074.1| hypothetical protein SpyM3_0270 [Streptococcus pyogenes MGAS315]
 gi|50913683|ref|YP_059655.1| hypothetical protein M6_Spy0337 [Streptococcus pyogenes MGAS10394]
 gi|56808586|ref|ZP_00366317.1| COG0759: Uncharacterized conserved protein [Streptococcus pyogenes
           M49 591]
 gi|71902966|ref|YP_279769.1| hypothetical protein M28_Spy0300 [Streptococcus pyogenes MGAS6180]
 gi|71910125|ref|YP_281675.1| hypothetical protein M5005_Spy_0311 [Streptococcus pyogenes
           MGAS5005]
 gi|94987941|ref|YP_596042.1| hypothetical protein MGAS9429_Spy0310 [Streptococcus pyogenes
           MGAS9429]
 gi|94989815|ref|YP_597915.1| hypothetical protein MGAS10270_Spy0306 [Streptococcus pyogenes
           MGAS10270]
 gi|94991825|ref|YP_599924.1| hypothetical protein MGAS2096_Spy0328 [Streptococcus pyogenes
           MGAS2096]
 gi|94993701|ref|YP_601799.1| hypothetical protein MGAS10750_Spy0305 [Streptococcus pyogenes
           MGAS10750]
 gi|306827949|ref|ZP_07461216.1| alpha-hemolysin [Streptococcus pyogenes ATCC 10782]
 gi|116256214|sp|Q48V42|Y300_STRPM RecName: Full=UPF0161 protein M28_Spy0300
 gi|116256217|sp|Q1J8A6|Y305_STRPF RecName: Full=UPF0161 protein MGAS10750_Spy0305
 gi|116256218|sp|Q1JIF2|Y306_STRPD RecName: Full=UPF0161 protein MGAS10270_Spy0306
 gi|116256219|sp|Q1JNA1|Y310_STRPC RecName: Full=UPF0161 protein MGAS9429_Spy0310
 gi|116256226|sp|Q1JDC8|Y328_STRPB RecName: Full=UPF0161 protein MGAS2096_Spy0328
 gi|21903992|gb|AAM78877.1| conserved hypothetical protein [Streptococcus pyogenes MGAS315]
 gi|50902757|gb|AAT86472.1| Hypothetical cytosolic protein [Streptococcus pyogenes MGAS10394]
 gi|71802061|gb|AAX71414.1| hypothetical cytosolic protein [Streptococcus pyogenes MGAS6180]
 gi|71852907|gb|AAZ50930.1| hypothetical cytosolic protein [Streptococcus pyogenes MGAS5005]
 gi|94541449|gb|ABF31498.1| hypothetical cytosolic protein [Streptococcus pyogenes MGAS9429]
 gi|94543323|gb|ABF33371.1| hypothetical cytosolic protein [Streptococcus pyogenes MGAS10270]
 gi|94545333|gb|ABF35380.1| hypothetical cytosolic protein [Streptococcus pyogenes MGAS2096]
 gi|94547209|gb|ABF37255.1| hypothetical cytosolic protein [Streptococcus pyogenes MGAS10750]
 gi|304429868|gb|EFM32910.1| alpha-hemolysin [Streptococcus pyogenes ATCC 10782]
          Length = 87

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 44/79 (55%), Gaps = 1/79 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + + I  ++ YQ   S +   SCRY PTCS Y   AI ++G   G  + + R+++C+P
Sbjct: 1   MMKKLLIVSVKAYQKYISPLSPPSCRYKPTCSAYMLTAIEKHGT-KGILMGIARILRCHP 59

Query: 114 LGSDGFDPVPDDLPPKKNN 132
             + G DPVP+D    +N 
Sbjct: 60  FVAGGVDPVPEDFSLMRNK 78


>gi|325663380|ref|ZP_08151830.1| hypothetical protein HMPREF0490_02571 [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|331086952|ref|ZP_08336028.1| hypothetical protein HMPREF0987_02331 [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|325470834|gb|EGC74064.1| hypothetical protein HMPREF0490_02571 [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|330409613|gb|EGG89052.1| hypothetical protein HMPREF0987_02331 [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 70

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 32/70 (45%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVF-GNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
            + I I +IR YQ   S +     C Y PTCS+YG EAI +YG   G  LT+ R+++CNP
Sbjct: 1   MKKIFIALIRFYQKYLSGLKRTTHCIYFPTCSQYGIEAIEKYGALKGGLLTIWRILRCNP 60

Query: 114 LGSDGFDPVP 123
               G+DPVP
Sbjct: 61  FAKGGYDPVP 70


>gi|260893980|ref|YP_003240077.1| protein of unknown function DUF37 [Ammonifex degensii KC4]
 gi|260866121|gb|ACX53227.1| protein of unknown function DUF37 [Ammonifex degensii KC4]
          Length = 69

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 42/69 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + +  I+ Y+   S      CR+ PTCS Y YEAIARYG W G+ L L R+++C+P 
Sbjct: 1   MKGLLLAAIKFYRTAISPCLPPRCRFYPTCSAYAYEAIARYGAWRGTVLALRRILRCHPF 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  NPGGYDPVP 69


>gi|300023296|ref|YP_003755907.1| hypothetical protein Hden_1783 [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299525117|gb|ADJ23586.1| protein of unknown function DUF37 [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 101

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 32/71 (45%), Positives = 44/71 (61%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + +    I +Y++ F  + G  CR+ PTCS+YG EAI   G W G WLTL R ++C P
Sbjct: 4   IAKALMKAPIHVYRVTFKPLVGGQCRHWPTCSQYGLEAIELNGAWRGFWLTLSRFLRCGP 63

Query: 114 LGSDGFDPVPD 124
            G+ G DPVPD
Sbjct: 64  GGTHGIDPVPD 74


>gi|315646298|ref|ZP_07899418.1| hypothetical protein PVOR_12855 [Paenibacillus vortex V453]
 gi|315278497|gb|EFU41813.1| hypothetical protein PVOR_12855 [Paenibacillus vortex V453]
          Length = 85

 Score = 98.0 bits (243), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 28/85 (32%), Positives = 42/85 (49%), Gaps = 3/85 (3%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R +    I  Y+   S +   +CR+ PTCS Y  EA+  +G   GSWL   R+ +C+P 
Sbjct: 4   ARRVVKVPIHFYRKFISPLKPATCRFYPTCSAYALEAVEVHGALKGSWLAAKRIARCHPF 63

Query: 115 GSDGFDPVPDDLPPKKNNPKLLSKK 139
              G D VP   P K  +   L+++
Sbjct: 64  NPGGIDMVP---PRKGESHSPLTEE 85


>gi|171911027|ref|ZP_02926497.1| hypothetical protein VspiD_07625 [Verrucomicrobium spinosum DSM
           4136]
          Length = 111

 Score = 98.0 bits (243), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 48/85 (56%), Gaps = 10/85 (11%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVF------GNSCRYLPTCSEYGYEAIARYGLWIGSWLT 104
            KT+ R+     IR YQ+  S V       G+ CR+ PTCS Y  +A+ R+G+  G W+ 
Sbjct: 1   MKTVIRI----AIRGYQIFISPVLHFVGGPGSGCRFEPTCSHYFLQAVERHGVMRGGWMG 56

Query: 105 LLRLIKCNPLGSDGFDPVPDDLPPK 129
           + R+ +CNP G  G DPVPD  P K
Sbjct: 57  IKRIGRCNPWGGSGHDPVPDLSPGK 81


>gi|294010746|ref|YP_003544206.1| hypothetical protein SJA_C1-07600 [Sphingobium japonicum UT26S]
 gi|292674076|dbj|BAI95594.1| conserved hypothetical protein [Sphingobium japonicum UT26S]
          Length = 70

 Score = 98.0 bits (243), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 32/67 (47%), Positives = 43/67 (64%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            I I + R +Q+  S +   SCRY P+CSEY  +AI +YG   GSWL   RL++C+P G 
Sbjct: 4   RILILVARFWQIGPSRILPPSCRYAPSCSEYAIQAIGKYGAVKGSWLATKRLMRCHPWGG 63

Query: 117 DGFDPVP 123
            G+DPVP
Sbjct: 64  SGYDPVP 70


>gi|258517432|ref|YP_003193654.1| hypothetical protein Dtox_4368 [Desulfotomaculum acetoxidans DSM
           771]
 gi|257781137|gb|ACV65031.1| protein of unknown function DUF37 [Desulfotomaculum acetoxidans DSM
           771]
          Length = 68

 Score = 98.0 bits (243), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 42/66 (63%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            + + +I IYQ   S +   +CR+ PTCS+Y  EAI ++G+  G  L ++R++KC+P   
Sbjct: 3   KLLVSLIIIYQRFISPLKMPTCRFYPTCSQYSIEAIQKFGVVKGVGLAVIRILKCHPFHP 62

Query: 117 DGFDPV 122
            G+DPV
Sbjct: 63  GGYDPV 68


>gi|153815420|ref|ZP_01968088.1| hypothetical protein RUMTOR_01655 [Ruminococcus torques ATCC 27756]
 gi|317500882|ref|ZP_07959094.1| ribonuclease P [Lachnospiraceae bacterium 8_1_57FAA]
 gi|145847279|gb|EDK24197.1| hypothetical protein RUMTOR_01655 [Ruminococcus torques ATCC 27756]
 gi|316897762|gb|EFV19821.1| ribonuclease P [Lachnospiraceae bacterium 8_1_57FAA]
          Length = 73

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 30/70 (42%), Positives = 46/70 (65%), Gaps = 1/70 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFG-NSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
            + + + +IR Y+   S + G ++C+Y PTCS+YG EAI +YG   G  LT+ R+++CNP
Sbjct: 4   MKQVMLWLIRFYRKYLSGMKGYSTCKYYPTCSQYGIEAIEKYGAVKGGALTVWRILRCNP 63

Query: 114 LGSDGFDPVP 123
               G+DPVP
Sbjct: 64  FSKGGYDPVP 73


>gi|116627196|ref|YP_819815.1| hypothetical protein STER_0310 [Streptococcus thermophilus LMD-9]
 gi|122268201|sp|Q03MF3|Y310_STRTD RecName: Full=UPF0161 protein STER_0310
 gi|116100473|gb|ABJ65619.1| Uncharacterized conserved protein [Streptococcus thermophilus
           LMD-9]
          Length = 82

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 29/83 (34%), Positives = 46/83 (55%), Gaps = 1/83 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   I +++ YQ   S +F  SCR+ PTCS Y  +AI ++G   G  + + R+++C+PL
Sbjct: 1   MKKFLIALVKAYQRWISPLFPLSCRFCPTCSVYMIQAIEKHG-LKGVLMGIARILRCHPL 59

Query: 115 GSDGFDPVPDDLPPKKNNPKLLS 137
              G DPVPD    K+    L +
Sbjct: 60  SETGDDPVPDYFSLKRKKTPLDN 82


>gi|325268529|ref|ZP_08135159.1| alpha-hemolysin [Prevotella multiformis DSM 16608]
 gi|324989057|gb|EGC21010.1| alpha-hemolysin [Prevotella multiformis DSM 16608]
          Length = 99

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 28/67 (41%), Positives = 41/67 (61%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            + I  I +Y+   S     SCR+ PTCSEY  +AI ++G + G  L + R+++CNP G 
Sbjct: 33  WLLILPILLYRQFISPFTPPSCRFTPTCSEYARQAILKHGPFKGLALAVWRILRCNPWGG 92

Query: 117 DGFDPVP 123
            G+DPVP
Sbjct: 93  SGYDPVP 99


>gi|33860968|ref|NP_892529.1| hypothetical protein PMM0411 [Prochlorococcus marinus subsp.
           pastoris str. CCMP1986]
 gi|47606122|sp|Q7V2R0|Y411_PROMP RecName: Full=UPF0161 protein PMM0411
 gi|33639700|emb|CAE18870.1| conserved hypothetical protein [Prochlorococcus marinus subsp.
           pastoris str. CCMP1986]
          Length = 78

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 38/67 (56%), Positives = 46/67 (68%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
           I + +I  YQ  FS  FG  CR++P+CS YGYEAI R+G W G WLTL RL +C+PL   
Sbjct: 12  ILLFMISCYQKWFSPFFGPRCRFIPSCSSYGYEAITRHGPWKGGWLTLRRLSRCHPLTPC 71

Query: 118 GFDPVPD 124
           G DPVPD
Sbjct: 72  GCDPVPD 78


>gi|15611058|ref|NP_218439.1| hypothetical protein Rv3922c [Mycobacterium tuberculosis H37Rv]
 gi|15843556|ref|NP_338593.1| hypothetical protein MT4040.1 [Mycobacterium tuberculosis CDC1551]
 gi|31795095|ref|NP_857588.1| hypothetical protein Mb3953c [Mycobacterium bovis AF2122/97]
 gi|121635908|ref|YP_976131.1| hypothetical protein BCG_0028c [Mycobacterium bovis BCG str.
           Pasteur 1173P2]
 gi|121639833|ref|YP_980057.1| hypothetical protein BCG_3980c [Mycobacterium bovis BCG str.
           Pasteur 1173P2]
 gi|148663789|ref|YP_001285312.1| hypothetical protein MRA_3961 [Mycobacterium tuberculosis H37Ra]
 gi|148825130|ref|YP_001289884.1| hypothetical protein TBFG_13957 [Mycobacterium tuberculosis F11]
 gi|167969460|ref|ZP_02551737.1| hypothetical protein MtubH3_16112 [Mycobacterium tuberculosis
           H37Ra]
 gi|215405980|ref|ZP_03418161.1| hypothetical protein Mtub0_20290 [Mycobacterium tuberculosis
           02_1987]
 gi|215413850|ref|ZP_03422515.1| hypothetical protein Mtub9_20927 [Mycobacterium tuberculosis
           94_M4241A]
 gi|215425184|ref|ZP_03423103.1| hypothetical protein MtubT9_01875 [Mycobacterium tuberculosis T92]
 gi|215432903|ref|ZP_03430822.1| hypothetical protein MtubE_20153 [Mycobacterium tuberculosis
           EAS054]
 gi|215448269|ref|ZP_03435021.1| hypothetical protein MtubT_20869 [Mycobacterium tuberculosis T85]
 gi|218755714|ref|ZP_03534510.1| hypothetical protein MtubG1_20784 [Mycobacterium tuberculosis GM
           1503]
 gi|219555769|ref|ZP_03534845.1| hypothetical protein MtubT1_00125 [Mycobacterium tuberculosis T17]
 gi|224992328|ref|YP_002647018.1| hypothetical protein JTY_3982 [Mycobacterium bovis BCG str. Tokyo
           172]
 gi|253800972|ref|YP_003033974.1| hemolysin [Mycobacterium tuberculosis KZN 1435]
 gi|254233404|ref|ZP_04926730.1| hypothetical protein TBCG_03849 [Mycobacterium tuberculosis C]
 gi|254366458|ref|ZP_04982502.1| hypothetical hemolysin [Mycobacterium tuberculosis str. Haarlem]
 gi|254548926|ref|ZP_05139373.1| hypothetical protein Mtube_00415 [Mycobacterium tuberculosis
           '98-R604 INH-RIF-EM']
 gi|260184851|ref|ZP_05762325.1| hypothetical protein MtubCP_02182 [Mycobacterium tuberculosis
           CPHL_A]
 gi|260198982|ref|ZP_05766473.1| hypothetical protein MtubT4_02259 [Mycobacterium tuberculosis T46]
 gi|260203135|ref|ZP_05770626.1| hypothetical protein MtubK8_02289 [Mycobacterium tuberculosis K85]
 gi|289441365|ref|ZP_06431109.1| hemolysin [Mycobacterium tuberculosis T46]
 gi|289445523|ref|ZP_06435267.1| hemolysin [Mycobacterium tuberculosis CPHL_A]
 gi|289556190|ref|ZP_06445400.1| hemolysin [Mycobacterium tuberculosis KZN 605]
 gi|289567879|ref|ZP_06448106.1| hemolysin [Mycobacterium tuberculosis T17]
 gi|289572574|ref|ZP_06452801.1| hemolysin [Mycobacterium tuberculosis K85]
 gi|289747766|ref|ZP_06507144.1| conserved hypothetical protein [Mycobacterium tuberculosis 02_1987]
 gi|289748460|ref|ZP_06507838.1| hemolysin [Mycobacterium tuberculosis T92]
 gi|289756057|ref|ZP_06515435.1| conserved hypothetical protein [Mycobacterium tuberculosis EAS054]
 gi|289760095|ref|ZP_06519473.1| conserved hypothetical protein [Mycobacterium tuberculosis T85]
 gi|289764113|ref|ZP_06523491.1| hemolysin [Mycobacterium tuberculosis GM 1503]
 gi|294995604|ref|ZP_06801295.1| hypothetical protein Mtub2_14142 [Mycobacterium tuberculosis 210]
 gi|297636609|ref|ZP_06954389.1| hypothetical protein MtubK4_20890 [Mycobacterium tuberculosis KZN
           4207]
 gi|297733604|ref|ZP_06962722.1| hypothetical protein MtubKR_21035 [Mycobacterium tuberculosis KZN
           R506]
 gi|298527394|ref|ZP_07014803.1| conserved hypothetical protein [Mycobacterium tuberculosis
           94_M4241A]
 gi|306795592|ref|ZP_07433894.1| hemolysin [Mycobacterium tuberculosis SUMu006]
 gi|307086724|ref|ZP_07495837.1| hemolysin [Mycobacterium tuberculosis SUMu012]
 gi|313660935|ref|ZP_07817815.1| hypothetical protein MtubKV_21030 [Mycobacterium tuberculosis KZN
           V2475]
 gi|54039954|sp|P67301|Y3953_MYCBO RecName: Full=UPF0161 protein Mb3953c
 gi|54042705|sp|P67300|Y3922_MYCTU RecName: Full=UPF0161 protein Rv3922c/MT4040.1
 gi|166229064|sp|A5U9Q0|Y3961_MYCTA RecName: Full=UPF0161 protein MRA_3961
 gi|254803831|sp|C1AJ62|Y3982_MYCBT RecName: Full=UPF0161 protein JTY_3982
 gi|2808707|emb|CAA16235.1| POSSIBLE HEMOLYSIN [Mycobacterium tuberculosis H37Rv]
 gi|13883934|gb|AAK48407.1| conserved hypothetical protein [Mycobacterium tuberculosis CDC1551]
 gi|31620693|emb|CAD96139.1| POSSIBLE HEMOLYSIN [Mycobacterium bovis AF2122/97]
 gi|121491555|emb|CAL70012.1| Possible hemolysin [Mycobacterium bovis BCG str. Pasteur 1173P2]
 gi|121495481|emb|CAL73970.1| Possible hemolysin [Mycobacterium bovis BCG str. Pasteur 1173P2]
 gi|124603197|gb|EAY61472.1| hypothetical protein TBCG_03849 [Mycobacterium tuberculosis C]
 gi|134151970|gb|EBA44015.1| hypothetical hemolysin [Mycobacterium tuberculosis str. Haarlem]
 gi|148507941|gb|ABQ75750.1| hypothetical protein MRA_3961 [Mycobacterium tuberculosis H37Ra]
 gi|148723657|gb|ABR08282.1| hypothetical hemolysin [Mycobacterium tuberculosis F11]
 gi|224775444|dbj|BAH28250.1| hypothetical protein JTY_3982 [Mycobacterium bovis BCG str. Tokyo
           172]
 gi|253322476|gb|ACT27079.1| hemolysin [Mycobacterium tuberculosis KZN 1435]
 gi|289414284|gb|EFD11524.1| hemolysin [Mycobacterium tuberculosis T46]
 gi|289418481|gb|EFD15682.1| hemolysin [Mycobacterium tuberculosis CPHL_A]
 gi|289440822|gb|EFD23315.1| hemolysin [Mycobacterium tuberculosis KZN 605]
 gi|289537005|gb|EFD41583.1| hemolysin [Mycobacterium tuberculosis K85]
 gi|289541632|gb|EFD45281.1| hemolysin [Mycobacterium tuberculosis T17]
 gi|289688294|gb|EFD55782.1| conserved hypothetical protein [Mycobacterium tuberculosis 02_1987]
 gi|289689047|gb|EFD56476.1| hemolysin [Mycobacterium tuberculosis T92]
 gi|289696644|gb|EFD64073.1| conserved hypothetical protein [Mycobacterium tuberculosis EAS054]
 gi|289711619|gb|EFD75635.1| hemolysin [Mycobacterium tuberculosis GM 1503]
 gi|289715659|gb|EFD79671.1| conserved hypothetical protein [Mycobacterium tuberculosis T85]
 gi|298497188|gb|EFI32482.1| conserved hypothetical protein [Mycobacterium tuberculosis
           94_M4241A]
 gi|308343888|gb|EFP32739.1| hemolysin [Mycobacterium tuberculosis SUMu006]
 gi|308363874|gb|EFP52725.1| hemolysin [Mycobacterium tuberculosis SUMu012]
 gi|323717338|gb|EGB26543.1| hemolysin [Mycobacterium tuberculosis CDC1551A]
 gi|326905755|gb|EGE52688.1| hemolysin [Mycobacterium tuberculosis W-148]
 gi|328460700|gb|AEB06123.1| hemolysin [Mycobacterium tuberculosis KZN 4207]
          Length = 120

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 36/92 (39%), Positives = 56/92 (60%), Gaps = 3/92 (3%)

Query: 43  SRNWNGKFPKTLGRLIG---IGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWI 99
           SR   G+  +  GR      I +I++Y+ + S +   SCR++PTCS+Y  +A+  YGL  
Sbjct: 4   SRQSCGRVVRVTGRASARGLIFVIQVYRHMLSPLRPASCRFVPTCSQYAVDALTEYGLLR 63

Query: 100 GSWLTLLRLIKCNPLGSDGFDPVPDDLPPKKN 131
           GSWLT++RL KC P    G+DP+P+ L   ++
Sbjct: 64  GSWLTMIRLAKCGPWHRGGWDPIPEGLTTGRS 95


>gi|331002962|ref|ZP_08326474.1| hypothetical protein HMPREF0491_01336 [Lachnospiraceae oral taxon
           107 str. F0167]
 gi|330413006|gb|EGG92381.1| hypothetical protein HMPREF0491_01336 [Lachnospiraceae oral taxon
           107 str. F0167]
          Length = 78

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 28/66 (42%), Positives = 42/66 (63%), Gaps = 1/66 (1%)

Query: 59  GIGIIRIYQLIFSNV-FGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
            I +IR YQ   S +     C Y PTCS+Y  EA+ ++G+  G+ L++ R+++CNPL   
Sbjct: 13  MIKLIRFYQKYLSPLKVRTHCIYSPTCSQYAIEALKKHGILKGTLLSIWRILRCNPLAKG 72

Query: 118 GFDPVP 123
           G+DPVP
Sbjct: 73  GYDPVP 78


>gi|261416141|ref|YP_003249824.1| protein of unknown function DUF37 [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|261372597|gb|ACX75342.1| protein of unknown function DUF37 [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|302326473|gb|ADL25674.1| conserved hypothetical protein TIGR00278 [Fibrobacter succinogenes
           subsp. succinogenes S85]
          Length = 83

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 41/78 (52%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           K       I  IR+YQL+    F   CR+ PTCS Y  EA+  +G   G +L + R+++C
Sbjct: 6   KNALVAALIAPIRLYQLVHPYFFHGVCRFQPTCSNYAIEALRLHGPIKGFYLAVFRVLRC 65

Query: 112 NPLGSDGFDPVPDDLPPK 129
           NP    G+DPVP     K
Sbjct: 66  NPFCKGGYDPVPLPKDKK 83


>gi|189464683|ref|ZP_03013468.1| hypothetical protein BACINT_01027 [Bacteroides intestinalis DSM
           17393]
 gi|189436957|gb|EDV05942.1| hypothetical protein BACINT_01027 [Bacteroides intestinalis DSM
           17393]
          Length = 73

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 40/61 (65%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           I  YQ   S +   SCR+ PTCS+Y  EAI ++G + G +L + R+++C+P G  G+DPV
Sbjct: 13  IYFYQKCISPLTSPSCRFTPTCSQYAVEAIKKHGPFKGLYLAIRRILRCHPWGGSGYDPV 72

Query: 123 P 123
           P
Sbjct: 73  P 73


>gi|225575687|ref|ZP_03784297.1| hypothetical protein RUMHYD_03780 [Blautia hydrogenotrophica DSM
           10507]
 gi|225037091|gb|EEG47337.1| hypothetical protein RUMHYD_03780 [Blautia hydrogenotrophica DSM
           10507]
          Length = 70

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 41/70 (58%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + +   I II+ YQ   S +    C Y P+CS+YG EAI +YG   G  L + R+++CNP
Sbjct: 1   MLKKFMIKIIKFYQKYLSPMKRTRCPYFPSCSQYGLEAIQKYGAIKGGLLAIWRILRCNP 60

Query: 114 LGSDGFDPVP 123
               G+DPVP
Sbjct: 61  FSKGGYDPVP 70


>gi|312864527|ref|ZP_07724758.1| conserved hypothetical protein YidD [Streptococcus downei F0415]
 gi|311099654|gb|EFQ57867.1| conserved hypothetical protein YidD [Streptococcus downei F0415]
          Length = 82

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I  +R+YQ + S +   SCRY P+CS Y  +AI ++GL  G  + + R+++C+P 
Sbjct: 1   MKKLLIAPVRLYQKLISPLTPASCRYQPSCSNYMIQAIEKHGLA-GVPMGIARILRCHPF 59

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G DPVPD    K+N+
Sbjct: 60  AQGGTDPVPDYFSLKQNH 77


>gi|307330014|ref|ZP_07609166.1| protein of unknown function DUF37 [Streptomyces violaceusniger Tu
           4113]
 gi|306884390|gb|EFN15424.1| protein of unknown function DUF37 [Streptomyces violaceusniger Tu
           4113]
          Length = 105

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 42/74 (56%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   + +I++YQ   S + G  C+Y P+CS YGY AI R+G   G+ LT  R+++CNP 
Sbjct: 1   MKYPLLWLIKLYQWTISPMLGPVCKYYPSCSHYGYTAIDRHGAVKGTALTAWRILRCNPW 60

Query: 115 GSDGFDPVPDDLPP 128
              G D VP    P
Sbjct: 61  SLGGVDHVPPRKRP 74


>gi|294056002|ref|YP_003549660.1| protein of unknown function DUF37 [Coraliomargarita akajimensis DSM
           45221]
 gi|293615335|gb|ADE55490.1| protein of unknown function DUF37 [Coraliomargarita akajimensis DSM
           45221]
          Length = 111

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 33/85 (38%), Positives = 52/85 (61%), Gaps = 7/85 (8%)

Query: 54  LGRLIGIGIIRIYQLIFSNV----FGNSC--RYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
           L R+   G +R YQL+ S +    FG SC  R+ PTCS Y  E++ +YG + G W+ L R
Sbjct: 17  LARVAAFG-VRGYQLLLSPLKYALFGPSCGCRFQPTCSCYARESLLKYGFFRGGWMALKR 75

Query: 108 LIKCNPLGSDGFDPVPDDLPPKKNN 132
           +++C+P    G+DPVPD    ++++
Sbjct: 76  ILRCHPWHPGGYDPVPDSTSREEDS 100


>gi|167766867|ref|ZP_02438920.1| hypothetical protein CLOSS21_01384 [Clostridium sp. SS2/1]
 gi|167711415|gb|EDS21994.1| hypothetical protein CLOSS21_01384 [Clostridium sp. SS2/1]
          Length = 80

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 32/77 (41%), Positives = 48/77 (62%), Gaps = 1/77 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGN-SCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
            + I I IIR Y+   S + G  +C Y+PTCSEY  EA+ ++G+  GS L + R+++CNP
Sbjct: 1   MKKILISIIRFYRKYLSRLKGRGTCIYVPTCSEYAIEALEKHGVVKGSLLAIFRILRCNP 60

Query: 114 LGSDGFDPVPDDLPPKK 130
               G+DPVP+    K+
Sbjct: 61  FSKGGYDPVPEVRKGKR 77


>gi|153811982|ref|ZP_01964650.1| hypothetical protein RUMOBE_02375 [Ruminococcus obeum ATCC 29174]
 gi|149831881|gb|EDM86967.1| hypothetical protein RUMOBE_02375 [Ruminococcus obeum ATCC 29174]
          Length = 69

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 44/69 (63%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I +IR+YQ+  S +    C Y+PTCS+YG EAI +YG   G  L + R+++CNP 
Sbjct: 1   MKKLLIKMIRLYQIYISPMKRTKCPYIPTCSQYGLEAIEKYGALKGGLLAVWRILRCNPF 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  SHGGYDPVP 69


>gi|108760227|ref|YP_635613.1| hypothetical protein MXAN_7510 [Myxococcus xanthus DK 1622]
 gi|116256261|sp|Q1CVG0|Y7510_MYXXD RecName: Full=UPF0161 protein MXAN_7510
 gi|108464107|gb|ABF89292.1| conserved hypothetical protein TIGR00278 [Myxococcus xanthus DK
           1622]
          Length = 72

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 36/61 (59%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           IR Y+     +    CR+ P+CS Y  EA+ ++G   GSWLTL RL++C P    G DPV
Sbjct: 12  IRFYRKFLGPLLPKVCRFHPSCSTYAMEALEKHGGLKGSWLTLWRLVRCQPFHPGGIDPV 71

Query: 123 P 123
           P
Sbjct: 72  P 72


>gi|289579533|ref|YP_003478160.1| hypothetical protein Thit_2405 [Thermoanaerobacter italicus Ab9]
 gi|289529246|gb|ADD03598.1| protein of unknown function DUF37 [Thermoanaerobacter italicus Ab9]
          Length = 69

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 28/69 (40%), Positives = 45/69 (65%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I +I++YQ   S +   SCR+ PTCS+Y  EAI++YGL  G  +++ R+++CNP 
Sbjct: 1   MKNVVIFLIKLYQRYISTMKPRSCRFYPTCSQYSIEAISKYGLLKGGIMSVWRILRCNPF 60

Query: 115 GSDGFDPVP 123
              G+DPV 
Sbjct: 61  NPGGYDPVK 69


>gi|227496608|ref|ZP_03926886.1| conserved hypothetical protein [Actinomyces urogenitalis DSM 15434]
 gi|226833888|gb|EEH66271.1| conserved hypothetical protein [Actinomyces urogenitalis DSM 15434]
          Length = 91

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 38/67 (56%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
           + +  +R YQ   S      CRY PTCS Y  EA+  +G+  G  LTL RL++CNPL   
Sbjct: 1   MFLAGVRFYQRWVSPALPRRCRYYPTCSAYAVEAVQVHGVVKGIVLTLWRLMRCNPLTRG 60

Query: 118 GFDPVPD 124
           G D VP+
Sbjct: 61  GVDHVPE 67


>gi|325265446|ref|ZP_08132169.1| alpha-hemolysin [Clostridium sp. D5]
 gi|324029304|gb|EGB90596.1| alpha-hemolysin [Clostridium sp. D5]
          Length = 73

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 33/72 (45%), Positives = 43/72 (59%), Gaps = 1/72 (1%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGN-SCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           T  + I I +IR YQ   S +     C Y PTCS+YG EAI +YG   G  LT+ R+++C
Sbjct: 2   TQMKHIFIWLIRFYQKYLSGLKTQYHCIYTPTCSQYGIEAIQKYGALKGGALTIWRILRC 61

Query: 112 NPLGSDGFDPVP 123
           NP    G+DPVP
Sbjct: 62  NPFAKGGYDPVP 73


>gi|291457890|ref|ZP_06597280.1| putative toxin-antitoxin system, toxin component [Oribacterium sp.
           oral taxon 078 str. F0262]
 gi|291419434|gb|EFE93153.1| putative toxin-antitoxin system, toxin component [Oribacterium sp.
           oral taxon 078 str. F0262]
          Length = 71

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 31/71 (43%), Positives = 45/71 (63%), Gaps = 1/71 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSC-RYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           + + + I +IR YQ   S + G+ C RY PTCS+Y  EAI +YG   G+ L + R+++CN
Sbjct: 1   MIKKMEIALIRFYQKYLSPIKGSCCCRYTPTCSQYAIEAIRKYGSVKGTLLAVWRILRCN 60

Query: 113 PLGSDGFDPVP 123
           P    G+DPVP
Sbjct: 61  PFAKGGYDPVP 71


>gi|115372269|ref|ZP_01459579.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|310825628|ref|YP_003957986.1| hypothetical protein STAUR_8405 [Stigmatella aurantiaca DW4/3-1]
 gi|115370734|gb|EAU69659.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|309398700|gb|ADO76159.1| conserved uncharacterized protein [Stigmatella aurantiaca DW4/3-1]
          Length = 72

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 23/71 (32%), Positives = 37/71 (52%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           +    +    IR Y+     +    CR+ P+CS Y  +A+ ++G   G+W    RL++C+
Sbjct: 2   SPLAFLLALPIRFYRRFLGPLLPKVCRFHPSCSSYAMQALEKHGGLKGAWFITWRLLRCH 61

Query: 113 PLGSDGFDPVP 123
           P    GFDPVP
Sbjct: 62  PFHPGGFDPVP 72


>gi|145221424|ref|YP_001132102.1| hypothetical protein Mflv_0830 [Mycobacterium gilvum PYR-GCK]
 gi|315446824|ref|YP_004079703.1| hypothetical protein Mspyr1_53440 [Mycobacterium sp. Spyr1]
 gi|145213910|gb|ABP43314.1| protein of unknown function DUF37 [Mycobacterium gilvum PYR-GCK]
 gi|315265127|gb|ADU01869.1| conserved hypothetical protein TIGR00278 [Mycobacterium sp. Spyr1]
          Length = 115

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 26/73 (35%), Positives = 46/73 (63%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           ++      + +I++Y+   S +   +CR+ PTCS+Y  +A+  +G + GSWL L+RL+KC
Sbjct: 4   RSAVVRAVVYVIQLYRHTISPLRLPTCRFTPTCSQYAVDALTEFGFFRGSWLALIRLLKC 63

Query: 112 NPLGSDGFDPVPD 124
            P    G+DP+P+
Sbjct: 64  GPWHRGGWDPIPE 76


>gi|148556518|ref|YP_001264100.1| hypothetical protein Swit_3616 [Sphingomonas wittichii RW1]
 gi|166232614|sp|A5VCE6|Y3616_SPHWW RecName: Full=UPF0161 protein Swit_3616
 gi|148501708|gb|ABQ69962.1| protein of unknown function DUF37 [Sphingomonas wittichii RW1]
          Length = 70

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 34/70 (48%), Positives = 46/70 (65%), Gaps = 1/70 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           +GRLI I + R +Q+  S V   +CRY+P+CS Y  EA++RYG   G WL   R+ +C+P
Sbjct: 2   IGRLI-ILLARAWQMGPSLVLPPTCRYVPSCSAYTIEAVSRYGALKGGWLGFRRICRCHP 60

Query: 114 LGSDGFDPVP 123
            G  GFDPVP
Sbjct: 61  WGGSGFDPVP 70


>gi|298246126|ref|ZP_06969932.1| protein of unknown function DUF37 [Ktedonobacter racemifer DSM
           44963]
 gi|297553607|gb|EFH87472.1| protein of unknown function DUF37 [Ktedonobacter racemifer DSM
           44963]
          Length = 76

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 36/76 (47%), Positives = 49/76 (64%), Gaps = 1/76 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I +G+IR+YQ   S V   SCR+ P+CS+YGYEAI R+G + G WLT  R+ +C P 
Sbjct: 1   MKYIALGLIRLYQRTLSVVMPPSCRFTPSCSQYGYEAIDRFGFFRGGWLTAKRIGRCQPF 60

Query: 115 -GSDGFDPVPDDLPPK 129
              D +DPVP+  P K
Sbjct: 61  YHGDSYDPVPETWPGK 76


>gi|300705598|ref|YP_003747201.1| hypothetical protein RCFBP_21449 [Ralstonia solanacearum CFBP2957]
 gi|299073262|emb|CBJ44621.1| conserved protein of unknown function [Ralstonia solanacearum
           CFBP2957]
          Length = 104

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 27/69 (39%), Positives = 43/69 (62%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              + + ++R+Y++ FS   G  CR+LPTCS+Y  +A+  +G   GS+L   RL +C+P 
Sbjct: 1   MTRVLLFLLRVYKVAFSPFVGAQCRFLPTCSDYARDAVLTHGPARGSYLAAKRLCRCHPF 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  AQGGYDPVP 69


>gi|167759574|ref|ZP_02431701.1| hypothetical protein CLOSCI_01931 [Clostridium scindens ATCC 35704]
 gi|167662801|gb|EDS06931.1| hypothetical protein CLOSCI_01931 [Clostridium scindens ATCC 35704]
          Length = 70

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 44/70 (62%), Gaps = 1/70 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFG-NSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
            + I +G+IR YQ   S +   ++C Y PTCS+Y  EAI +YG + G  + + R+++CNP
Sbjct: 1   MKKIMLGLIRFYQKYLSGLKSYSTCIYFPTCSQYAVEAIEKYGAFKGGLMAVWRILRCNP 60

Query: 114 LGSDGFDPVP 123
               G+DPVP
Sbjct: 61  FAKGGYDPVP 70


>gi|218258722|ref|ZP_03475031.1| hypothetical protein PRABACTJOHN_00686 [Parabacteroides johnsonii
           DSM 18315]
 gi|218225248|gb|EEC97898.1| hypothetical protein PRABACTJOHN_00686 [Parabacteroides johnsonii
           DSM 18315]
          Length = 74

 Score = 97.7 bits (242), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 42/72 (58%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           K     + +  +  Y+   S +   SCRY PTCSEY  +A+ ++G   G +L + R+++C
Sbjct: 3   KRFVTSLLLLPVYFYKYCISPMTPASCRYTPTCSEYAVQALKKHGPIKGLYLAVKRILRC 62

Query: 112 NPLGSDGFDPVP 123
           +P G  G+DPVP
Sbjct: 63  HPWGGSGYDPVP 74


>gi|297545655|ref|YP_003677957.1| hypothetical protein Tmath_2285 [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
 gi|296843430|gb|ADH61946.1| protein of unknown function DUF37 [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
          Length = 69

 Score = 97.7 bits (242), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 28/69 (40%), Positives = 45/69 (65%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I +I++YQ   S +   SCR+ PTCS+Y  EAI++YGL  G  +++ R+++CNP 
Sbjct: 1   MKNVIIFLIKLYQRYISTMKPRSCRFYPTCSQYSIEAISKYGLLKGGIMSVWRILRCNPF 60

Query: 115 GSDGFDPVP 123
              G+DPV 
Sbjct: 61  NPGGYDPVK 69


>gi|198282182|ref|YP_002218503.1| hypothetical protein Lferr_0034 [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218666389|ref|YP_002424547.1| conserved hypothetical protein TIGR00278 [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|198246703|gb|ACH82296.1| protein of unknown function DUF37 [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218518602|gb|ACK79188.1| conserved hypothetical protein TIGR00278 [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 71

 Score = 97.7 bits (242), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 30/58 (51%), Positives = 40/58 (68%)

Query: 66  YQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVP 123
           YQ I S + G++CR+ PTCSEY  +AI RYG+  GSWL + R+ +C+P    G DPVP
Sbjct: 14  YQYIISPMLGHNCRFFPTCSEYTCQAIERYGIAKGSWLGIKRISRCHPWHPGGVDPVP 71


>gi|255263680|ref|ZP_05343022.1| conserved domain protein [Thalassiobium sp. R2A62]
 gi|255106015|gb|EET48689.1| conserved domain protein [Thalassiobium sp. R2A62]
          Length = 73

 Score = 97.7 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 33/72 (45%), Positives = 45/72 (62%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           T    I    +R Y+L+FS   G+SCRY PTCS Y  EA A++G   G++LT+ R+ +C+
Sbjct: 2   TPLAYILSLPVRGYRLVFSPWVGHSCRYQPTCSAYSLEAYAKHGGIKGTYLTIRRIARCH 61

Query: 113 PLGSDGFDPVPD 124
           P G  G D VPD
Sbjct: 62  PWGGHGIDDVPD 73


>gi|313672990|ref|YP_004051101.1| hypothetical protein Calni_1027 [Calditerrivibrio nitroreducens DSM
           19672]
 gi|312939746|gb|ADR18938.1| protein of unknown function DUF37 [Calditerrivibrio nitroreducens
           DSM 19672]
          Length = 75

 Score = 97.7 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 38/62 (61%)

Query: 62  IIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDP 121
           +I  YQ+  S   GN+CR+ P+CS Y  EAI + G++ G  L++ R+++CNP    G D 
Sbjct: 14  MINFYQMAISPFLGNNCRFYPSCSAYAKEAIEKKGVFKGILLSIWRILRCNPFNKGGIDH 73

Query: 122 VP 123
           V 
Sbjct: 74  VK 75


>gi|167748060|ref|ZP_02420187.1| hypothetical protein ANACAC_02804 [Anaerostipes caccae DSM 14662]
 gi|317472415|ref|ZP_07931740.1| hypothetical protein HMPREF1011_02090 [Anaerostipes sp. 3_2_56FAA]
 gi|167652052|gb|EDR96181.1| hypothetical protein ANACAC_02804 [Anaerostipes caccae DSM 14662]
 gi|316900135|gb|EFV22124.1| hypothetical protein HMPREF1011_02090 [Anaerostipes sp. 3_2_56FAA]
          Length = 80

 Score = 97.7 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 30/80 (37%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFG-NSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
            + I I +I+ Y+   S + G  +C Y PTCSEY  EA+ ++G   GS L + R+++CNP
Sbjct: 1   MKKILIYLIQFYRAHLSKLKGKGTCIYTPTCSEYAVEALEKHGALKGSLLAVFRILRCNP 60

Query: 114 LGSDGFDPVPDDLPPKKNNP 133
               G+DPVP+    K    
Sbjct: 61  FAKGGYDPVPEVRKVKGKKK 80


>gi|320536045|ref|ZP_08036103.1| conserved hypothetical protein YidD [Treponema phagedenis F0421]
 gi|320147095|gb|EFW38653.1| conserved hypothetical protein YidD [Treponema phagedenis F0421]
          Length = 76

 Score = 97.7 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 27/63 (42%), Positives = 41/63 (65%)

Query: 61  GIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFD 120
           G+I+ YQ   S +F  +CRY PTC  Y  E+I +YG + G +L + R+++C+P    G+D
Sbjct: 14  GVIKFYQKAISPLFPPTCRYYPTCYAYALESIKKYGPFKGVFLAIKRILRCHPFHKGGYD 73

Query: 121 PVP 123
           PVP
Sbjct: 74  PVP 76


>gi|167770831|ref|ZP_02442884.1| hypothetical protein ANACOL_02184 [Anaerotruncus colihominis DSM
           17241]
 gi|167666871|gb|EDS11001.1| hypothetical protein ANACOL_02184 [Anaerotruncus colihominis DSM
           17241]
          Length = 82

 Score = 97.7 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 30/76 (39%), Positives = 44/76 (57%), Gaps = 1/76 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNS-CRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
            +   +  IR Y+   S +  +S CR+ PTCSEY   AI+R+G   G WL + R++KC+P
Sbjct: 1   MKAFLLAAIRFYRRYLSPLKPHSTCRFYPTCSEYALTAISRFGALRGGWLAVKRILKCHP 60

Query: 114 LGSDGFDPVPDDLPPK 129
               G D VP+ LP +
Sbjct: 61  FHPGGIDHVPEKLPRR 76


>gi|325282307|ref|YP_004254848.1| hypothetical protein Deipr_0055 [Deinococcus proteolyticus MRP]
 gi|324314116|gb|ADY25231.1| UPF0161 protein yidD [Deinococcus proteolyticus MRP]
          Length = 91

 Score = 97.7 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 29/71 (40%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 58  IGIGIIRIYQLIFSNVFG-NSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
           + I  +R YQ   S      +CR+ PTCS Y   A+ R+G   G WL   R  +CNPL  
Sbjct: 18  LLIRAVRWYQREVSPRKPAPTCRFSPTCSGYAVTALQRHGAVKGGWLAFWRFFRCNPLFP 77

Query: 117 DGFDPVPDDLP 127
            G DPVP+  P
Sbjct: 78  GGHDPVPEQWP 88


>gi|260904984|ref|ZP_05913306.1| hypothetical protein BlinB_06608 [Brevibacterium linens BL2]
          Length = 117

 Score = 97.7 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 27/69 (39%), Positives = 39/69 (56%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R+  +  IR Y+ + S ++G  CRY P+CS YG EA   +G+     LT  R+++CNP 
Sbjct: 32  PRMPFVWFIRAYRTVVSPMYGQVCRYYPSCSMYGLEAFEIHGVLKAMVLTGWRILRCNPF 91

Query: 115 GSDGFDPVP 123
              G D VP
Sbjct: 92  SHGGVDHVP 100


>gi|317123173|ref|YP_004103176.1| hypothetical protein Tmar_2372 [Thermaerobacter marianensis DSM
           12885]
 gi|315593153|gb|ADU52449.1| protein of unknown function DUF37 [Thermaerobacter marianensis DSM
           12885]
          Length = 70

 Score = 97.7 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 30/64 (46%), Positives = 41/64 (64%)

Query: 60  IGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGF 119
           +  +R+Y+   S +   SCRY PTCS Y  EA+ARYG W G WL + R+++C+P    G 
Sbjct: 7   LAALRLYRQWISPLKPPSCRYSPTCSAYAMEAVARYGPWRGGWLAVRRILRCHPWARGGH 66

Query: 120 DPVP 123
           DPVP
Sbjct: 67  DPVP 70


>gi|331089216|ref|ZP_08338118.1| hypothetical protein HMPREF1025_01701 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|330405768|gb|EGG85297.1| hypothetical protein HMPREF1025_01701 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 70

 Score = 97.7 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 30/70 (42%), Positives = 46/70 (65%), Gaps = 1/70 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFG-NSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
            + + + +IR Y+   S + G ++C+Y PTCS+YG EAI +YG   G  LT+ R+++CNP
Sbjct: 1   MKQVMLWLIRFYRKYLSGMKGYSTCKYYPTCSQYGIEAIEKYGAVKGGALTVWRILRCNP 60

Query: 114 LGSDGFDPVP 123
               G+DPVP
Sbjct: 61  FSKGGYDPVP 70


>gi|325478808|gb|EGC81918.1| YidD family protein [Anaerococcus prevotii ACS-065-V-Col13]
          Length = 71

 Score = 97.7 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 41/70 (58%), Gaps = 1/70 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFG-NSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           +   I I +IR YQ   S   G + C+Y PTCS+Y  EA  +YG +    ++L R+++CN
Sbjct: 1   MLNKIFIKMIRFYQRFISPQLGYSKCKYYPTCSQYALEAFNKYGFFKAFSMSLWRILRCN 60

Query: 113 PLGSDGFDPV 122
           P    G+DPV
Sbjct: 61  PFSKGGYDPV 70


>gi|315088012|gb|EFT59988.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL072PA1]
          Length = 167

 Score = 97.7 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 26/89 (29%), Positives = 51/89 (57%), Gaps = 5/89 (5%)

Query: 40  TPKSRNWNGKFPKTLGRL-----IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIAR 94
             +  N +G    T+ R      + IG ++ ++ + S ++G+ C+Y P+CS YG  A+  
Sbjct: 16  PSRHPNDDGGVWATMRRFRPLTWLAIGFVKGWRALISPLYGDVCKYQPSCSTYGLRALQV 75

Query: 95  YGLWIGSWLTLLRLIKCNPLGSDGFDPVP 123
           +G++  + + + R+++CNP    G+DPVP
Sbjct: 76  HGVFRATPMIIWRILRCNPWSHGGYDPVP 104


>gi|163745586|ref|ZP_02152946.1| hypothetical protein OIHEL45_08345 [Oceanibulbus indolifex HEL-45]
 gi|161382404|gb|EDQ06813.1| hypothetical protein OIHEL45_08345 [Oceanibulbus indolifex HEL-45]
          Length = 73

 Score = 97.7 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 30/72 (41%), Positives = 41/72 (56%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           T    +    +R Y+L+FS   G +CRY PTCS Y  EA+ ++G   G WL   R+ +C+
Sbjct: 2   TPFATLLALPVRGYRLLFSPWVGYNCRYQPTCSAYALEALQKHGGLRGGWLAARRIARCH 61

Query: 113 PLGSDGFDPVPD 124
           P G  G D VPD
Sbjct: 62  PWGRSGIDNVPD 73


>gi|332672291|ref|YP_004455299.1| hypothetical protein Celf_3808 [Cellulomonas fimi ATCC 484]
 gi|332341329|gb|AEE47912.1| protein of unknown function DUF37 [Cellulomonas fimi ATCC 484]
          Length = 103

 Score = 97.7 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 27/69 (39%), Positives = 39/69 (56%)

Query: 65  IYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVPD 124
           IYQ   S +   +CR+ P+CS+Y   A+ R+GL  GSWL   RL++C+P    G D VP 
Sbjct: 24  IYQRFISPMTPPTCRFYPSCSQYAVVAVTRHGLLRGSWLAARRLLRCHPWNPGGVDDVPP 83

Query: 125 DLPPKKNNP 133
                ++ P
Sbjct: 84  ARASHRHGP 92


>gi|322387121|ref|ZP_08060732.1| alpha-hemolysin family protein [Streptococcus infantis ATCC 700779]
 gi|321142108|gb|EFX37602.1| alpha-hemolysin family protein [Streptococcus infantis ATCC 700779]
          Length = 70

 Score = 97.7 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 29/71 (40%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           +R YQ   S  F  SCR+ PTCS Y  +AI ++G   G  + L R+++C+P    G DPV
Sbjct: 1   MRFYQRFISPAFPPSCRFEPTCSNYMIQAIEKHG-LKGVLMGLARILRCHPWSKIGKDPV 59

Query: 123 PDDLPPKKNNP 133
           PD    K+N+ 
Sbjct: 60  PDHFSLKRNSK 70


>gi|110678774|ref|YP_681781.1| hypothetical protein RD1_1458 [Roseobacter denitrificans OCh 114]
 gi|116256136|sp|Q16A98|Y1458_ROSDO RecName: Full=UPF0161 protein RD1_1458
 gi|109454890|gb|ABG31095.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114]
          Length = 78

 Score = 97.7 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 46/62 (74%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           +R Y+LIFS   G +CRY PTCS Y  EA+ ++G  IG+WLTL R+++C+P G  G+DPV
Sbjct: 12  VRAYRLIFSPWVGYNCRYQPTCSAYALEALQKHGGLIGAWLTLRRILRCHPWGKCGYDPV 71

Query: 123 PD 124
           P+
Sbjct: 72  PE 73


>gi|240145745|ref|ZP_04744346.1| putative toxin-antitoxin system, toxin component [Roseburia
           intestinalis L1-82]
 gi|257202161|gb|EEV00446.1| putative toxin-antitoxin system, toxin component [Roseburia
           intestinalis L1-82]
          Length = 78

 Score = 97.7 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 41/70 (58%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + I I +I+ Y+   S +    C Y PTCS YG EA+ +YG   G  L L R+++CNP
Sbjct: 9   ILKKILIALIKFYRKYLSPMKTTKCPYCPTCSLYGLEAVEKYGALKGGALALWRILRCNP 68

Query: 114 LGSDGFDPVP 123
               G+DPVP
Sbjct: 69  FSKGGYDPVP 78


>gi|15807144|ref|NP_295873.1| hypothetical protein DR_2150 [Deinococcus radiodurans R1]
 gi|14286082|sp|Q9RSH4|Y2150_DEIRA RecName: Full=UPF0161 protein DR_2150
 gi|6459948|gb|AAF11698.1|AE002049_3 conserved hypothetical protein [Deinococcus radiodurans R1]
          Length = 96

 Score = 97.7 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 32/77 (41%), Positives = 46/77 (59%), Gaps = 1/77 (1%)

Query: 59  GIGIIRIYQLIFSNVFG-NSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
            +  +R YQ + S      +CR+ PTCSEY  +A+ R+G   G WL L R+++CNPL   
Sbjct: 6   LVRAVRWYQRVLSPRKPAPTCRFSPTCSEYAAQALDRHGALKGGWLALWRVLRCNPLVPG 65

Query: 118 GFDPVPDDLPPKKNNPK 134
           GFDPVP+  P +   P+
Sbjct: 66  GFDPVPEHFPARHPRPQ 82


>gi|148261131|ref|YP_001235258.1| hypothetical protein Acry_2140 [Acidiphilium cryptum JF-5]
 gi|326404532|ref|YP_004284614.1| hypothetical protein ACMV_23850 [Acidiphilium multivorum AIU301]
 gi|166227667|sp|A5G0F7|Y2140_ACICJ RecName: Full=UPF0161 protein Acry_2140
 gi|146402812|gb|ABQ31339.1| protein of unknown function DUF37 [Acidiphilium cryptum JF-5]
 gi|325051394|dbj|BAJ81732.1| hypothetical protein ACMV_23850 [Acidiphilium multivorum AIU301]
          Length = 84

 Score = 97.7 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 40/67 (59%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            +  G +R YQL  S+V G  CR+ P+CS Y  EA+A +G   GS L   R+++C+P   
Sbjct: 6   KLLRGGVRAYQLTLSSVLGGQCRFYPSCSAYAMEALAVHGALHGSALAARRILRCHPWNP 65

Query: 117 DGFDPVP 123
            G DPVP
Sbjct: 66  GGVDPVP 72


>gi|315105160|gb|EFT77136.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL050PA2]
          Length = 167

 Score = 97.7 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 26/89 (29%), Positives = 51/89 (57%), Gaps = 5/89 (5%)

Query: 40  TPKSRNWNGKFPKTLGRL-----IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIAR 94
             +  N +G    T+ R      + IG ++ ++ + S ++G+ C+Y P+CS YG  A+  
Sbjct: 16  PSRHPNDDGGVWATVRRFRPLTWLAIGFVKGWRALISPLYGDVCKYQPSCSTYGLRALQV 75

Query: 95  YGLWIGSWLTLLRLIKCNPLGSDGFDPVP 123
           +G++  + + + R+++CNP    G+DPVP
Sbjct: 76  HGVFRATPMIIWRILRCNPWSHGGYDPVP 104


>gi|284047383|ref|YP_003397723.1| hypothetical protein Cwoe_5948 [Conexibacter woesei DSM 14684]
 gi|283951604|gb|ADB54348.1| protein of unknown function DUF37 [Conexibacter woesei DSM 14684]
          Length = 87

 Score = 97.3 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 29/73 (39%), Positives = 38/73 (52%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           T  R + I  IR YQ   S      C+Y PTCS Y  +++  YG+  G  L   RL++CN
Sbjct: 2   TFLRRVAIAPIRFYQRFVSPGLPRRCKYEPTCSRYAAQSVQEYGILRGLVLAGWRLMRCN 61

Query: 113 PLGSDGFDPVPDD 125
           P    G+DPV D 
Sbjct: 62  PWSHGGYDPVHDQ 74


>gi|314965758|gb|EFT09857.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL082PA2]
 gi|315091206|gb|EFT63182.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL110PA4]
          Length = 167

 Score = 97.3 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 26/89 (29%), Positives = 51/89 (57%), Gaps = 5/89 (5%)

Query: 40  TPKSRNWNGKFPKTLGRL-----IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIAR 94
             +  N +G    T+ R      + IG ++ ++ + S ++G+ C+Y P+CS YG  A+  
Sbjct: 16  PSRHPNDDGGVWATVRRFRPLTWLAIGFVKGWRALISPLYGDVCKYQPSCSTYGLRALQV 75

Query: 95  YGLWIGSWLTLLRLIKCNPLGSDGFDPVP 123
           +G++  + + + R+++CNP    G+DPVP
Sbjct: 76  HGVFRATPMIIWRILRCNPWSHGGYDPVP 104


>gi|239624139|ref|ZP_04667170.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239520525|gb|EEQ60391.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 70

 Score = 97.3 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 27/70 (38%), Positives = 39/70 (55%), Gaps = 1/70 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNV-FGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
                I ++R YQ   S +     C Y PTCS+Y  EA+ +YG   G+WL   R+++C+P
Sbjct: 1   MTRFLILLVRGYQRFLSPLKLRTHCIYTPTCSQYAIEALKKYGALKGTWLACKRILRCHP 60

Query: 114 LGSDGFDPVP 123
               G+DPVP
Sbjct: 61  FAEGGYDPVP 70


>gi|332521573|ref|ZP_08398026.1| protein of unknown function DUF37 [Lacinutrix algicola 5H-3-7-4]
 gi|332042662|gb|EGI78862.1| protein of unknown function DUF37 [Lacinutrix algicola 5H-3-7-4]
          Length = 73

 Score = 97.3 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 43/73 (58%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            K +     + II++YQ   S     +CRY PTCS+Y  EA+ ++G   G  L++ R++ 
Sbjct: 1   MKKIAIAPFLFIIKVYQTFISPFTPATCRYQPTCSQYTKEALTKHGFLKGMKLSINRILS 60

Query: 111 CNPLGSDGFDPVP 123
           C+P G  G+DPVP
Sbjct: 61  CHPWGGKGYDPVP 73


>gi|225386357|ref|ZP_03756121.1| hypothetical protein CLOSTASPAR_00101 [Clostridium asparagiforme
           DSM 15981]
 gi|225047539|gb|EEG57785.1| hypothetical protein CLOSTASPAR_00101 [Clostridium asparagiforme
           DSM 15981]
          Length = 71

 Score = 97.3 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 27/71 (38%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNV-FGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           +   + I ++R+YQ   S +     C Y PTCS+Y  EA+ +YG   G+WL   R+++C+
Sbjct: 1   MVAKLLIFLVRVYQKYLSPLKIRTHCIYTPTCSQYAVEALQKYGALKGTWLACKRILRCH 60

Query: 113 PLGSDGFDPVP 123
           P    G+DPVP
Sbjct: 61  PFAEGGYDPVP 71


>gi|313765029|gb|EFS36393.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL013PA1]
          Length = 167

 Score = 97.3 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 26/89 (29%), Positives = 51/89 (57%), Gaps = 5/89 (5%)

Query: 40  TPKSRNWNGKFPKTLGRL-----IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIAR 94
             +  N +G    T+ R      + IG ++ ++ + S ++G+ C+Y P+CS YG  A+  
Sbjct: 16  PSRHPNDDGGVWATVRRFRPLTWLAIGFVKGWRALISPLYGDVCKYQPSCSTYGLRALQV 75

Query: 95  YGLWIGSWLTLLRLIKCNPLGSDGFDPVP 123
           +G++  + + + R+++CNP    G+DPVP
Sbjct: 76  HGVFRATPMIIWRILRCNPWSHGGYDPVP 104


>gi|300692996|ref|YP_003753991.1| hypothetical protein RPSI07_3383 [Ralstonia solanacearum PSI07]
 gi|299080056|emb|CBJ52731.1| conserved protein of unknown function [Ralstonia solanacearum
           PSI07]
          Length = 104

 Score = 97.3 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 27/69 (39%), Positives = 44/69 (63%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              + + ++R+Y++ FS   G  CR+LPTCS+Y  +A+  +G  +GS+L   RL +C+P 
Sbjct: 1   MTRVLLFLLRVYKVAFSPFVGAQCRFLPTCSDYARDAVLTHGPALGSYLAAKRLCRCHPF 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  AQGGYDPVP 69


>gi|261368847|ref|ZP_05981730.1| alpha-hemolysin [Subdoligranulum variabile DSM 15176]
 gi|282569120|gb|EFB74655.1| alpha-hemolysin [Subdoligranulum variabile DSM 15176]
          Length = 84

 Score = 97.3 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 32/71 (45%), Positives = 45/71 (63%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              + I ++R Y+   S   G+ CR++PTCSEY  +A+A +GL  G  LT  RL++CNPL
Sbjct: 1   MTRLLIALLRGYKKYISPHLGHHCRFVPTCSEYAMQALAVHGLCKGLLLTAWRLLRCNPL 60

Query: 115 GSDGFDPVPDD 125
              GFDPVP+ 
Sbjct: 61  CKFGFDPVPEK 71


>gi|50843791|ref|YP_057018.1| hypothetical protein PPA2351 [Propionibacterium acnes KPA171202]
 gi|50841393|gb|AAT84060.1| conserved protein [Propionibacterium acnes KPA171202]
 gi|313792571|gb|EFS40657.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL110PA1]
 gi|313803572|gb|EFS44754.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL110PA2]
 gi|313829186|gb|EFS66900.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL063PA2]
 gi|314917477|gb|EFS81308.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL050PA1]
 gi|314990683|gb|EFT34774.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL005PA3]
 gi|315097165|gb|EFT69141.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL038PA1]
 gi|315099345|gb|EFT71321.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL059PA2]
 gi|327332497|gb|EGE74232.1| hypothetical protein HMPREF9338_00383 [Propionibacterium acnes
           HL096PA2]
 gi|327456309|gb|EGF02964.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL083PA2]
 gi|327457417|gb|EGF04072.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL092PA1]
          Length = 167

 Score = 97.3 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 26/89 (29%), Positives = 51/89 (57%), Gaps = 5/89 (5%)

Query: 40  TPKSRNWNGKFPKTLGRL-----IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIAR 94
             +  N +G    T+ R      + IG ++ ++ + S ++G+ C+Y P+CS YG  A+  
Sbjct: 16  PSRHPNDDGGVWATVRRFRPLTWLAIGFVKGWRALISPLYGDVCKYQPSCSTYGLRALQV 75

Query: 95  YGLWIGSWLTLLRLIKCNPLGSDGFDPVP 123
           +G++  + + + R+++CNP    G+DPVP
Sbjct: 76  HGVFRATPMIIWRILRCNPWSHGGYDPVP 104


>gi|294501609|ref|YP_003565309.1| hypothetical protein BMQ_4873 [Bacillus megaterium QM B1551]
 gi|295706957|ref|YP_003600032.1| hypothetical protein BMD_4859 [Bacillus megaterium DSM 319]
 gi|294351546|gb|ADE71875.1| protein of unknown function (DUF37) [Bacillus megaterium QM B1551]
 gi|294804616|gb|ADF41682.1| protein of unknown function (DUF37) [Bacillus megaterium DSM 319]
          Length = 75

 Score = 97.3 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 39/65 (60%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           I+ YQ   S      CR+ PTCS+YG E+I R+G   GS+LT+ R++KC+P    G D V
Sbjct: 10  IKGYQKGISPFLPARCRFYPTCSQYGVESIKRFGAVKGSYLTVKRILKCHPFHPGGIDEV 69

Query: 123 PDDLP 127
           P+   
Sbjct: 70  PEKKS 74


>gi|302381719|ref|YP_003817542.1| hypothetical protein Bresu_0604 [Brevundimonas subvibrioides ATCC
           15264]
 gi|302192347|gb|ADK99918.1| protein of unknown function DUF37 [Brevundimonas subvibrioides ATCC
           15264]
          Length = 95

 Score = 97.3 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 39/66 (59%), Positives = 47/66 (71%), Gaps = 1/66 (1%)

Query: 64  RIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVP 123
           R Y+L  S  FG SCR+LPTCS+YG +A+ R+GL  G WLTL RL KC+P G  G+DPVP
Sbjct: 24  RGYKLTLSPFFGQSCRFLPTCSDYGRDALIRHGLRKGGWLTLRRLCKCHPFGGSGYDPVP 83

Query: 124 -DDLPP 128
             D PP
Sbjct: 84  AKDAPP 89


>gi|302672311|ref|YP_003832271.1| hypothetical protein bpr_I2959 [Butyrivibrio proteoclasticus B316]
 gi|302396784|gb|ADL35689.1| hypothetical protein bpr_I2959 [Butyrivibrio proteoclasticus B316]
          Length = 69

 Score = 97.3 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 32/69 (46%), Positives = 43/69 (62%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I +I+ Y+   S +    C Y+PTCSEYG EAI +YG   G  L + R+I+CNP 
Sbjct: 1   MKKILIFLIKFYRKYLSPLKRTKCPYIPTCSEYGLEAIEKYGALKGGLLAVWRIIRCNPF 60

Query: 115 GSDGFDPVP 123
            S G+DPVP
Sbjct: 61  SSGGYDPVP 69


>gi|238926051|ref|YP_002939569.1| hypothetical protein EUBREC_3710 [Eubacterium rectale ATCC 33656]
 gi|238877728|gb|ACR77435.1| hypothetical protein EUBREC_3710 [Eubacterium rectale ATCC 33656]
          Length = 79

 Score = 97.3 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 41/70 (58%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + I I +I+ Y+   S +    C Y PTCSEYG +A+ +YG   G  L   R+++CNP
Sbjct: 10  VLKSILIFLIKFYRKYISPMKSTKCPYCPTCSEYGLQAVQKYGAIKGGLLAAWRILRCNP 69

Query: 114 LGSDGFDPVP 123
               G+DPVP
Sbjct: 70  FSKGGYDPVP 79


>gi|226309517|ref|YP_002769479.1| hypothetical protein RER_60320 [Rhodococcus erythropolis PR4]
 gi|226188636|dbj|BAH36740.1| conserved hypothetical protein [Rhodococcus erythropolis PR4]
          Length = 126

 Score = 97.3 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 42/72 (58%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           +     + I  I +Y+   S +   +CR+ PTCSEY  EA+  +G   G +LT++RL KC
Sbjct: 25  RRAPATVLIFCIELYRTYVSPLRMPTCRFTPTCSEYAVEALRTHGAIKGLFLTVVRLAKC 84

Query: 112 NPLGSDGFDPVP 123
            P  S G+DPVP
Sbjct: 85  APWHSGGWDPVP 96


>gi|71275656|ref|ZP_00651941.1| Protein of unknown function DUF37 [Xylella fastidiosa Dixon]
 gi|71897800|ref|ZP_00680026.1| Protein of unknown function DUF37 [Xylella fastidiosa Ann-1]
 gi|170729526|ref|YP_001774959.1| hypothetical protein Xfasm12_0306 [Xylella fastidiosa M12]
 gi|71163547|gb|EAO13264.1| Protein of unknown function DUF37 [Xylella fastidiosa Dixon]
 gi|71732355|gb|EAO34409.1| Protein of unknown function DUF37 [Xylella fastidiosa Ann-1]
 gi|167964319|gb|ACA11329.1| alpha-hemolysin [Xylella fastidiosa M12]
          Length = 87

 Score = 97.3 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 33/74 (44%), Positives = 45/74 (60%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            I +++IY+ + S + G  CR+ P+CSEY   AIAR+G   G WL   RL +CNPL   G
Sbjct: 4   LILLLKIYKRLISPLLGPHCRFEPSCSEYAMVAIARFGTLRGIWLAARRLARCNPLQLGG 63

Query: 119 FDPVPDDLPPKKNN 132
            DPVPD+   + N 
Sbjct: 64  HDPVPDNTSTQVNP 77


>gi|111020652|ref|YP_703624.1| hypothetical protein RHA1_ro03663 [Rhodococcus jostii RHA1]
 gi|116256234|sp|Q0SAH0|Y3663_RHOSR RecName: Full=UPF0161 protein RHA1_ro03663
 gi|110820182|gb|ABG95466.1| conserved hypothetical protein [Rhodococcus jostii RHA1]
          Length = 121

 Score = 97.3 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 28/72 (38%), Positives = 43/72 (59%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           + L     I  I +Y+   S +   +CR++PTCSEY  E++  +G+  G +LT++RL KC
Sbjct: 27  RALPARTLIFFIELYRTYVSPLRMPTCRFMPTCSEYAVESLRTHGVIKGLFLTVVRLAKC 86

Query: 112 NPLGSDGFDPVP 123
            P    G+DPVP
Sbjct: 87  APWHPGGWDPVP 98


>gi|160882062|ref|YP_001561030.1| hypothetical protein Cphy_3944 [Clostridium phytofermentans ISDg]
 gi|226706079|sp|A9KLY2|Y3944_CLOPH RecName: Full=UPF0161 protein Cphy_3944
 gi|160430728|gb|ABX44291.1| protein of unknown function DUF37 [Clostridium phytofermentans
           ISDg]
          Length = 70

 Score = 97.3 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 31/70 (44%), Positives = 45/70 (64%), Gaps = 1/70 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFG-NSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
            + I I I+++Y+   S +    +CR+ PTCSEY  EA+ RYG   GS+L + R++KC+P
Sbjct: 1   MKRILIAIVKLYRKYISPMKRVPTCRFTPTCSEYALEALQRYGAIRGSYLAVRRILKCHP 60

Query: 114 LGSDGFDPVP 123
               GFDPVP
Sbjct: 61  FHKGGFDPVP 70


>gi|170764181|ref|ZP_02633744.2| conserved hypothetical protein TIGR00278 [Clostridium perfringens E
           str. JGS1987]
 gi|182420537|ref|ZP_02643679.2| conserved hypothetical protein TIGR00278 [Clostridium perfringens
           NCTC 8239]
 gi|170660938|gb|EDT13621.1| conserved hypothetical protein TIGR00278 [Clostridium perfringens E
           str. JGS1987]
 gi|182379920|gb|EDT77399.1| conserved hypothetical protein TIGR00278 [Clostridium perfringens
           NCTC 8239]
          Length = 71

 Score = 97.3 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 25/70 (35%), Positives = 44/70 (62%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + + I +I+ Y+   S +    CR+ PTCS+Y  EAI +YG + G ++++ R+++CNP
Sbjct: 2   IMKKLFIVMIKFYRKYISPLKRPCCRFYPTCSQYALEAIQKYGAFKGGFMSIGRILRCNP 61

Query: 114 LGSDGFDPVP 123
               G+DPV 
Sbjct: 62  FCKGGYDPVK 71


>gi|47606243|sp|P61473|YIDD_SHIFL RecName: Full=UPF0161 protein yidD
          Length = 85

 Score = 97.3 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 31/67 (46%), Positives = 45/67 (67%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
              P + G  + I +IR+YQ + S + G  CR+ PTCS YG EA+ R+G+  GSWLT+ R
Sbjct: 1   MAPPLSPGSRVLIALIRVYQRLISPLLGPHCRFTPTCSSYGIEALRRFGVIKGSWLTVKR 60

Query: 108 LIKCNPL 114
           ++KC+PL
Sbjct: 61  VLKCHPL 67


>gi|308232612|ref|ZP_07664133.1| hemolysin [Mycobacterium tuberculosis SUMu001]
 gi|308369278|ref|ZP_07666709.1| hemolysin [Mycobacterium tuberculosis SUMu002]
 gi|308371503|ref|ZP_07667185.1| hemolysin [Mycobacterium tuberculosis SUMu003]
 gi|308371553|ref|ZP_07667204.1| hemolysin [Mycobacterium tuberculosis SUMu004]
 gi|308372783|ref|ZP_07667457.1| hypothetical protein TMEG_00422 [Mycobacterium tuberculosis
           SUMu005]
 gi|308375035|ref|ZP_07667930.1| hemolysin [Mycobacterium tuberculosis SUMu007]
 gi|308376282|ref|ZP_07668241.1| hemolysin [Mycobacterium tuberculosis SUMu008]
 gi|308378517|ref|ZP_07668776.1| hemolysin [Mycobacterium tuberculosis SUMu009]
 gi|308379667|ref|ZP_07669017.1| hemolysin [Mycobacterium tuberculosis SUMu010]
 gi|308380866|ref|ZP_07669310.1| hemolysin [Mycobacterium tuberculosis SUMu011]
 gi|308213436|gb|EFO72835.1| hemolysin [Mycobacterium tuberculosis SUMu001]
 gi|308328153|gb|EFP17004.1| hemolysin [Mycobacterium tuberculosis SUMu002]
 gi|308328615|gb|EFP17466.1| hemolysin [Mycobacterium tuberculosis SUMu003]
 gi|308336270|gb|EFP25121.1| hemolysin [Mycobacterium tuberculosis SUMu004]
 gi|308339876|gb|EFP28727.1| hypothetical protein TMEG_00422 [Mycobacterium tuberculosis
           SUMu005]
 gi|308347672|gb|EFP36523.1| hemolysin [Mycobacterium tuberculosis SUMu007]
 gi|308351590|gb|EFP40441.1| hemolysin [Mycobacterium tuberculosis SUMu008]
 gi|308352297|gb|EFP41148.1| hemolysin [Mycobacterium tuberculosis SUMu009]
 gi|308356300|gb|EFP45151.1| hemolysin [Mycobacterium tuberculosis SUMu010]
 gi|308360187|gb|EFP49038.1| hemolysin [Mycobacterium tuberculosis SUMu011]
          Length = 98

 Score = 97.3 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 49/73 (67%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            I +I++Y+ + S +   SCR++PTCS+Y  +A+  YGL  GSWLT++RL KC P    G
Sbjct: 1   MIFVIQVYRHMLSPLRPASCRFVPTCSQYAVDALTEYGLLRGSWLTMIRLAKCGPWHRGG 60

Query: 119 FDPVPDDLPPKKN 131
           +DP+P+ L   ++
Sbjct: 61  WDPIPEGLTTGRS 73


>gi|15674519|ref|NP_268693.1| hypothetical protein SPy_0370 [Streptococcus pyogenes M1 GAS]
 gi|28896501|ref|NP_802851.1| hypothetical protein SPs1589 [Streptococcus pyogenes SSI-1]
 gi|209558866|ref|YP_002285338.1| hypothetical protein Spy49_0305 [Streptococcus pyogenes NZ131]
 gi|54039921|sp|P67308|Y270_STRP3 RecName: Full=UPF0161 protein SpyM3_0270/SPs1589
 gi|54042709|sp|P67307|Y370_STRP1 RecName: Full=UPF0161 protein SPy_0370/M5005_Spy0311
 gi|73921113|sp|Q5XDP1|Y337_STRP6 RecName: Full=UPF0161 protein M6_Spy0337
 gi|226703684|sp|B5XJY1|Y305_STRPZ RecName: Full=UPF0161 protein Spy49_0305
 gi|13621622|gb|AAK33414.1| conserved hypothetical protein [Streptococcus pyogenes M1 GAS]
 gi|28811755|dbj|BAC64684.1| conserved hypothetical protein [Streptococcus pyogenes SSI-1]
 gi|209540067|gb|ACI60643.1| hypothetical protein Spy49_0305 [Streptococcus pyogenes NZ131]
          Length = 86

 Score = 97.3 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 43/78 (55%), Gaps = 1/78 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I  ++ YQ   S +   SCRY PTCS Y   AI ++G   G  + + R+++C+P 
Sbjct: 1   MKKLLIVSVKAYQKYISPLSPPSCRYKPTCSAYMLTAIEKHGT-KGILMGIARILRCHPF 59

Query: 115 GSDGFDPVPDDLPPKKNN 132
            + G DPVP+D    +N 
Sbjct: 60  VAGGVDPVPEDFSLMRNK 77


>gi|307564789|ref|ZP_07627317.1| conserved hypothetical protein YidD [Prevotella amnii CRIS 21A-A]
 gi|307346511|gb|EFN91820.1| conserved hypothetical protein YidD [Prevotella amnii CRIS 21A-A]
          Length = 91

 Score = 97.3 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 42/82 (51%), Gaps = 3/82 (3%)

Query: 45  NWNGKFPKTLGRLIGIGI---IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGS 101
           NW  K        + I +   I  YQ   S     SCR+ P+CS Y  +AI ++G   G 
Sbjct: 10  NWVKKIIHLCSYSLSILLCIPIVFYQHFISPFTPPSCRFTPSCSVYAKQAIMKHGPIKGL 69

Query: 102 WLTLLRLIKCNPLGSDGFDPVP 123
            L + R+++CNP G  G+DPVP
Sbjct: 70  ALAIWRILRCNPWGGSGYDPVP 91


>gi|47497897|dbj|BAD20081.1| unknown protein [Oryza sativa Japonica Group]
 gi|47497921|dbj|BAD20127.1| unknown protein [Oryza sativa Japonica Group]
          Length = 130

 Score = 97.3 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 30/70 (42%), Positives = 45/70 (64%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
             LG  + + +++ Y+   S +  +SCRY+PTCSEY  +A  +YG+  G+ LT  RL +C
Sbjct: 49  NDLGVNVALSMLKFYKREISPLLPSSCRYVPTCSEYSMQAYKKYGVAKGTILTAWRLCRC 108

Query: 112 NPLGSDGFDP 121
           NPLG  G+DP
Sbjct: 109 NPLGGHGYDP 118


>gi|300857414|ref|YP_003782398.1| hypothetical protein CLJU_c42950 [Clostridium ljungdahlii DSM
           13528]
 gi|300437529|gb|ADK17296.1| conserved hypothetical protein [Clostridium ljungdahlii DSM 13528]
          Length = 69

 Score = 97.3 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 24/69 (34%), Positives = 42/69 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   I ++++Y    S + G  CR+ PTCS+Y  EA+ +YG   G ++++ R+++CNP 
Sbjct: 1   MKKFLIFLVKLYMKYISPLKGPCCRFYPTCSQYTVEALQKYGTIKGGFMSIKRILRCNPF 60

Query: 115 GSDGFDPVP 123
              G+DPV 
Sbjct: 61  CKGGYDPVK 69


>gi|182678548|ref|YP_001832694.1| hypothetical protein Bind_1573 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|226734713|sp|B2IBC1|Y1573_BEII9 RecName: Full=UPF0161 protein Bind_1573
 gi|182634431|gb|ACB95205.1| protein of unknown function DUF37 [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 123

 Score = 97.3 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 39/94 (41%), Positives = 58/94 (61%), Gaps = 4/94 (4%)

Query: 33  PLLLKNNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAI 92
              +++ +   R+  G  P    R     ++R YQL FS++ G  CR+LPTCS Y  EA+
Sbjct: 2   RRFVRSLSSTGRSQTGSLPVRGLR----KLLRFYQLTFSSLVGTQCRHLPTCSAYMDEAL 57

Query: 93  ARYGLWIGSWLTLLRLIKCNPLGSDGFDPVPDDL 126
           AR+G+W G ++ L RL +C+P G+ G+DPVPD L
Sbjct: 58  ARHGVWAGLFIGLARLSRCHPWGTAGYDPVPDQL 91


>gi|327398261|ref|YP_004339130.1| hypothetical protein Hipma_0091 [Hippea maritima DSM 10411]
 gi|327180890|gb|AEA33071.1| UPF0161 protein yidD [Hippea maritima DSM 10411]
          Length = 95

 Score = 96.9 bits (240), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
             IG+I++YQ   S +   SCR+ PTCS Y  EAI ++G   G  +++ R+++C P  + 
Sbjct: 11  FMIGLIKLYQRFISPLTRPSCRFYPTCSNYSIEAIKKFGPIQGGMMSIWRILRCGPWSAG 70

Query: 118 GFDPVPDDLPPKKNNPKLLSK 138
           G+DP P++   K  + K   +
Sbjct: 71  GYDP-PNEPLFKLKSFKFKRR 90


>gi|282880554|ref|ZP_06289261.1| conserved hypothetical protein YidD [Prevotella timonensis CRIS
           5C-B1]
 gi|281305657|gb|EFA97710.1| conserved hypothetical protein YidD [Prevotella timonensis CRIS
           5C-B1]
          Length = 72

 Score = 96.9 bits (240), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 30/68 (44%), Positives = 42/68 (61%)

Query: 56  RLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLG 115
           + I +  I  YQ   +     SCR+ PTCSEY  +AI +YG   GS+L + R+++CNP G
Sbjct: 5   KWILLVPILFYQKCITPFTPPSCRFTPTCSEYARQAIVKYGPLKGSYLAVKRILRCNPWG 64

Query: 116 SDGFDPVP 123
             G+DPVP
Sbjct: 65  GSGYDPVP 72


>gi|331700392|ref|YP_004336631.1| hypothetical protein Psed_6690 [Pseudonocardia dioxanivorans
           CB1190]
 gi|326955081|gb|AEA28778.1| UPF0161 protein yidD [Pseudonocardia dioxanivorans CB1190]
          Length = 128

 Score = 96.9 bits (240), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 25/66 (37%), Positives = 36/66 (54%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           +      I ++R YQ   S  F   CR+ PTCS Y  EA+  +G+  GS+LT+ RL++C 
Sbjct: 23  SPIARALIAVLRFYQKWISPAFPPVCRFHPTCSAYAVEALQVHGVMRGSFLTVRRLLRCG 82

Query: 113 PLGSDG 118
           P    G
Sbjct: 83  PWHPGG 88


>gi|328543261|ref|YP_004303370.1| hypothetical protein SL003B_1642 [polymorphum gilvum SL003B-26A1]
 gi|326413007|gb|ADZ70070.1| hypothetical protein SL003B_1642 [Polymorphum gilvum SL003B-26A1]
          Length = 116

 Score = 96.9 bits (240), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 43/90 (47%), Positives = 58/90 (64%), Gaps = 1/90 (1%)

Query: 39  NTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLW 98
             P S    G+ P +L   +G+ +I IY+   S V G +CRY PTCS Y  EAI RYGLW
Sbjct: 3   TKPPSATSEGR-PISLPARLGLALIWIYRHSLSLVMGRACRYAPTCSHYTEEAILRYGLW 61

Query: 99  IGSWLTLLRLIKCNPLGSDGFDPVPDDLPP 128
            G W+ L R+++CNP G+ G+DP+P+ LPP
Sbjct: 62  AGGWMGLARILRCNPFGASGYDPIPEALPP 91


>gi|213966266|ref|ZP_03394450.1| conserved hypothetical protein [Corynebacterium amycolatum SK46]
 gi|213951118|gb|EEB62516.1| conserved hypothetical protein [Corynebacterium amycolatum SK46]
          Length = 110

 Score = 96.9 bits (240), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 50/97 (51%), Gaps = 1/97 (1%)

Query: 32  SPLLLKNNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFG-NSCRYLPTCSEYGYE 90
           +   L  N   +   +G   +  G  +    I  Y+   SN+   ++CR+ PTCS YG E
Sbjct: 3   NRHSLHTNVGANSLDDGPLAQAPGARVAERAILFYRRRISNLKPTSTCRFEPTCSAYGLE 62

Query: 91  AIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVPDDLP 127
           A+ R+G   G WLTLLR+ +C P    G+DPVP   P
Sbjct: 63  AVRRFGAIRGLWLTLLRIFRCAPWHPGGWDPVPATFP 99


>gi|163733763|ref|ZP_02141205.1| hypothetical protein RLO149_05608 [Roseobacter litoralis Och 149]
 gi|161392874|gb|EDQ17201.1| hypothetical protein RLO149_05608 [Roseobacter litoralis Och 149]
          Length = 78

 Score = 96.9 bits (240), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 32/62 (51%), Positives = 46/62 (74%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           +R Y+LIFS   G +CRY PTCS Y  EA+ ++G  +G+WLTL R+++C+P G  G+DPV
Sbjct: 12  VRAYRLIFSPWVGYNCRYQPTCSAYALEALQKHGGLVGAWLTLRRILRCHPWGKCGYDPV 71

Query: 123 PD 124
           P+
Sbjct: 72  PE 73


>gi|91205206|ref|YP_537561.1| hypothetical protein RBE_0391 [Rickettsia bellii RML369-C]
 gi|116256236|sp|Q1RJJ2|Y391_RICBR RecName: Full=UPF0161 protein RBE_0391
 gi|91068750|gb|ABE04472.1| unknown [Rickettsia bellii RML369-C]
          Length = 73

 Score = 96.9 bits (240), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 41/70 (58%), Gaps = 1/70 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFG-NSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
              I + ++  Y+   S + G N+CR+ PTCS+Y  EA+  +G   G WL   R+IKC P
Sbjct: 1   MTRILLLLLTFYRYFISPLLGGNNCRFYPTCSKYAKEALNTHGGIKGLWLIFKRIIKCQP 60

Query: 114 LGSDGFDPVP 123
           L   G+DPVP
Sbjct: 61  LCDGGYDPVP 70


>gi|154493398|ref|ZP_02032718.1| hypothetical protein PARMER_02735 [Parabacteroides merdae ATCC
           43184]
 gi|154086608|gb|EDN85653.1| hypothetical protein PARMER_02735 [Parabacteroides merdae ATCC
           43184]
          Length = 74

 Score = 96.9 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 42/72 (58%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           K     + +  +  Y+   S +   SCRY PTCSEY  +A+ ++G   G +L + R+++C
Sbjct: 3   KRFFTFLLLLPVYFYKYCISPMTPASCRYTPTCSEYAVQALKKHGPVKGLYLAVKRILRC 62

Query: 112 NPLGSDGFDPVP 123
           +P G  G+DPVP
Sbjct: 63  HPWGGSGYDPVP 74


>gi|125974853|ref|YP_001038763.1| hypothetical protein Cthe_2368 [Clostridium thermocellum ATCC
           27405]
 gi|256003890|ref|ZP_05428877.1| protein of unknown function DUF37 [Clostridium thermocellum DSM
           2360]
 gi|281418692|ref|ZP_06249711.1| protein of unknown function DUF37 [Clostridium thermocellum JW20]
 gi|166228571|sp|A3DHZ1|Y2368_CLOTH RecName: Full=UPF0161 protein Cthe_2368
 gi|125715078|gb|ABN53570.1| protein of unknown function DUF37 [Clostridium thermocellum ATCC
           27405]
 gi|255992228|gb|EEU02323.1| protein of unknown function DUF37 [Clostridium thermocellum DSM
           2360]
 gi|281407776|gb|EFB38035.1| protein of unknown function DUF37 [Clostridium thermocellum JW20]
 gi|316941975|gb|ADU76009.1| protein of unknown function DUF37 [Clostridium thermocellum DSM
           1313]
          Length = 71

 Score = 96.9 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFG-NSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           + R   I IIR+YQ   S +    SCR+ PTCS+Y  +A+ RYG+  G ++ L R++KC+
Sbjct: 1   MFRRWVIYIIRLYQRWISPLKTMPSCRFYPTCSQYAIDAVGRYGVIKGGFMALKRILKCH 60

Query: 113 PLGSDGFDPVP 123
           P    G+DPV 
Sbjct: 61  PFHPGGYDPVK 71


>gi|258655509|ref|YP_003204665.1| hypothetical protein Namu_5413 [Nakamurella multipartita DSM 44233]
 gi|258558734|gb|ACV81676.1| protein of unknown function DUF37 [Nakamurella multipartita DSM
           44233]
          Length = 144

 Score = 96.9 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 27/66 (40%), Positives = 36/66 (54%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
           + +  IR YQ   +     SCRY PTCS Y   A+   G  +G+ LT+ RL++CNP    
Sbjct: 11  LLVAPIRFYQRFITPYTPASCRYYPTCSAYAVTALRTRGAVVGTILTIWRLLRCNPWSEG 70

Query: 118 GFDPVP 123
           G D VP
Sbjct: 71  GIDHVP 76


>gi|262200045|ref|YP_003271254.1| hypothetical protein Hoch_6898 [Haliangium ochraceum DSM 14365]
 gi|262083392|gb|ACY19361.1| protein of unknown function DUF37 [Haliangium ochraceum DSM 14365]
          Length = 102

 Score = 96.9 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 27/71 (38%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFG-NSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           + + + I  IR YQ   S +    +CR++PTCS Y  +AI + G+ +G+ L   R+++CN
Sbjct: 1   MLKHVFIAGIRFYQRFLSPLKPAPTCRFVPTCSSYALQAIRQRGVLMGTLLATWRILRCN 60

Query: 113 PLGSDGFDPVP 123
           P    G+DPVP
Sbjct: 61  PFVPGGYDPVP 71


>gi|257057914|ref|YP_003135746.1| hypothetical protein Svir_39780 [Saccharomonospora viridis DSM
           43017]
 gi|256587786|gb|ACU98919.1| conserved hypothetical protein TIGR00278 [Saccharomonospora viridis
           DSM 43017]
          Length = 100

 Score = 96.9 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 27/91 (29%), Positives = 44/91 (48%)

Query: 49  KFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRL 108
               T    + +  IR Y+   S      CR+ P+CS Y  EA+ R+G   G +L + RL
Sbjct: 10  PTRPTPVAWVLLLPIRFYRKAISPYLPPMCRFYPSCSAYAVEALNRFGAARGMYLAVRRL 69

Query: 109 IKCNPLGSDGFDPVPDDLPPKKNNPKLLSKK 139
           ++C P    G DPVP+    +   P + +++
Sbjct: 70  LRCGPWTPPGRDPVPEKFSFRYQGPGMSTEE 100


>gi|189501598|ref|YP_001957315.1| hypothetical protein Aasi_0140 [Candidatus Amoebophilus asiaticus
           5a2]
 gi|226734148|sp|B3EUG7|Y140_AMOA5 RecName: Full=UPF0161 protein Aasi_0140
 gi|189497039|gb|ACE05586.1| protein of unknown function DUF37 [Candidatus Amoebophilus
           asiaticus 5a2]
          Length = 72

 Score = 96.9 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 28/69 (40%), Positives = 42/69 (60%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           L + I I  I +YQ+  +      CR+ PTCS Y +EAI ++G+  G WL   R+++C+P
Sbjct: 3   LLKRIVIFPIWVYQVALAPYLTPCCRFQPTCSAYAHEAINKHGIVKGIWLAGKRILRCHP 62

Query: 114 LGSDGFDPV 122
            G  G+DPV
Sbjct: 63  CGKSGYDPV 71


>gi|148381583|ref|YP_001256124.1| hypothetical protein CBO3646 [Clostridium botulinum A str. ATCC
           3502]
 gi|153933888|ref|YP_001385960.1| hypothetical protein CLB_3739 [Clostridium botulinum A str. ATCC
           19397]
 gi|153936782|ref|YP_001389367.1| hypothetical protein CLC_3645 [Clostridium botulinum A str. Hall]
 gi|170760176|ref|YP_001788988.1| hypothetical protein CLK_3130 [Clostridium botulinum A3 str. Loch
           Maree]
 gi|166232620|sp|A5I819|Y3646_CLOBH RecName: Full=UPF0161 protein CBO3646/CLC_3645
 gi|166232634|sp|A7FPL4|Y3739_CLOB1 RecName: Full=UPF0161 protein CLB_3739
 gi|226703721|sp|B1KUB5|Y3130_CLOBM RecName: Full=UPF0161 protein CLK_3130
 gi|148291067|emb|CAL85204.1| conserved hypothetical protein [Clostridium botulinum A str. ATCC
           3502]
 gi|152929932|gb|ABS35432.1| conserved hypothetical protein TIGR00278 [Clostridium botulinum A
           str. ATCC 19397]
 gi|152932696|gb|ABS38195.1| conserved hypothetical protein TIGR00278 [Clostridium botulinum A
           str. Hall]
 gi|169407165|gb|ACA55576.1| conserved hypothetical protein TIGR00278 [Clostridium botulinum A3
           str. Loch Maree]
          Length = 69

 Score = 96.9 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 27/69 (39%), Positives = 44/69 (63%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I II++Y+   S +   SCR+ PTCS+Y  EAI +YG   G+ +++ R++KC+P 
Sbjct: 1   MKNLLICIIKMYRKYISPLKRPSCRFYPTCSQYSIEAIEKYGALKGTLISIKRILKCHPF 60

Query: 115 GSDGFDPVP 123
              G+DPV 
Sbjct: 61  NEGGYDPVK 69


>gi|318040405|ref|ZP_07972361.1| hypothetical protein SCB01_01806 [Synechococcus sp. CB0101]
          Length = 124

 Score = 96.9 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 34/63 (53%), Positives = 43/63 (68%), Gaps = 1/63 (1%)

Query: 63  IRIYQLIFSNVFGN-SCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDP 121
           I  Y+L  S + G   CR++P+CS YG EAI R+G W GSWLTL RL++C+P    G DP
Sbjct: 62  IGFYRLFISPLLGPPRCRFIPSCSAYGLEAIERHGPWRGSWLTLRRLLRCHPFTPCGCDP 121

Query: 122 VPD 124
           VPD
Sbjct: 122 VPD 124


>gi|212692524|ref|ZP_03300652.1| hypothetical protein BACDOR_02020 [Bacteroides dorei DSM 17855]
 gi|212664935|gb|EEB25507.1| hypothetical protein BACDOR_02020 [Bacteroides dorei DSM 17855]
          Length = 73

 Score = 96.9 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 40/59 (67%)

Query: 65  IYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVP 123
            Y+   S +   SCR++PTCSEY  EAI ++G + G +L + R+++C+P G  G+DPVP
Sbjct: 15  FYRGYISPMTPPSCRFVPTCSEYAIEAIKKHGPFKGLYLAVRRILRCHPWGGSGYDPVP 73


>gi|254362247|ref|ZP_04978361.1| hypothetical protein MHA_1856 [Mannheimia haemolytica PHL213]
 gi|153093822|gb|EDN74757.1| hypothetical protein MHA_1856 [Mannheimia haemolytica PHL213]
          Length = 107

 Score = 96.9 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 30/86 (34%), Positives = 42/86 (48%)

Query: 38  NNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGL 97
                + + N     +L   I +  I  Y+   S + G  CR+ PTCS Y  EAI  +G 
Sbjct: 9   QKAGTTESINQPPRLSLLAKILLLPIYFYRYAISPLIGPRCRFYPTCSTYAVEAIKIHGA 68

Query: 98  WIGSWLTLLRLIKCNPLGSDGFDPVP 123
             G +L   R+++CNPL   G DPVP
Sbjct: 69  IKGGYLAFKRILRCNPLSEGGEDPVP 94


>gi|291547602|emb|CBL20710.1| conserved hypothetical protein TIGR00278 [Ruminococcus sp. SR1/5]
          Length = 70

 Score = 96.9 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 31/70 (44%), Positives = 44/70 (62%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + +   I +IR+YQ   S +    C Y+PTCS+YG EAI +YG + GS L   R+++CNP
Sbjct: 1   MIKKFLIKMIRLYQKYISPMKRTKCPYIPTCSQYGLEAIEKYGAFKGSLLAAWRILRCNP 60

Query: 114 LGSDGFDPVP 123
               G+DPVP
Sbjct: 61  FSHGGYDPVP 70


>gi|238899055|ref|YP_002924737.1| hypothetical protein HDEF_2010 [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229466815|gb|ACQ68589.1| conserved hypothetical phage protein [Candidatus Hamiltonella
           defensa 5AT (Acyrthosiphon pisum)]
          Length = 74

 Score = 96.9 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 31/67 (46%), Positives = 44/67 (65%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            + +I+ YQLI       SCR+ P+CS+Y  E++ R+G+  GSWLT  R+I+C+PL S G
Sbjct: 1   MLYLIKAYQLISRFFLPPSCRFYPSCSDYAIESLRRFGVIKGSWLTAKRIIRCHPLHSAG 60

Query: 119 FDPVPDD 125
            DPVP  
Sbjct: 61  NDPVPPK 67


>gi|226362892|ref|YP_002780672.1| hypothetical protein ROP_34800 [Rhodococcus opacus B4]
 gi|254765056|sp|C1B7S4|Y3480_RHOOB RecName: Full=UPF0161 protein ROP_34800
 gi|226241379|dbj|BAH51727.1| hypothetical protein [Rhodococcus opacus B4]
          Length = 121

 Score = 96.9 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 28/72 (38%), Positives = 41/72 (56%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           + L     I  I +Y+   S +   +CR++PTCSEY  E++  +G   G  LT++RL KC
Sbjct: 27  RALPARTLIFFIELYRTYVSPLRMPTCRFMPTCSEYAVESLRTHGTIKGLLLTVVRLAKC 86

Query: 112 NPLGSDGFDPVP 123
            P    G+DPVP
Sbjct: 87  APWHPGGWDPVP 98


>gi|16331639|ref|NP_442367.1| hypothetical protein ssl0331 [Synechocystis sp. PCC 6803]
 gi|14286011|sp|Q55785|Y331_SYNY3 RecName: Full=UPF0161 protein ssl0331
 gi|1001699|dbj|BAA10437.1| ssl0331 [Synechocystis sp. PCC 6803]
          Length = 79

 Score = 96.9 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 28/64 (43%), Positives = 44/64 (68%)

Query: 66  YQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVPDD 125
           Y+++ S +F  SCR+ PTCS+Y  +A+  +G+W GS L L R+++C+PL   G+DPVP+ 
Sbjct: 13  YRILISPLFPPSCRFQPTCSQYALDAVEIHGVWRGSCLALKRILRCHPLHPGGYDPVPNP 72

Query: 126 LPPK 129
              K
Sbjct: 73  EQGK 76


>gi|261492907|ref|ZP_05989453.1| hypothetical protein COK_1327 [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261496743|ref|ZP_05993118.1| hypothetical protein COI_2461 [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261307582|gb|EEY08910.1| hypothetical protein COI_2461 [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261311448|gb|EEY12605.1| hypothetical protein COK_1327 [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 77

 Score = 96.9 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 27/64 (42%), Positives = 36/64 (56%)

Query: 60  IGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGF 119
           +  I  Y+   S + G  CR+ PTCS Y  EAI  +G   G +L   R+++CNPL   G 
Sbjct: 1   MLPIYFYRYAISPLIGPRCRFYPTCSTYAVEAIKIHGAIKGGYLAFKRILRCNPLSEGGE 60

Query: 120 DPVP 123
           DPVP
Sbjct: 61  DPVP 64


>gi|218190446|gb|EEC72873.1| hypothetical protein OsI_06645 [Oryza sativa Indica Group]
          Length = 130

 Score = 96.9 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 30/70 (42%), Positives = 45/70 (64%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
             LG  + + +++ Y+   S +  +SCRY+PTCSEY  +A  +YG+  G+ LT  RL +C
Sbjct: 49  NDLGVNVALSMLKFYKREISPLLPSSCRYVPTCSEYSMQAYKKYGVAKGTILTAWRLCRC 108

Query: 112 NPLGSDGFDP 121
           NPLG  G+DP
Sbjct: 109 NPLGGHGYDP 118


>gi|257067220|ref|YP_003153476.1| hypothetical protein Apre_1737 [Anaerococcus prevotii DSM 20548]
 gi|256799100|gb|ACV29755.1| protein of unknown function DUF37 [Anaerococcus prevotii DSM 20548]
          Length = 71

 Score = 96.9 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 25/70 (35%), Positives = 38/70 (54%), Gaps = 1/70 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNS-CRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           +   + I +I+ YQ   S   G S C++ PTCS+Y  EA  +YG       +  R+++CN
Sbjct: 1   MINRLFIRLIKFYQKFISPQLGPSKCKFYPTCSQYALEAFRKYGFLKAFIKSFWRILRCN 60

Query: 113 PLGSDGFDPV 122
           P    G+DPV
Sbjct: 61  PFSKGGYDPV 70


>gi|212550543|ref|YP_002308860.1| hypothetical protein CFPG_186 [Candidatus Azobacteroides
           pseudotrichonymphae genomovar. CFP2]
 gi|212548781|dbj|BAG83449.1| conserved hypothetical protein [Candidatus Azobacteroides
           pseudotrichonymphae genomovar. CFP2]
          Length = 77

 Score = 96.9 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 30/63 (47%), Positives = 43/63 (68%)

Query: 60  IGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGF 119
           + +I+ Y+L  S +  +SCRY+PTCSEY   A+ +YG+  G WLTL R+ +C+P G  G 
Sbjct: 14  LLLIQFYRLCISPLLLSSCRYIPTCSEYATIAMKKYGILKGGWLTLKRICRCHPWGKHGH 73

Query: 120 DPV 122
           DPV
Sbjct: 74  DPV 76


>gi|253581090|ref|ZP_04858350.1| ribonuclease P [Ruminococcus sp. 5_1_39B_FAA]
 gi|251847626|gb|EES75596.1| ribonuclease P [Ruminococcus sp. 5_1_39BFAA]
          Length = 70

 Score = 96.9 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 30/70 (42%), Positives = 43/70 (61%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + +   I II++YQ   S +    C Y+PTCS+YG EAI +YG   G  L + R+++CNP
Sbjct: 1   MIKKFLIRIIKLYQKYISPMKRTKCPYIPTCSQYGLEAIEKYGALKGGLLAVWRILRCNP 60

Query: 114 LGSDGFDPVP 123
               G+DPVP
Sbjct: 61  FSHGGYDPVP 70


>gi|167763945|ref|ZP_02436072.1| hypothetical protein BACSTE_02328 [Bacteroides stercoris ATCC
           43183]
 gi|167698061|gb|EDS14640.1| hypothetical protein BACSTE_02328 [Bacteroides stercoris ATCC
           43183]
          Length = 73

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/61 (42%), Positives = 40/61 (65%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           I  Y+   S +   SCR+ PTCS+Y  EAI ++G + G +L + R+++C+P G  G+DPV
Sbjct: 13  IYFYRKCISPMTSPSCRFTPTCSQYAVEAIKKHGPFKGLYLAVKRILRCHPWGGSGYDPV 72

Query: 123 P 123
           P
Sbjct: 73  P 73


>gi|329956461|ref|ZP_08297058.1| hypothetical protein YidD [Bacteroides clarus YIT 12056]
 gi|328524358|gb|EGF51428.1| hypothetical protein YidD [Bacteroides clarus YIT 12056]
          Length = 73

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/61 (42%), Positives = 40/61 (65%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           I  Y+   S +   SCR+ PTCS+Y  EAI ++G + G +L + R+++C+P G  G+DPV
Sbjct: 13  IYFYRKCISPMTSPSCRFTPTCSQYAVEAIKKHGPFKGLYLAIKRILRCHPWGGSGYDPV 72

Query: 123 P 123
           P
Sbjct: 73  P 73


>gi|121611910|ref|YP_999717.1| hypothetical protein Veis_5013 [Verminephrobacter eiseniae EF01-2]
 gi|121556550|gb|ABM60699.1| protein of unknown function DUF37 [Verminephrobacter eiseniae
           EF01-2]
          Length = 100

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/73 (39%), Positives = 46/73 (63%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I ++R Y+   S   G++CR+ P+CS Y  +A+A++G   GS LTL RL++C+P 
Sbjct: 1   MQRLLIAVVRGYRFWLSPWLGSACRFEPSCSRYALQALAQHGAAAGSVLTLHRLLRCHPW 60

Query: 115 GSDGFDPVPDDLP 127
              G DP+P  LP
Sbjct: 61  CDGGHDPLPQALP 73


>gi|288800270|ref|ZP_06405728.1| putative toxin-antitoxin system, toxin component [Prevotella sp.
           oral taxon 299 str. F0039]
 gi|288332483|gb|EFC70963.1| putative toxin-antitoxin system, toxin component [Prevotella sp.
           oral taxon 299 str. F0039]
          Length = 84

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 38/61 (62%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           I  YQ   S     SCR+ P+CSEY   AI ++G   G +L++ R+++CNP G  G+DPV
Sbjct: 24  ILFYQRFVSPFTPPSCRFTPSCSEYAKTAILKHGPLKGLYLSVWRILRCNPWGGSGYDPV 83

Query: 123 P 123
           P
Sbjct: 84  P 84


>gi|314922674|gb|EFS86505.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL001PA1]
 gi|314982900|gb|EFT26992.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL110PA3]
 gi|315094440|gb|EFT66416.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL060PA1]
 gi|327328935|gb|EGE70695.1| hypothetical protein HMPREF9341_00405 [Propionibacterium acnes
           HL103PA1]
          Length = 158

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/89 (29%), Positives = 51/89 (57%), Gaps = 5/89 (5%)

Query: 40  TPKSRNWNGKFPKTLGRL-----IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIAR 94
             +  N +G    T+ R      + IG ++ ++ + S ++G+ C+Y P+CS YG  A+  
Sbjct: 7   PSRHPNDDGGVWATVRRFRPLTWLAIGFVKGWRALISPLYGDVCKYQPSCSTYGLRALQV 66

Query: 95  YGLWIGSWLTLLRLIKCNPLGSDGFDPVP 123
           +G++  + + + R+++CNP    G+DPVP
Sbjct: 67  HGVFRATPMIIWRILRCNPWSHGGYDPVP 95


>gi|189460191|ref|ZP_03008976.1| hypothetical protein BACCOP_00828 [Bacteroides coprocola DSM 17136]
 gi|189433052|gb|EDV02037.1| hypothetical protein BACCOP_00828 [Bacteroides coprocola DSM 17136]
          Length = 73

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 40/61 (65%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           I  Y+   S     SCR+ PTCS+Y  EA+ ++G + G +LT+ RL++C+P G  G+DPV
Sbjct: 13  IYFYRNCISPFTPPSCRFTPTCSQYAVEALKKHGPFKGLYLTIRRLLRCHPWGGSGYDPV 72

Query: 123 P 123
           P
Sbjct: 73  P 73


>gi|118469284|ref|YP_891136.1| hypothetical protein MSMEG_6944 [Mycobacterium smegmatis str. MC2
           155]
 gi|118170571|gb|ABK71467.1| conserved hypothetical protein, putative [Mycobacterium smegmatis
           str. MC2 155]
          Length = 115

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/65 (41%), Positives = 44/65 (67%)

Query: 60  IGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGF 119
           I +I++Y+   S +   +CR++PTCS+Y  +A+  YGL  G+WL  +RL+KC P    G+
Sbjct: 14  IYVIQLYRHTISPLRLPTCRFMPTCSQYAVDALTEYGLIRGTWLATVRLLKCGPWHQGGW 73

Query: 120 DPVPD 124
           DP+P+
Sbjct: 74  DPIPE 78


>gi|313904722|ref|ZP_07838096.1| protein of unknown function DUF37 [Eubacterium cellulosolvens 6]
 gi|313470515|gb|EFR65843.1| protein of unknown function DUF37 [Eubacterium cellulosolvens 6]
          Length = 74

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 34/74 (45%), Positives = 43/74 (58%), Gaps = 1/74 (1%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVF-GNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLI 109
            K  G+ + I  IR+YQ   S +  G  C YLPTCS+Y  EAI +YG   G  L   R++
Sbjct: 1   MKEPGKFVMIRGIRLYQKYLSPLKRGVRCPYLPTCSQYAVEAIEKYGAVKGGLLASWRIL 60

Query: 110 KCNPLGSDGFDPVP 123
           +CNPL   G DPVP
Sbjct: 61  RCNPLSHGGIDPVP 74


>gi|221195245|ref|ZP_03568301.1| conserved hypothetical protein [Atopobium rimae ATCC 49626]
 gi|221185148|gb|EEE17539.1| conserved hypothetical protein [Atopobium rimae ATCC 49626]
          Length = 78

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/73 (39%), Positives = 42/73 (57%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
             +      +  IR YQ   S +F   C Y PTCSEY  +AI +YG+  GS L + R+++
Sbjct: 6   RTSFLARCFLSAIRFYQRNISPLFRAHCIYTPTCSEYAVQAIQKYGVGKGSKLAIKRILR 65

Query: 111 CNPLGSDGFDPVP 123
           C+P  + G+DPVP
Sbjct: 66  CHPFHAGGYDPVP 78


>gi|115486819|ref|NP_001068553.1| Os11g0706100 [Oryza sativa Japonica Group]
 gi|113645775|dbj|BAF28916.1| Os11g0706100 [Oryza sativa Japonica Group]
 gi|218186225|gb|EEC68652.1| hypothetical protein OsI_37093 [Oryza sativa Indica Group]
 gi|222616448|gb|EEE52580.1| hypothetical protein OsJ_34875 [Oryza sativa Japonica Group]
          Length = 127

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 44/70 (62%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
             LG  + + +++ Y+   S +  +SCRY+PTCS+Y  +A  +YG+  G+ LT  RL  C
Sbjct: 46  NDLGVNVALSMLKFYKREISPLLPSSCRYVPTCSQYSMQAYKKYGVAKGTILTAWRLCHC 105

Query: 112 NPLGSDGFDP 121
           NPLG  G+DP
Sbjct: 106 NPLGGHGYDP 115


>gi|313771069|gb|EFS37035.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL074PA1]
 gi|313806853|gb|EFS45351.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL087PA2]
 gi|313815414|gb|EFS53128.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL059PA1]
 gi|313821535|gb|EFS59249.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL036PA1]
 gi|313832300|gb|EFS70014.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL007PA1]
 gi|314916210|gb|EFS80041.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL005PA4]
 gi|314959155|gb|EFT03257.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL002PA1]
 gi|314963876|gb|EFT07976.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL082PA1]
 gi|314969086|gb|EFT13184.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL037PA1]
 gi|314975195|gb|EFT19290.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL053PA1]
 gi|314985206|gb|EFT29298.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL005PA1]
 gi|314987115|gb|EFT31207.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL005PA2]
 gi|315078990|gb|EFT51002.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL053PA2]
 gi|315081500|gb|EFT53476.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL078PA1]
 gi|315083076|gb|EFT55052.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL027PA2]
 gi|315086610|gb|EFT58586.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL002PA3]
 gi|315102314|gb|EFT74290.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL046PA1]
 gi|315107501|gb|EFT79477.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL030PA1]
 gi|315109869|gb|EFT81845.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL030PA2]
 gi|327334554|gb|EGE76265.1| hypothetical protein HMPREF9344_00416 [Propionibacterium acnes
           HL097PA1]
 gi|327448832|gb|EGE95486.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL043PA1]
 gi|327454249|gb|EGF00904.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL087PA3]
 gi|328756007|gb|EGF69623.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL087PA1]
 gi|332676744|gb|AEE73560.1| conserved hypothetical protein [Propionibacterium acnes 266]
          Length = 158

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/89 (29%), Positives = 51/89 (57%), Gaps = 5/89 (5%)

Query: 40  TPKSRNWNGKFPKTLGRL-----IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIAR 94
             +  N +G    T+ R      + IG ++ ++ + S ++G+ C+Y P+CS YG  A+  
Sbjct: 7   PSRHPNDDGGVWATVRRFRPLTWLAIGFVKGWRALISPLYGDVCKYQPSCSTYGLRALQV 66

Query: 95  YGLWIGSWLTLLRLIKCNPLGSDGFDPVP 123
           +G++  + + + R+++CNP    G+DPVP
Sbjct: 67  HGVFRATPMIIWRILRCNPWSHGGYDPVP 95


>gi|238061910|ref|ZP_04606619.1| hypothetical protein MCAG_02876 [Micromonospora sp. ATCC 39149]
 gi|237883721|gb|EEP72549.1| hypothetical protein MCAG_02876 [Micromonospora sp. ATCC 39149]
          Length = 92

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/64 (42%), Positives = 38/64 (59%)

Query: 61  GIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFD 120
           G I  Y+   S      CR+ P+CS Y  EA+AR+G   G+ LT+ RL++C+P    G D
Sbjct: 17  GPIIAYRRWISPALPARCRFYPSCSAYALEAVARHGAIRGAGLTVRRLLRCHPFHPGGHD 76

Query: 121 PVPD 124
           PVP+
Sbjct: 77  PVPE 80


>gi|227485754|ref|ZP_03916070.1| alpha-hemolysin [Anaerococcus lactolyticus ATCC 51172]
 gi|227236309|gb|EEI86324.1| alpha-hemolysin [Anaerococcus lactolyticus ATCC 51172]
          Length = 71

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/71 (38%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGN-SCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           +   + I +IR YQ   S   G+  C+Y PTCS Y  EA  +YG     +++L R+++CN
Sbjct: 1   MLNKVFIKMIRFYQKFISPQLGHGKCKYYPTCSNYAIEAFKKYGPVKAFFMSLWRILRCN 60

Query: 113 PLGSDGFDPVP 123
           P    G+DPV 
Sbjct: 61  PFSKGGYDPVK 71


>gi|89074708|ref|ZP_01161166.1| hypothetical protein SKA34_17378 [Photobacterium sp. SKA34]
 gi|89049472|gb|EAR55033.1| hypothetical protein SKA34_17378 [Photobacterium sp. SKA34]
          Length = 65

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/65 (44%), Positives = 39/65 (60%), Gaps = 4/65 (6%)

Query: 70  FSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVPDDLPPK 129
            S + G  CR+ PTCS+Y  EA+  +G   G WL   RL+KC+PL   G+DPVP    P 
Sbjct: 3   ISPLLGPRCRFTPTCSQYAIEAVKTHGALKGCWLAAKRLLKCHPLNDGGYDPVP----PT 58

Query: 130 KNNPK 134
           K+N +
Sbjct: 59  KHNDR 63


>gi|120407005|ref|YP_956834.1| hypothetical protein Mvan_6076 [Mycobacterium vanbaalenii PYR-1]
 gi|119959823|gb|ABM16828.1| protein of unknown function DUF37 [Mycobacterium vanbaalenii PYR-1]
          Length = 115

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/65 (41%), Positives = 45/65 (69%)

Query: 60  IGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGF 119
           + +I++Y+   S +   +CR+ PTCS+Y  +A+  +GL+ G WL L+RL+KC P  + G+
Sbjct: 12  VYLIQLYRHTISPLRLPTCRFTPTCSQYAVDALTEFGLFRGGWLALVRLLKCGPWHNGGW 71

Query: 120 DPVPD 124
           DP+PD
Sbjct: 72  DPIPD 76


>gi|62733163|gb|AAX95280.1| hypothetical protein LOC_Os11g47930 [Oryza sativa Japonica Group]
 gi|77552721|gb|ABA95518.1| expressed protein [Oryza sativa Japonica Group]
          Length = 176

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 44/70 (62%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
             LG  + + +++ Y+   S +  +SCRY+PTCS+Y  +A  +YG+  G+ LT  RL  C
Sbjct: 46  NDLGVNVALSMLKFYKREISPLLPSSCRYVPTCSQYSMQAYKKYGVAKGTILTAWRLCHC 105

Query: 112 NPLGSDGFDP 121
           NPLG  G+DP
Sbjct: 106 NPLGGHGYDP 115


>gi|153940573|ref|YP_001393002.1| hypothetical protein CLI_3891 [Clostridium botulinum F str.
           Langeland]
 gi|168181113|ref|ZP_02615777.1| conserved hypothetical protein TIGR00278 [Clostridium botulinum
           NCTC 2916]
 gi|226951098|ref|YP_002806189.1| hypothetical protein TIGR00278 [Clostridium botulinum A2 str.
           Kyoto]
 gi|166201479|sp|A7GJP2|Y3891_CLOBL RecName: Full=UPF0161 protein CLI_3891
 gi|254803871|sp|C1FP34|Y4151_CLOBJ RecName: Full=UPF0161 protein CLM_4151
 gi|152936469|gb|ABS41967.1| conserved hypothetical protein TIGR00278 [Clostridium botulinum F
           str. Langeland]
 gi|182668157|gb|EDT80136.1| conserved hypothetical protein TIGR00278 [Clostridium botulinum
           NCTC 2916]
 gi|226843918|gb|ACO86584.1| conserved hypothetical protein TIGR00278 [Clostridium botulinum A2
           str. Kyoto]
 gi|295320978|gb|ADG01356.1| conserved hypothetical protein TIGR00278 [Clostridium botulinum F
           str. 230613]
 gi|322807970|emb|CBZ05545.1| protein YidD [Clostridium botulinum H04402 065]
          Length = 69

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/69 (39%), Positives = 44/69 (63%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I II++Y+   S +   SCR+ PTCS+Y  EAI +YG   G+ +++ R++KC+P 
Sbjct: 1   MKNLLICIIKMYRKYISPLKRPSCRFYPTCSQYSLEAIEKYGALKGTLISIKRILKCHPF 60

Query: 115 GSDGFDPVP 123
              G+DPV 
Sbjct: 61  NEGGYDPVK 69


>gi|328757979|gb|EGF71595.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL020PA1]
          Length = 158

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/89 (29%), Positives = 51/89 (57%), Gaps = 5/89 (5%)

Query: 40  TPKSRNWNGKFPKTLGRL-----IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIAR 94
             +  N +G    T+ R      + IG ++ ++ + S ++G+ C+Y P+CS YG  A+  
Sbjct: 7   PSRHPNDDGGVWATVRRFRPLTWLAIGFVKGWRALISPLYGDVCKYQPSCSTYGLRALQV 66

Query: 95  YGLWIGSWLTLLRLIKCNPLGSDGFDPVP 123
           +G++  + + + R+++CNP    G+DPVP
Sbjct: 67  HGVFRATPMIIWRILRCNPWSHGGYDPVP 95


>gi|229829515|ref|ZP_04455584.1| hypothetical protein GCWU000342_01607 [Shuttleworthia satelles DSM
           14600]
 gi|229791946|gb|EEP28060.1| hypothetical protein GCWU000342_01607 [Shuttleworthia satelles DSM
           14600]
          Length = 91

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 36/83 (43%), Positives = 49/83 (59%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R + + +IRIYQ   S +  + C Y PTCS YGYEAI+R+G  +G  L   R+++CNP 
Sbjct: 1   MRELLLRLIRIYQKYISPMKRSRCPYSPTCSAYGYEAISRHGALVGGLLAAYRVLRCNPF 60

Query: 115 GSDGFDPVPDDLPPKKNNPKLLS 137
              G DPVP D    +   KL+S
Sbjct: 61  SHGGIDPVPRDREEIRRRYKLIS 83


>gi|309390348|gb|ADO78228.1| protein of unknown function DUF37 [Halanaerobium praevalens DSM
           2228]
          Length = 69

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 31/68 (45%), Positives = 42/68 (61%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I +  I IYQ I S     SCR+ PTCSEY  +AI +YG + G W  L R+++C+P 
Sbjct: 1   MKKILLFFIIIYQKIISPWTPKSCRFRPTCSEYTKQAIKKYGAFKGFWKGLKRILRCHPF 60

Query: 115 GSDGFDPV 122
            S G+DPV
Sbjct: 61  NSGGYDPV 68


>gi|220930847|ref|YP_002507756.1| hypothetical protein Ccel_3489 [Clostridium cellulolyticum H10]
 gi|254765059|sp|B8I2B3|Y3489_CLOCE RecName: Full=UPF0161 protein Ccel_3489
 gi|220001175|gb|ACL77776.1| protein of unknown function DUF37 [Clostridium cellulolyticum H10]
          Length = 71

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNV-FGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           + + I I IIR YQ   S +    +CR+ PTCS+Y  EA+ +YG   G++L L R++KC+
Sbjct: 1   MLKRILISIIRFYQRFISPIKVRPTCRFYPTCSQYAIEAVTKYGCVKGTFLALKRILKCH 60

Query: 113 PLGSDGFDPVP 123
           P    GFDP+ 
Sbjct: 61  PFHPGGFDPIK 71


>gi|83747143|ref|ZP_00944186.1| Hypothetical cytosolic protein [Ralstonia solanacearum UW551]
 gi|207727481|ref|YP_002255875.1| hypothetical protein RSMK03774 [Ralstonia solanacearum MolK2]
 gi|207741913|ref|YP_002258305.1| hypothetical protein RSIPO_00092 [Ralstonia solanacearum IPO1609]
 gi|83726118|gb|EAP73253.1| Hypothetical cytosolic protein [Ralstonia solanacearum UW551]
 gi|206590718|emb|CAQ56330.1| conserved hypothetical protein [Ralstonia solanacearum MolK2]
 gi|206593299|emb|CAQ60226.1| conserved hypothetical protein [Ralstonia solanacearum IPO1609]
          Length = 104

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/69 (39%), Positives = 44/69 (63%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              + + ++R+Y++ FS   G  CR+LPTCS+Y  +A+  +G  +GS+L   RL +C+P 
Sbjct: 1   MTRVLLFLLRVYKVAFSPFVGAQCRFLPTCSDYARDAVLTHGPALGSYLAAKRLCRCHPF 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  AQGGYDPVP 69


>gi|296134497|ref|YP_003641744.1| protein of unknown function DUF37 [Thermincola sp. JR]
 gi|296033075|gb|ADG83843.1| protein of unknown function DUF37 [Thermincola potens JR]
          Length = 68

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/68 (39%), Positives = 41/68 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I  ++IY+   S +   +CR+ PTCSEY   A+ RYG+  G +  L R++KC+P 
Sbjct: 1   MKYILIMFVKIYRAFISPLKPATCRFYPTCSEYTILALERYGVMRGGFKALKRILKCHPF 60

Query: 115 GSDGFDPV 122
              G+DPV
Sbjct: 61  HPGGYDPV 68


>gi|123967998|ref|YP_001008856.1| hypothetical protein A9601_04611 [Prochlorococcus marinus str.
           AS9601]
 gi|157412823|ref|YP_001483689.1| hypothetical protein P9215_04871 [Prochlorococcus marinus str. MIT
           9215]
 gi|123198108|gb|ABM69749.1| Uncharacterized conserved protein [Prochlorococcus marinus str.
           AS9601]
 gi|157387398|gb|ABV50103.1| Conserved hypothetical protein [Prochlorococcus marinus str. MIT
           9215]
          Length = 63

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 37/63 (58%), Positives = 44/63 (69%)

Query: 62  IIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDP 121
           +I  YQ  FS  FG  CR++P+CS YGYEAI R+G W G WLTL RL +C+PL   G DP
Sbjct: 1   MISFYQKWFSPFFGPRCRFIPSCSSYGYEAITRHGPWKGGWLTLKRLSRCHPLTPCGCDP 60

Query: 122 VPD 124
           VPD
Sbjct: 61  VPD 63


>gi|170757706|ref|YP_001783281.1| hypothetical protein CLD_0828 [Clostridium botulinum B1 str. Okra]
 gi|226708088|sp|B1IHS2|Y828_CLOBK RecName: Full=UPF0161 protein CLD_0828
 gi|169122918|gb|ACA46754.1| conserved hypothetical protein TIGR00278 [Clostridium botulinum B1
           str. Okra]
          Length = 69

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/69 (39%), Positives = 44/69 (63%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I II++Y+   S +   SCR+ PTCS+Y  EAI +YG   G+ +++ R++KC+P 
Sbjct: 1   MKNLLICIIKMYRKYISPLKRPSCRFYPTCSQYSLEAIEKYGALKGTLISIKRILKCHPF 60

Query: 115 GSDGFDPVP 123
              G+DPV 
Sbjct: 61  NKGGYDPVK 69


>gi|157827456|ref|YP_001496520.1| hypothetical protein A1I_05805 [Rickettsia bellii OSU 85-389]
 gi|166229077|sp|A8GX83|Y5805_RICB8 RecName: Full=UPF0161 protein A1I_05805
 gi|157802760|gb|ABV79483.1| hypothetical protein A1I_05805 [Rickettsia bellii OSU 85-389]
          Length = 73

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFG-NSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
              I + ++  Y+   S + G N+CR+ PTCS+Y  EA+  +G   G WL   R+IKC P
Sbjct: 1   MTRILLLLLTFYRYFISPLLGGNNCRFYPTCSKYAKEALNTHGGIKGLWLIFKRIIKCQP 60

Query: 114 LGSDGFDPVPDD 125
           L   G+DPVP  
Sbjct: 61  LCDGGYDPVPPT 72


>gi|312113790|ref|YP_004011386.1| hypothetical protein Rvan_1013 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311218919|gb|ADP70287.1| protein of unknown function DUF37 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 108

 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 47/79 (59%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
           P    ++I    I +Y+   S + G  CR+LPTCS+Y  +AI   G W+G WLTL R+++
Sbjct: 5   PAKALKVIAKSPIYVYRYAISPIIGPRCRHLPTCSQYALDAIDVNGAWLGGWLTLGRILR 64

Query: 111 CNPLGSDGFDPVPDDLPPK 129
           C+P GS G DP PD    K
Sbjct: 65  CHPWGSSGCDPAPDLRAEK 83


>gi|213581267|ref|ZP_03363093.1| hypothetical protein SentesTyph_08705 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
          Length = 67

 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 31/67 (46%), Positives = 45/67 (67%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
              P + G  + I +IR+YQ + S + G  CR+ PTCS YG EA+ R+G+  GSWLT+ R
Sbjct: 1   MAPPLSPGSRVLIALIRVYQRLISPLLGPHCRFTPTCSSYGIEALRRFGVIKGSWLTVKR 60

Query: 108 LIKCNPL 114
           ++KC+PL
Sbjct: 61  VLKCHPL 67


>gi|220926911|ref|YP_002502213.1| hypothetical protein Mnod_7170 [Methylobacterium nodulans ORS 2060]
 gi|254806587|sp|B8IKC5|Y7170_METNO RecName: Full=UPF0161 protein Mnod_7170
 gi|219951518|gb|ACL61910.1| protein of unknown function DUF37 [Methylobacterium nodulans ORS
           2060]
          Length = 111

 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 35/75 (46%), Positives = 45/75 (60%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           +L R      IR YQL  S + G  CR+ P+CS Y  EAI R+GLW G W+ L R+ +C 
Sbjct: 2   SLPRRAAHVAIRGYQLTLSGLVGRQCRHWPSCSAYTDEAIERHGLWAGGWMGLARICRCG 61

Query: 113 PLGSDGFDPVPDDLP 127
           P G+ G D VP+ LP
Sbjct: 62  PFGTHGIDLVPERLP 76


>gi|322382809|ref|ZP_08056653.1| hypothetical protein PL1_3505 [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321153278|gb|EFX45724.1| hypothetical protein PL1_3505 [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 83

 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 40/81 (49%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + +    IR Y+   S +   +CR+ P+CS Y  EAI  +G   GSWL L R+ KC+P
Sbjct: 1   MMKKMVQAPIRFYRKWISPLKPPTCRFYPSCSIYALEAIEEHGAAYGSWLALKRICKCHP 60

Query: 114 LGSDGFDPVPDDLPPKKNNPK 134
               G D V      K +  K
Sbjct: 61  FHPGGVDHVSPSTRKKHSGSK 81


>gi|320333666|ref|YP_004170377.1| hypothetical protein Deima_1059 [Deinococcus maricopensis DSM
           21211]
 gi|319754955|gb|ADV66712.1| UPF0161 protein yidD [Deinococcus maricopensis DSM 21211]
          Length = 90

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 31/76 (40%), Positives = 47/76 (61%), Gaps = 2/76 (2%)

Query: 59  GIGIIRIYQLIFSNVFG-NSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
            IG +R YQ + S   G  +CR+ PTCSEY  +A+A++G   G+ L   R+ +C+PL   
Sbjct: 16  MIGGVRFYQRVLSPRKGVPTCRFTPTCSEYAAQALAQHGALRGTLLAARRIARCHPLHPG 75

Query: 118 GFDPVPDDLPPKKNNP 133
           G+DPVP   P ++ +P
Sbjct: 76  GYDPVPP-PPSERTHP 90


>gi|262038126|ref|ZP_06011527.1| conserved hypothetical protein YidD [Leptotrichia goodfellowii
           F0264]
 gi|261747850|gb|EEY35288.1| conserved hypothetical protein YidD [Leptotrichia goodfellowii
           F0264]
          Length = 69

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 45/67 (67%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I + +I+IYQ  FS  FG  CR+ PTCSEY  +A+ +YG+  G +L++ R++KC+P 
Sbjct: 1   MKHILLFLIKIYQKFFSGAFGRKCRFYPTCSEYARQAVTKYGVIKGVYLSVKRILKCHPF 60

Query: 115 GSDGFDP 121
              G+DP
Sbjct: 61  HKGGYDP 67


>gi|307297277|ref|ZP_07577083.1| protein of unknown function DUF37 [Thermotogales bacterium
           mesG1.Ag.4.2]
 gi|306916537|gb|EFN46919.1| protein of unknown function DUF37 [Thermotogales bacterium
           mesG1.Ag.4.2]
          Length = 80

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/80 (37%), Positives = 41/80 (51%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I + +I  Y+   S      CR+ PTCS Y YEAI R+G   G  L + R+I+CN  
Sbjct: 1   MKKILLFLIDFYRKKISPRTRPRCRFSPTCSTYTYEAIERFGALKGLILGIWRIIRCNSF 60

Query: 115 GSDGFDPVPDDLPPKKNNPK 134
              GFD VPD     + + K
Sbjct: 61  NPGGFDEVPDHFTLLRRHEK 80


>gi|171464338|ref|YP_001798451.1| protein of unknown function DUF37 [Polynucleobacter necessarius
           subsp. necessarius STIR1]
 gi|171193876|gb|ACB44837.1| protein of unknown function DUF37 [Polynucleobacter necessarius
           subsp. necessarius STIR1]
          Length = 80

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/63 (42%), Positives = 39/63 (61%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            I +I+IYQL  S  FG  C+Y+P+CS+Y  E  + YG   G  L + R+++CNP    G
Sbjct: 8   AIKLIKIYQLALSPYFGMHCKYVPSCSQYACECFSYYGFIKGFGLMVWRILRCNPWSRGG 67

Query: 119 FDP 121
           +DP
Sbjct: 68  YDP 70


>gi|94967249|ref|YP_589297.1| hypothetical protein Acid345_0218 [Candidatus Koribacter versatilis
           Ellin345]
 gi|116256197|sp|Q1IV77|Y218_ACIBL RecName: Full=UPF0161 protein Acid345_0218
 gi|94549299|gb|ABF39223.1| protein of unknown function DUF37 [Candidatus Koribacter versatilis
           Ellin345]
          Length = 88

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 44/69 (63%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + + +++ Y+   S +   SCRY+PTCSEY  EAI+ +G   GS L L RL++C+P 
Sbjct: 1   MKAVLVQMLKGYKRWISPLLPVSCRYVPTCSEYAMEAISIHGAVRGSVLALGRLLRCHPF 60

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 61  VRGGYDPVP 69


>gi|94676717|ref|YP_588604.1| hypothetical protein BCI_0135 [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
 gi|116256134|sp|Q1LTW0|Y135_BAUCH RecName: Full=UPF0161 protein BCI_0135
 gi|94219867|gb|ABF14026.1| conserved hypothetical protein TIGR00278 [Baumannia cicadellinicola
           str. Hc (Homalodisca coagulata)]
          Length = 85

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 33/69 (47%), Positives = 47/69 (68%)

Query: 62  IIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDP 121
           +IR YQLI S +    CR+LPTCS+Y   AI R+G++ G WLTL+R+++CNP    G D 
Sbjct: 15  VIRCYQLIISPLIKPHCRFLPTCSQYSITAIHRFGIFKGIWLTLIRILRCNPWSQGGEDQ 74

Query: 122 VPDDLPPKK 130
           VP ++  K+
Sbjct: 75  VPLNIFDKR 83


>gi|240138855|ref|YP_002963330.1| hypothetical protein MexAM1_META1p2267 [Methylobacterium extorquens
           AM1]
 gi|254561462|ref|YP_003068557.1| hypothetical protein METDI3049 [Methylobacterium extorquens DM4]
 gi|240008827|gb|ACS40053.1| Conserved hypothetical protein, UPF0161 protein [Methylobacterium
           extorquens AM1]
 gi|254268740|emb|CAX24701.1| Conserved hypothetical protein, UPF0161 protein [Methylobacterium
           extorquens DM4]
          Length = 106

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 34/76 (44%), Positives = 45/76 (59%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + R    G IR YQL  S + G  CR+ P+CS Y  EAI R+GLW G W+   R+ +C P
Sbjct: 1   MVRRAAHGAIRAYQLTLSGLIGRQCRHWPSCSAYTDEAIQRHGLWAGGWIGFARICRCGP 60

Query: 114 LGSDGFDPVPDDLPPK 129
            G+ G D VP+ LP +
Sbjct: 61  FGTHGIDLVPEHLPER 76


>gi|153854258|ref|ZP_01995557.1| hypothetical protein DORLON_01551 [Dorea longicatena DSM 13814]
 gi|149753033|gb|EDM62964.1| hypothetical protein DORLON_01551 [Dorea longicatena DSM 13814]
          Length = 70

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 43/70 (61%), Gaps = 1/70 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFG-NSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
            + I +  IR YQ   S + G ++C++ PTCS+Y  EAI +YG   G  L + R+++CNP
Sbjct: 1   MKKILLTGIRFYQRYLSPIKGGSTCKFYPTCSQYAKEAIEKYGALKGGRLAVWRILRCNP 60

Query: 114 LGSDGFDPVP 123
               G+DPVP
Sbjct: 61  FTRGGYDPVP 70


>gi|23012079|ref|ZP_00052254.1| COG0759: Uncharacterized conserved protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 108

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 36/79 (45%), Positives = 46/79 (58%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
              L R    G IR YQL  S + G  CR+ P+CS Y  EAI R+GLW G W+ L R+ +
Sbjct: 1   MNRLVRRAAHGAIRTYQLTLSGLVGRQCRHWPSCSAYTDEAIQRHGLWAGGWIGLARICR 60

Query: 111 CNPLGSDGFDPVPDDLPPK 129
           C P G+ G D VP+ LP +
Sbjct: 61  CGPFGTHGIDLVPERLPER 79


>gi|284928859|ref|YP_003421381.1| hypothetical protein UCYN_02780 [cyanobacterium UCYN-A]
 gi|284809318|gb|ADB95023.1| conserved hypothetical protein TIGR00278 [cyanobacterium UCYN-A]
          Length = 100

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/76 (35%), Positives = 42/76 (55%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           + +   I + +I+ Y+   S     SCR+ PTCSEY  EA+ R+G   G+ L + R  +C
Sbjct: 24  QLVSTKILLILIKGYKKYISPFLPPSCRFQPTCSEYMLEAVERFGPLHGTLLGVKRFFRC 83

Query: 112 NPLGSDGFDPVPDDLP 127
           NP  +  +DPVP  + 
Sbjct: 84  NPFSTPKYDPVPPKVK 99


>gi|296875978|ref|ZP_06900037.1| alpha-hemolysin family protein [Streptococcus parasanguinis ATCC
           15912]
 gi|296433053|gb|EFH18841.1| alpha-hemolysin family protein [Streptococcus parasanguinis ATCC
           15912]
          Length = 80

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/77 (37%), Positives = 46/77 (59%), Gaps = 1/77 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I I ++R YQ   S +F  SCR+ PTCS Y  +AI R+G+  G  + + R+++C+P 
Sbjct: 1   MKKILIAMVRGYQKWISPIFPPSCRFQPTCSNYMIQAIERFGV-KGVLMGVARILRCHPG 59

Query: 115 GSDGFDPVPDDLPPKKN 131
              G DP+PD    ++N
Sbjct: 60  TQAGPDPLPDHFSLRRN 76


>gi|255527589|ref|ZP_05394453.1| protein of unknown function DUF37 [Clostridium carboxidivorans P7]
 gi|296186787|ref|ZP_06855188.1| conserved hypothetical protein YidD [Clostridium carboxidivorans
           P7]
 gi|255508722|gb|EET85098.1| protein of unknown function DUF37 [Clostridium carboxidivorans P7]
 gi|296048501|gb|EFG87934.1| conserved hypothetical protein YidD [Clostridium carboxidivorans
           P7]
          Length = 69

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 24/69 (34%), Positives = 40/69 (57%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   I  I+ Y+   S +    CR+ PTCS+Y  +A+ +YG+  G +L + R+++CNP 
Sbjct: 1   MKEFLIFFIKSYRKYISPLKRPCCRFYPTCSQYALDALEKYGVLKGGFLAIKRILRCNPF 60

Query: 115 GSDGFDPVP 123
              G+DPV 
Sbjct: 61  NKGGYDPVK 69


>gi|218530496|ref|YP_002421312.1| hypothetical protein Mchl_2542 [Methylobacterium chloromethanicum
           CM4]
 gi|218522799|gb|ACK83384.1| protein of unknown function DUF37 [Methylobacterium
           chloromethanicum CM4]
          Length = 115

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 34/76 (44%), Positives = 45/76 (59%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + R    G IR YQL  S + G  CR+ P+CS Y  EAI R+GLW G W+   R+ +C P
Sbjct: 10  VVRRAAHGAIRAYQLTLSGLIGRQCRHWPSCSTYTDEAIQRHGLWAGGWIGFARICRCGP 69

Query: 114 LGSDGFDPVPDDLPPK 129
            G+ G D VP+ LP +
Sbjct: 70  FGTHGIDLVPEHLPER 85


>gi|18311640|ref|NP_563574.1| hypothetical protein CPE2658 [Clostridium perfringens str. 13]
 gi|110799979|ref|YP_697349.1| hypothetical protein CPF_2995 [Clostridium perfringens ATCC 13124]
 gi|110801742|ref|YP_699907.1| hypothetical protein CPR_2672 [Clostridium perfringens SM101]
 gi|168211554|ref|ZP_02637179.1| conserved hypothetical protein TIGR00278 [Clostridium perfringens B
           str. ATCC 3626]
 gi|168214846|ref|ZP_02640471.1| conserved hypothetical protein TIGR00278 [Clostridium perfringens
           CPE str. F4969]
 gi|169343480|ref|ZP_02864480.1| conserved hypothetical protein TIGR00278 [Clostridium perfringens C
           str. JGS1495]
 gi|182626412|ref|ZP_02954165.1| conserved hypothetical protein TIGR00278 [Clostridium perfringens D
           str. JGS1721]
 gi|25009633|sp|Q8XH27|Y2658_CLOPE RecName: Full=UPF0161 protein CPE2658
 gi|123047101|sp|Q0SPQ0|Y2672_CLOPS RecName: Full=UPF0161 protein CPR_2672
 gi|123148449|sp|Q0TLZ1|Y2995_CLOP1 RecName: Full=UPF0161 protein CPF_2995
 gi|18146324|dbj|BAB82364.1| conserved hypothetical protein [Clostridium perfringens str. 13]
 gi|110674626|gb|ABG83613.1| conserved hypothetical protein TIGR00278 [Clostridium perfringens
           ATCC 13124]
 gi|110682243|gb|ABG85613.1| conserved hypothetical protein TIGR00278 [Clostridium perfringens
           SM101]
 gi|169298432|gb|EDS80521.1| conserved hypothetical protein TIGR00278 [Clostridium perfringens C
           str. JGS1495]
 gi|170710457|gb|EDT22639.1| conserved hypothetical protein TIGR00278 [Clostridium perfringens B
           str. ATCC 3626]
 gi|170713707|gb|EDT25889.1| conserved hypothetical protein TIGR00278 [Clostridium perfringens
           CPE str. F4969]
 gi|177908286|gb|EDT70839.1| conserved hypothetical protein TIGR00278 [Clostridium perfringens D
           str. JGS1721]
          Length = 69

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 43/69 (62%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I +I+ Y+   S +    CR+ PTCS+Y  EAI +YG + G ++++ R+++CNP 
Sbjct: 1   MKKLFIVMIKFYRKYISPLKRPCCRFYPTCSQYALEAIQKYGAFKGGFMSIGRILRCNPF 60

Query: 115 GSDGFDPVP 123
              G+DPV 
Sbjct: 61  CKGGYDPVK 69


>gi|328946936|ref|YP_004364273.1| hypothetical protein Tresu_0006 [Treponema succinifaciens DSM 2489]
 gi|328447260|gb|AEB12976.1| UPF0161 protein yidD [Treponema succinifaciens DSM 2489]
          Length = 65

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 26/65 (40%), Positives = 39/65 (60%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            +  IR YQ+  S +F   CRY P+CS Y  E+I ++G   G +  + R+++CNP    G
Sbjct: 1   MVLFIRFYQVCISPLFPPCCRYTPSCSAYALESIQKHGPVKGLYFAIKRILRCNPFCKGG 60

Query: 119 FDPVP 123
           +DPVP
Sbjct: 61  YDPVP 65


>gi|86749302|ref|YP_485798.1| hypothetical protein RPB_2181 [Rhodopseudomonas palustris HaA2]
 gi|116256196|sp|Q2IY23|Y2181_RHOP2 RecName: Full=UPF0161 protein RPB_2181
 gi|86572330|gb|ABD06887.1| Protein of unknown function DUF37 [Rhodopseudomonas palustris HaA2]
          Length = 121

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 55/75 (73%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           L R  G G+I +Y+  FS + G++CR+LPTCS+YG EAI R+GLW G W+TL RLI+CNP
Sbjct: 19  LPRNAGRGLIWVYRHSFSALVGSNCRHLPTCSQYGDEAIGRFGLWAGGWMTLARLIRCNP 78

Query: 114 LGSDGFDPVPDDLPP 128
            G+ G D VP+  PP
Sbjct: 79  YGTSGIDNVPETPPP 93


>gi|145597100|ref|YP_001161397.1| hypothetical protein Strop_4591 [Salinispora tropica CNB-440]
 gi|145306437|gb|ABP57019.1| protein of unknown function DUF37 [Salinispora tropica CNB-440]
          Length = 79

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/70 (38%), Positives = 40/70 (57%)

Query: 61  GIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFD 120
           G I  Y+   S      CR+ P+CS Y  EA+ R+G   G+ LT+ RL++C+P    GFD
Sbjct: 4   GPIIAYRRWISPALPARCRFYPSCSAYALEAVTRHGPVRGAGLTVRRLMRCHPFHPGGFD 63

Query: 121 PVPDDLPPKK 130
           PVP+    ++
Sbjct: 64  PVPEPDCRRR 73


>gi|260437686|ref|ZP_05791502.1| putative toxin-antitoxin system, toxin component [Butyrivibrio
           crossotus DSM 2876]
 gi|292809912|gb|EFF69117.1| putative toxin-antitoxin system, toxin component [Butyrivibrio
           crossotus DSM 2876]
          Length = 70

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 44/70 (62%), Gaps = 1/70 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGN-SCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
            + I I +I+ Y+   S +  + +C Y PTCS+Y  EAI +YG + G  LT+ R+++CNP
Sbjct: 1   MKKILIKMIKFYKKNISPLKKHATCIYTPTCSQYAIEAIEKYGAFKGGLLTIWRILRCNP 60

Query: 114 LGSDGFDPVP 123
               G+DPVP
Sbjct: 61  FAKGGYDPVP 70


>gi|187735749|ref|YP_001877861.1| protein of unknown function DUF37 [Akkermansia muciniphila ATCC
           BAA-835]
 gi|187425801|gb|ACD05080.1| protein of unknown function DUF37 [Akkermansia muciniphila ATCC
           BAA-835]
          Length = 82

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 46/82 (56%), Gaps = 6/82 (7%)

Query: 54  LGRLIGIGIIRIYQLIFS-NVF-----GNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
           + + + I +++ YQ   S  +      G+ CRY PTCS+Y  +A+  +G W G  L   R
Sbjct: 1   MMKWLLITLVKGYQTFISAPLHALGGPGSGCRYTPTCSQYFIQAVHIHGAWRGFLLGTWR 60

Query: 108 LIKCNPLGSDGFDPVPDDLPPK 129
           +++CNP G  G+DPVP    P+
Sbjct: 61  ILRCNPWGGSGYDPVPPARHPR 82


>gi|332654815|ref|ZP_08420557.1| alpha-hemolysin [Ruminococcaceae bacterium D16]
 gi|332516158|gb|EGJ45766.1| alpha-hemolysin [Ruminococcaceae bacterium D16]
          Length = 72

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 3/72 (4%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + + +IR YQ   S +    CR++PTCS Y  EA+ +YG W G WL L R+++CNP 
Sbjct: 1   MKKLFLWLIRFYQREISPLRPPCCRFIPTCSAYALEAVEKYGAWKGGWLALRRILRCNPF 60

Query: 115 GSDG---FDPVP 123
                  +DPVP
Sbjct: 61  HRQKSIEYDPVP 72


>gi|226493408|ref|NP_001143857.1| hypothetical protein LOC100276648 [Zea mays]
 gi|195628386|gb|ACG36023.1| hypothetical protein [Zea mays]
          Length = 136

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 32/70 (45%), Positives = 45/70 (64%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           K  G  + + +++ Y+   S +  +SCRY+PTCSEY  +A  RYG+  GS LT  RL +C
Sbjct: 55  KDFGVNMALSMLKFYKREISPLLPSSCRYVPTCSEYSMQAYKRYGVVKGSILTAWRLCRC 114

Query: 112 NPLGSDGFDP 121
           NPLG  G+DP
Sbjct: 115 NPLGGYGYDP 124


>gi|313112581|ref|ZP_07798242.1| conserved hypothetical protein YidD [Faecalibacterium cf.
           prausnitzii KLE1255]
 gi|310625103|gb|EFQ08397.1| conserved hypothetical protein YidD [Faecalibacterium cf.
           prausnitzii KLE1255]
          Length = 104

 Score = 95.4 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 41/78 (52%), Gaps = 2/78 (2%)

Query: 56  RLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLG 115
           R      IR YQ   S   G SCR+ P+CS Y  +AI  +G   G  L   R+ +CNP G
Sbjct: 9   RRALCVPIRAYQYTLSPWIGRSCRFTPSCSNYTMQAIMTHGCVKGILLGAWRIARCNPFG 68

Query: 116 SDGFDPVPDDLPPKKNNP 133
             GFDPVP+  P +  NP
Sbjct: 69  KWGFDPVPE--PGRWQNP 84


>gi|324995020|gb|EGC26933.1| alpha-hemolysin family protein [Streptococcus sanguinis SK678]
          Length = 73

 Score = 95.4 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/72 (41%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 66  YQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVPDD 125
           YQ   S  F  SCR+ PTCS Y  EAI ++G   G  + L R+++C+P    G DPVPD 
Sbjct: 2   YQRFISPAFPPSCRFRPTCSNYMIEAIQKHGA-KGVLMGLARILRCHPWSQPGEDPVPDH 60

Query: 126 LPPKKNNPKLLS 137
              ++NN +  S
Sbjct: 61  FSLRRNNSRKKS 72


>gi|302388595|ref|YP_003824417.1| protein of unknown function DUF37 [Clostridium saccharolyticum WM1]
 gi|302199223|gb|ADL06794.1| protein of unknown function DUF37 [Clostridium saccharolyticum WM1]
          Length = 71

 Score = 95.4 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/71 (39%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNV-FGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           + + + I +IR YQ   S +     C Y PTCS+Y  EA+ +YG+  G++L   R+++CN
Sbjct: 1   MVKKVMILLIRGYQKYLSPLKIRTHCIYTPTCSQYAIEALTKYGVLKGTFLACKRILRCN 60

Query: 113 PLGSDGFDPVP 123
           P    G+DPVP
Sbjct: 61  PFAKGGYDPVP 71


>gi|226326143|ref|ZP_03801661.1| hypothetical protein COPCOM_03962 [Coprococcus comes ATCC 27758]
 gi|225205685|gb|EEG88039.1| hypothetical protein COPCOM_03962 [Coprococcus comes ATCC 27758]
          Length = 70

 Score = 95.4 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/70 (42%), Positives = 43/70 (61%), Gaps = 1/70 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNV-FGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
            + I + +IR Y+   S +     C Y+PTCSEY  EAI +YG + G  LT+ R+++CNP
Sbjct: 1   MKKILLYLIRFYRKYLSPMKVYTHCIYIPTCSEYALEAIEKYGAFKGGLLTVWRILRCNP 60

Query: 114 LGSDGFDPVP 123
               G+DPVP
Sbjct: 61  FAKGGYDPVP 70


>gi|139474354|ref|YP_001129070.1| hypothetical protein SpyM51547 [Streptococcus pyogenes str.
           Manfredo]
 gi|166231403|sp|A2RG89|Y1547_STRPG RecName: Full=UPF0161 protein SpyM51547
 gi|134272601|emb|CAM30868.1| conserved hypothetical protein [Streptococcus pyogenes str.
           Manfredo]
          Length = 86

 Score = 95.4 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I  ++ YQ   S +   SCRY PTCS Y   AI ++G   G  + + R+++C+P 
Sbjct: 1   MKKLLIVSVKAYQKYISPLSPPSCRYKPTCSAYMLTAIEKHGT-KGILMGIARILRCHPF 59

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G DPVP+D    +N 
Sbjct: 60  VDSGVDPVPEDFSLMRNK 77


>gi|78778791|ref|YP_396903.1| hypothetical protein PMT9312_0406 [Prochlorococcus marinus str. MIT
           9312]
 gi|78712290|gb|ABB49467.1| Protein of unknown function DUF37 [Prochlorococcus marinus str. MIT
           9312]
          Length = 63

 Score = 95.4 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 37/63 (58%), Positives = 44/63 (69%)

Query: 62  IIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDP 121
           +I  YQ  FS  FG  CR++P+CS YGYEAI R+G W G WLTL RL +C+PL   G DP
Sbjct: 1   MISFYQKWFSPFFGPRCRFIPSCSSYGYEAITRHGPWKGGWLTLRRLSRCHPLTPCGCDP 60

Query: 122 VPD 124
           VPD
Sbjct: 61  VPD 63


>gi|258512906|ref|YP_003186340.1| hypothetical protein Aaci_2948 [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257479632|gb|ACV59951.1| protein of unknown function DUF37 [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 72

 Score = 95.4 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 32/70 (45%), Positives = 42/70 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + IG IR YQ   S     +CR+ PTCSEY  +AIAR+G+  G WL + RL+KC P 
Sbjct: 1   MKRLVIGCIRFYQRYISPAKLPTCRFTPTCSEYAVQAIARFGVVYGGWLAVRRLVKCGPW 60

Query: 115 GSDGFDPVPD 124
              G D VP+
Sbjct: 61  HPGGVDEVPE 70


>gi|317970557|ref|ZP_07971947.1| hypothetical protein SCB02_13566 [Synechococcus sp. CB0205]
          Length = 75

 Score = 95.4 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 33/63 (52%), Positives = 43/63 (68%), Gaps = 1/63 (1%)

Query: 63  IRIYQLIFSNVFGN-SCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDP 121
           I  Y+L  S + G   CR++P+CS YG EAI R+G W GSWLT+ RL++C+P    G DP
Sbjct: 13  IGFYRLAISPLLGPPRCRFIPSCSAYGLEAIERHGPWRGSWLTIKRLLRCHPWTPCGCDP 72

Query: 122 VPD 124
           VPD
Sbjct: 73  VPD 75


>gi|188581476|ref|YP_001924921.1| hypothetical protein Mpop_2224 [Methylobacterium populi BJ001]
 gi|179344974|gb|ACB80386.1| protein of unknown function DUF37 [Methylobacterium populi BJ001]
          Length = 105

 Score = 95.4 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 34/76 (44%), Positives = 46/76 (60%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + R    G IR YQL  S + G  CR+ P+CS Y  EAI R+GLW G W+ + R+ +C P
Sbjct: 1   MVRRAAHGAIRAYQLTLSGLIGRQCRHWPSCSAYTDEAIQRHGLWAGGWIGVARICRCGP 60

Query: 114 LGSDGFDPVPDDLPPK 129
            G+ G D VP+ LP +
Sbjct: 61  FGTHGIDLVPERLPER 76


>gi|71083173|ref|YP_265892.1| hypothetical protein SAR11_0467 [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|91762398|ref|ZP_01264363.1| hypothetical protein PU1002_03996 [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|116256247|sp|Q4FNF0|Y467_PELUB RecName: Full=UPF0161 protein SAR11_0467
 gi|71062286|gb|AAZ21289.1| Uncharacterized conserved protein [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|91718200|gb|EAS84850.1| hypothetical protein PU1002_03996 [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 83

 Score = 95.4 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 45/82 (54%), Gaps = 4/82 (4%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
            +   I IG+I+ Y+++ S     SCRYLPTCSEY  E +  YGL      +  R+  C+
Sbjct: 2   NIISNILIGLIKFYKMVISPYLTPSCRYLPTCSEYTIECLRTYGLVKAISKSTKRIFSCH 61

Query: 113 PL----GSDGFDPVPDDLPPKK 130
           P+    G +GFDPV  +   KK
Sbjct: 62  PIKILGGGEGFDPVNKEFKAKK 83


>gi|159897294|ref|YP_001543541.1| hypothetical protein Haur_0765 [Herpetosiphon aurantiacus ATCC
           23779]
 gi|254806607|sp|A9AXJ9|Y765_HERA2 RecName: Full=UPF0161 protein Haur_0765
 gi|159890333|gb|ABX03413.1| protein of unknown function DUF37 [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 68

 Score = 95.4 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 43/67 (64%), Gaps = 1/67 (1%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            I + +IR+YQ         SC Y PTCS YGY+AIA+YG + G+WLTL R+ +C+P   
Sbjct: 3   KILLALIRLYQRFSR-YTPPSCIYTPTCSHYGYQAIAKYGAFKGTWLTLKRIARCHPWAQ 61

Query: 117 DGFDPVP 123
            G DPVP
Sbjct: 62  GGEDPVP 68


>gi|256827814|ref|YP_003151773.1| hypothetical protein Ccur_14190 [Cryptobacterium curtum DSM 15641]
 gi|256583957|gb|ACU95091.1| conserved hypothetical protein TIGR00278 [Cryptobacterium curtum
           DSM 15641]
          Length = 80

 Score = 95.0 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 32/72 (44%), Positives = 42/72 (58%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           K +   + I +I  Y++  S  F   CR+ PTCSEYG  A  RYG   G  LT  R++KC
Sbjct: 9   KKVPTQLAIFLIEAYRVTLSPHFPGCCRFEPTCSEYGLIAFRRYGFCKGFVLTAKRILKC 68

Query: 112 NPLGSDGFDPVP 123
           +P G  G+DPVP
Sbjct: 69  HPGGPHGYDPVP 80


>gi|309811403|ref|ZP_07705190.1| conserved hypothetical protein YidD [Dermacoccus sp. Ellin185]
 gi|308434710|gb|EFP58555.1| conserved hypothetical protein YidD [Dermacoccus sp. Ellin185]
          Length = 105

 Score = 95.0 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 26/64 (40%), Positives = 35/64 (54%)

Query: 64  RIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVP 123
           R Y+   S     +CR+ P+CS YG  A+ R+G   G+WLTL RL +C+P    G D VP
Sbjct: 41  RFYRRWISPALPATCRFYPSCSTYGLTALQRFGPIKGTWLTLKRLGRCHPWNPGGVDHVP 100

Query: 124 DDLP 127
               
Sbjct: 101 QKKT 104


>gi|196019086|ref|XP_002118921.1| hypothetical protein TRIADDRAFT_34951 [Trichoplax adhaerens]
 gi|190577701|gb|EDV18593.1| hypothetical protein TRIADDRAFT_34951 [Trichoplax adhaerens]
          Length = 87

 Score = 95.0 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
            L + I +  I IYQ I S +   SCRY P+CS Y  +++  +GL+ G  L + R++KCN
Sbjct: 7   KLFKTIILFFISIYQNIISPLIPQSCRYYPSCSNYAKDSLRIHGLF-GILLIVKRILKCN 65

Query: 113 PLGSDGFDPVPDDLPPKKNN 132
           P    G+DPVP     K+  
Sbjct: 66  PFFLGGYDPVPVKNNKKRKK 85


>gi|256830919|ref|YP_003159647.1| hypothetical protein Dbac_3156 [Desulfomicrobium baculatum DSM
           4028]
 gi|256580095|gb|ACU91231.1| protein of unknown function DUF37 [Desulfomicrobium baculatum DSM
           4028]
          Length = 77

 Score = 95.0 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 48/77 (62%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R + + I+ +YQ + S ++   CR+ P+CSEY  +A+  +G++ G  L   RL++C+PL
Sbjct: 1   MRHVFVRILSLYQYLISPLYSPCCRFTPSCSEYARQAVLSHGIFRGMGLAFWRLLRCHPL 60

Query: 115 GSDGFDPVPDDLPPKKN 131
            + G+DPVP     K++
Sbjct: 61  CAGGYDPVPTPNLSKRD 77


>gi|160941467|ref|ZP_02088802.1| hypothetical protein CLOBOL_06358 [Clostridium bolteae ATCC
           BAA-613]
 gi|158435613|gb|EDP13380.1| hypothetical protein CLOBOL_06358 [Clostridium bolteae ATCC
           BAA-613]
          Length = 70

 Score = 95.0 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 27/68 (39%), Positives = 39/68 (57%), Gaps = 1/68 (1%)

Query: 57  LIGIGIIRIYQLIFSNV-FGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLG 115
              I ++R YQ   S +     C Y PTCS+Y  EA+ +YG   G+WL   R+++C+P  
Sbjct: 3   RCLILLVRGYQKFLSPLKVRTHCIYTPTCSQYAIEALKKYGALKGTWLACKRILRCHPFA 62

Query: 116 SDGFDPVP 123
             G+DPVP
Sbjct: 63  EGGYDPVP 70


>gi|75910420|ref|YP_324716.1| hypothetical protein Ava_4222 [Anabaena variabilis ATCC 29413]
 gi|75704145|gb|ABA23821.1| Protein of unknown function DUF37 [Anabaena variabilis ATCC 29413]
          Length = 69

 Score = 95.0 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 39/57 (68%)

Query: 68  LIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVPD 124
           +  S +F  +CR+ PTCS Y  EAI R+G++ G W+ + R+++C+P    G+DPVP+
Sbjct: 1   MFISPLFPPTCRFQPTCSMYALEAIERFGVFRGGWMGIRRILRCHPFHPGGYDPVPE 57


>gi|163851690|ref|YP_001639733.1| hypothetical protein Mext_2267 [Methylobacterium extorquens PA1]
 gi|163663295|gb|ABY30662.1| protein of unknown function DUF37 [Methylobacterium extorquens PA1]
          Length = 106

 Score = 95.0 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 34/76 (44%), Positives = 45/76 (59%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + R    G IR YQL  S + G  CR+ P+CS Y  EAI R+GLW G W+   R+ +C P
Sbjct: 1   MVRRAAHGAIRAYQLTLSGLIGRQCRHWPSCSVYTDEAIQRHGLWAGGWIGFARICRCGP 60

Query: 114 LGSDGFDPVPDDLPPK 129
            G+ G D VP+ LP +
Sbjct: 61  FGTHGIDLVPEHLPER 76


>gi|238917978|ref|YP_002931495.1| ribonuclease P [Eubacterium eligens ATCC 27750]
 gi|238873338|gb|ACR73048.1| ribonuclease P [Eubacterium eligens ATCC 27750]
          Length = 93

 Score = 95.0 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 36/84 (42%), Positives = 51/84 (60%), Gaps = 3/84 (3%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNS-CRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
           K  G+ I + +IR+YQL  S   G   C ++PTCS+Y  EAI  YG+++G WL L R+++
Sbjct: 9   KNAGKFIVLKMIRLYQLAISPYKGGKYCSFIPTCSQYAIEAIEMYGVFLGGWLALKRILR 68

Query: 111 CNPLGSD--GFDPVPDDLPPKKNN 132
           CNP   +  GFDPVP     K+  
Sbjct: 69  CNPFNKNAYGFDPVPVGRYGKRKK 92


>gi|169832373|ref|YP_001718355.1| hypothetical protein Daud_2236 [Candidatus Desulforudis audaxviator
           MP104C]
 gi|259646607|sp|B1I6S5|Y2236_DESAP RecName: Full=UPF0161 protein Daud_2236
 gi|169639217|gb|ACA60723.1| protein of unknown function DUF37 [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 71

 Score = 95.0 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 27/67 (40%), Positives = 43/67 (64%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + IG+I+ YQ+  S  F ++CR+ PTCSEY  +AI +YGL  G    + R+++C+P 
Sbjct: 4   PQKLAIGLIKGYQVAISPFFPSTCRFYPTCSEYAVQAIGKYGLMRGGLRAVRRVLRCHPF 63

Query: 115 GSDGFDP 121
              G+DP
Sbjct: 64  SPGGYDP 70


>gi|163782853|ref|ZP_02177849.1| hypothetical protein HG1285_15996 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159881974|gb|EDP75482.1| hypothetical protein HG1285_15996 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 68

 Score = 95.0 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 25/66 (37%), Positives = 42/66 (63%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R + I ++R++Q++ S ++  SC+Y PTCSEY   A+ ++G + GS   L R+++CNP 
Sbjct: 1   MRWLLIKLLRLWQVVVSPLYPPSCKYHPTCSEYAVLAVEKHGAFKGSLKALWRVLRCNPW 60

Query: 115 GSDGFD 120
              G D
Sbjct: 61  SKGGVD 66


>gi|210614344|ref|ZP_03290163.1| hypothetical protein CLONEX_02377 [Clostridium nexile DSM 1787]
 gi|210150688|gb|EEA81697.1| hypothetical protein CLONEX_02377 [Clostridium nexile DSM 1787]
          Length = 70

 Score = 95.0 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 32/70 (45%), Positives = 45/70 (64%), Gaps = 1/70 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSC-RYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
            + I IG+I+ Y+   S +   SC +Y PTCS+YG EAI +YG   G  LT+ R+++CNP
Sbjct: 1   MKRIFIGLIKFYRKYLSGLKTASCCKYFPTCSQYGLEAIEKYGALKGGLLTVWRILRCNP 60

Query: 114 LGSDGFDPVP 123
               G+DPVP
Sbjct: 61  FSKGGYDPVP 70


>gi|290477351|ref|YP_003470272.1| hypothetical protein XBJ1_4411 [Xenorhabdus bovienii SS-2004]
 gi|289176705|emb|CBJ83514.1| conserved hypothetical protein [Xenorhabdus bovienii SS-2004]
          Length = 65

 Score = 95.0 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 33/63 (52%), Positives = 44/63 (69%), Gaps = 4/63 (6%)

Query: 69  IFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVPDDLPP 128
           + S + G  CR+ PTCS+YG EA+ R+G+  GSWLT+ R++KC+PL   G DPVP    P
Sbjct: 1   MISPLLGPRCRFHPTCSQYGIEALRRFGMIKGSWLTVKRILKCHPLHVGGDDPVP----P 56

Query: 129 KKN 131
           KKN
Sbjct: 57  KKN 59


>gi|254526087|ref|ZP_05138139.1| conserved hypothetical protein TIGR00278 [Prochlorococcus marinus
           str. MIT 9202]
 gi|221537511|gb|EEE39964.1| conserved hypothetical protein TIGR00278 [Prochlorococcus marinus
           str. MIT 9202]
          Length = 63

 Score = 95.0 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 36/63 (57%), Positives = 44/63 (69%)

Query: 62  IIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDP 121
           +I  YQ  FS  FG  CR++P+CS +GYEAI R+G W G WLTL RL +C+PL   G DP
Sbjct: 1   MISFYQKWFSPFFGPRCRFIPSCSSFGYEAITRHGPWKGGWLTLKRLSRCHPLTPCGCDP 60

Query: 122 VPD 124
           VPD
Sbjct: 61  VPD 63


>gi|163784044|ref|ZP_02179000.1| hypothetical protein HG1285_01308 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159880685|gb|EDP74233.1| hypothetical protein HG1285_01308 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 68

 Score = 95.0 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 28/66 (42%), Positives = 43/66 (65%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I +I++YQ  FS + GNSCRY P+CS Y  +AI +YG+  GS  ++ R+++CNP 
Sbjct: 1   MKKVIILLIKLYQKAFSPILGNSCRYYPSCSNYSIQAIEKYGVLKGSLKSVWRILRCNPF 60

Query: 115 GSDGFD 120
              G D
Sbjct: 61  SKGGID 66


>gi|255013077|ref|ZP_05285203.1| hypothetical protein B2_04173 [Bacteroides sp. 2_1_7]
 gi|256838684|ref|ZP_05544194.1| conserved hypothetical protein [Parabacteroides sp. D13]
 gi|262383072|ref|ZP_06076209.1| conserved hypothetical protein [Bacteroides sp. 2_1_33B]
 gi|298374039|ref|ZP_06983997.1| toxin-antitoxin system toxin component [Bacteroides sp. 3_1_19]
 gi|301307635|ref|ZP_07213592.1| putative toxin-antitoxin system, toxin component [Bacteroides sp.
           20_3]
 gi|256739603|gb|EEU52927.1| conserved hypothetical protein [Parabacteroides sp. D13]
 gi|262295950|gb|EEY83881.1| conserved hypothetical protein [Bacteroides sp. 2_1_33B]
 gi|298268407|gb|EFI10062.1| toxin-antitoxin system toxin component [Bacteroides sp. 3_1_19]
 gi|300834309|gb|EFK64922.1| putative toxin-antitoxin system, toxin component [Bacteroides sp.
           20_3]
          Length = 73

 Score = 95.0 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 26/73 (35%), Positives = 42/73 (57%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            +     + +  +  Y+   S +   SCRY PTCSEY  +A+ +YG   G +L + R+++
Sbjct: 1   MRRFFTTLLLLPVYFYKYCISPMTPASCRYTPTCSEYAVQALKKYGPVKGLYLAVKRILR 60

Query: 111 CNPLGSDGFDPVP 123
           C+P G  G+DPVP
Sbjct: 61  CHPWGGSGYDPVP 73


>gi|27380636|ref|NP_772165.1| hypothetical protein blr5525 [Bradyrhizobium japonicum USDA 110]
 gi|47606285|sp|Q89IV9|Y5525_BRAJA RecName: Full=UPF0161 protein blr5525
 gi|27353801|dbj|BAC50790.1| blr5525 [Bradyrhizobium japonicum USDA 110]
          Length = 112

 Score = 95.0 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 38/74 (51%), Positives = 49/74 (66%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           L R  G  +I +Y+   S + G +CR+LPTCS YG EAI R+GLW G W+TL RL++CNP
Sbjct: 19  LPRRFGRALIWLYRHTLSPLVGYNCRHLPTCSVYGDEAIERFGLWAGGWMTLARLLRCNP 78

Query: 114 LGSDGFDPVPDDLP 127
            G+ G D VP   P
Sbjct: 79  FGTSGIDNVPLAAP 92


>gi|297572342|ref|YP_003698116.1| hypothetical protein Arch_1819 [Arcanobacterium haemolyticum DSM
           20595]
 gi|296932689|gb|ADH93497.1| protein of unknown function DUF37 [Arcanobacterium haemolyticum DSM
           20595]
          Length = 110

 Score = 95.0 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 37/67 (55%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
           +    IR YQ   S      C+Y PTCS+Y  ++I  +G   G+ L++ RL++CNP    
Sbjct: 5   LLKKAIRWYQRNISAGLPRRCKYQPTCSQYALDSIEVHGAIKGTILSMWRLLRCNPWSKG 64

Query: 118 GFDPVPD 124
           G D VP+
Sbjct: 65  GVDWVPE 71


>gi|92117202|ref|YP_576931.1| hypothetical protein Nham_1654 [Nitrobacter hamburgensis X14]
 gi|116256142|sp|Q1QMS6|Y1654_NITHX RecName: Full=UPF0161 protein Nham_1654
 gi|91800096|gb|ABE62471.1| protein of unknown function DUF37 [Nitrobacter hamburgensis X14]
          Length = 114

 Score = 95.0 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 39/75 (52%), Positives = 49/75 (65%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           L R  G  +I IY+   S + G +CR+LPTCS YG EAI R+GLW G W+TL RL++C P
Sbjct: 21  LPRNSGRALIWIYRHTLSPLVGFNCRHLPTCSVYGDEAIERFGLWGGGWMTLARLLRCQP 80

Query: 114 LGSDGFDPVPDDLPP 128
            G+ G D VP   PP
Sbjct: 81  WGTSGIDNVPATKPP 95


>gi|240168406|ref|ZP_04747065.1| hypothetical protein MkanA1_03787 [Mycobacterium kansasii ATCC
           12478]
          Length = 103

 Score = 94.6 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 43/66 (65%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            I +I +Y+ + S +   SCR++PTCS+Y   A+  YGL  GSWLT+ RL KC P    G
Sbjct: 13  LIFVINLYRHMVSPLRPASCRFVPTCSQYAVAALTEYGLIRGSWLTVARLAKCGPWHRGG 72

Query: 119 FDPVPD 124
           +DP+P+
Sbjct: 73  WDPIPE 78


>gi|116256200|sp|Q6A5A3|Y2351_PROAC RecName: Full=UPF0161 protein PPA2351
          Length = 138

 Score = 94.6 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 22/70 (31%), Positives = 44/70 (62%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
               + IG ++ ++ + S ++G+ C+Y P+CS YG  A+  +G++  + + + R+++CNP
Sbjct: 6   PLTWLAIGFVKGWRALISPLYGDVCKYQPSCSTYGLRALQVHGVFRATPMIIWRILRCNP 65

Query: 114 LGSDGFDPVP 123
               G+DPVP
Sbjct: 66  WSHGGYDPVP 75


>gi|291548771|emb|CBL25033.1| conserved hypothetical protein TIGR00278 [Ruminococcus torques
           L2-14]
          Length = 70

 Score = 94.6 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 44/70 (62%), Gaps = 1/70 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGN-SCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
            + + + +IR Y+   S + G  +C+Y PTCS+YG EAI +YG   G  L + R+++CNP
Sbjct: 1   MKYVLLWMIRFYRKYLSGMKGGCTCKYYPTCSQYGLEAIEKYGALKGGALAVWRILRCNP 60

Query: 114 LGSDGFDPVP 123
               G+DPVP
Sbjct: 61  FSKGGYDPVP 70


>gi|237736112|ref|ZP_04566593.1| predicted protein [Fusobacterium mortiferum ATCC 9817]
 gi|229421823|gb|EEO36870.1| predicted protein [Fusobacterium mortiferum ATCC 9817]
          Length = 75

 Score = 94.6 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 28/60 (46%), Positives = 39/60 (65%)

Query: 66  YQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVPDD 125
           YQ   S   G +CR+ PTCS Y YEAI ++G+  G +L + R+IKC+P    G+DPVP+ 
Sbjct: 12  YQKYISIFLGKNCRFYPTCSAYTYEAIEKFGIIKGIFLGIKRIIKCHPFHPGGYDPVPEK 71


>gi|218296523|ref|ZP_03497251.1| protein of unknown function DUF37 [Thermus aquaticus Y51MC23]
 gi|218243065|gb|EED09597.1| protein of unknown function DUF37 [Thermus aquaticus Y51MC23]
          Length = 82

 Score = 94.6 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 25/66 (37%), Positives = 40/66 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R + I +++ Y+   S +   +CR+ PTCS Y  EA+ R+G  +GS+L   RL++C+PL
Sbjct: 1   MRGLLILLVKAYRRFISPLKPRTCRFHPTCSAYALEALERHGALLGSYLAARRLLRCHPL 60

Query: 115 GSDGFD 120
              G D
Sbjct: 61  HPGGLD 66


>gi|282892071|ref|ZP_06300548.1| hypothetical protein pah_c205o111 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281498113|gb|EFB40455.1| hypothetical protein pah_c205o111 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 69

 Score = 94.6 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 31/69 (44%), Positives = 42/69 (60%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I + +IR+YQL  S + G  CR+ PTCS+Y  EAI +YG   G  L L R+ +CNP 
Sbjct: 1   MKKITLFLIRLYQLFVSPMLGPICRFTPTCSQYAVEAIQKYGFSKGVSLALSRICRCNPR 60

Query: 115 GSDGFDPVP 123
              G DP+P
Sbjct: 61  CLGGHDPIP 69


>gi|256833764|ref|YP_003162491.1| hypothetical protein Jden_2556 [Jonesia denitrificans DSM 20603]
 gi|256687295|gb|ACV10188.1| protein of unknown function DUF37 [Jonesia denitrificans DSM 20603]
          Length = 113

 Score = 94.6 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 30/77 (38%), Positives = 39/77 (50%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            + II  YQ   S + G +CRY PTCS Y   AI R+G + G+ L   RL++C P    G
Sbjct: 12  ALQIILFYQRYISVLTGPTCRYHPTCSHYATTAIQRHGFFRGTRLAAWRLLRCVPWTPGG 71

Query: 119 FDPVPDDLPPKKNNPKL 135
            D VP  +      P L
Sbjct: 72  IDDVPPTVTRHPEPPAL 88


>gi|320103592|ref|YP_004179183.1| hypothetical protein Isop_2054 [Isosphaera pallida ATCC 43644]
 gi|319750874|gb|ADV62634.1| protein of unknown function DUF37 [Isosphaera pallida ATCC 43644]
          Length = 92

 Score = 94.6 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 42/73 (57%), Gaps = 7/73 (9%)

Query: 56  RLIGIGII---RIYQLIFSNVF----GNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRL 108
           RLI  G+I   R+YQ   S VF    G  CR+ PTCS Y  +AI ++G W G    L RL
Sbjct: 19  RLISAGLIGMTRLYQFTLSPVFTLLVGPVCRFEPTCSHYMIQAIQKHGPWRGLLKGLRRL 78

Query: 109 IKCNPLGSDGFDP 121
            +C+P G  G+DP
Sbjct: 79  SRCHPWGGHGYDP 91


>gi|254520699|ref|ZP_05132755.1| conserved hypothetical protein [Clostridium sp. 7_2_43FAA]
 gi|226914448|gb|EEH99649.1| conserved hypothetical protein [Clostridium sp. 7_2_43FAA]
          Length = 69

 Score = 94.6 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 24/69 (34%), Positives = 41/69 (59%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + I +  I +Y+   S +   +C Y+PTCS+Y  +AI +YG   G +L + R+++C+P 
Sbjct: 1   MKKIMLRSIYLYRKYISPMRPPTCIYVPTCSQYAIDAINKYGAIKGGFLAIKRILRCHPF 60

Query: 115 GSDGFDPVP 123
              G+DPV 
Sbjct: 61  AKGGYDPVK 69


>gi|295106383|emb|CBL03926.1| conserved hypothetical protein TIGR00278 [Gordonibacter pamelaeae
           7-10-1-b]
          Length = 80

 Score = 94.6 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 33/74 (44%), Positives = 44/74 (59%)

Query: 50  FPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLI 109
           F K L     + +I  Y+   S +F + CR+ PTCSEYG  A  RYG W G  LT+ R++
Sbjct: 7   FIKHLPCKTAVFMITFYRAAISPLFPSCCRFTPTCSEYGIIAFRRYGFWKGLKLTVKRIL 66

Query: 110 KCNPLGSDGFDPVP 123
           +C P G  G+DPVP
Sbjct: 67  RCRPGGPHGYDPVP 80


>gi|121606996|ref|YP_984325.1| hypothetical protein Pnap_4114 [Polaromonas naphthalenivorans CJ2]
 gi|120595965|gb|ABM39404.1| protein of unknown function DUF37 [Polaromonas naphthalenivorans
           CJ2]
          Length = 105

 Score = 94.6 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 30/70 (42%), Positives = 46/70 (65%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           L ++  IG++  Y+L+ S   G++CR+ P+CS Y   A++R+G   GS+LTL RL++C P
Sbjct: 11  LPQMTLIGVVNGYRLLISPALGSNCRFEPSCSAYSLLALSRHGAVTGSYLTLRRLVRCQP 70

Query: 114 LGSDGFDPVP 123
               G DPVP
Sbjct: 71  WCEGGHDPVP 80


>gi|257127032|ref|YP_003165146.1| hypothetical protein Lebu_2304 [Leptotrichia buccalis C-1013-b]
 gi|257050971|gb|ACV40155.1| protein of unknown function DUF37 [Leptotrichia buccalis C-1013-b]
          Length = 69

 Score = 94.6 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 31/67 (46%), Positives = 44/67 (65%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + + +I+IYQ   S  FG  CR+ PTCSEY  +AI +YG   GS+LT+ RL+KC+P 
Sbjct: 1   MKKVLLFLIKIYQKYISIFFGRRCRFYPTCSEYSRQAITKYGAIKGSYLTIRRLLKCHPF 60

Query: 115 GSDGFDP 121
              G+DP
Sbjct: 61  HKGGYDP 67


>gi|93007298|ref|YP_581735.1| hypothetical protein Pcryo_2474 [Psychrobacter cryohalolentis K5]
 gi|116256204|sp|Q1Q7V2|Y2474_PSYCK RecName: Full=UPF0161 protein Pcryo_2474
 gi|92394976|gb|ABE76251.1| protein of unknown function DUF37 [Psychrobacter cryohalolentis K5]
          Length = 124

 Score = 94.6 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 38/62 (61%)

Query: 62  IIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDP 121
            I  YQ I S +    CRY PTCS YG +A+A +G+  GS L L R+ +C+PLG  G D 
Sbjct: 19  FIDFYQKIISPILPARCRYYPTCSNYGKQALAWHGVLNGSLLLLKRISRCHPLGGHGVDF 78

Query: 122 VP 123
           VP
Sbjct: 79  VP 80


>gi|300769666|ref|ZP_07079549.1| alpha-hemolysin [Lactobacillus plantarum subsp. plantarum ATCC
           14917]
 gi|300492709|gb|EFK27894.1| alpha-hemolysin [Lactobacillus plantarum subsp. plantarum ATCC
           14917]
          Length = 85

 Score = 94.2 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 31/70 (44%), Positives = 39/70 (55%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           IR YQ  FS      CRY PTCS Y  EAI R+G   G  + + R+++C PL   GFDPV
Sbjct: 4   IRFYQRAFSAFSPAHCRYYPTCSNYTLEAIDRFGAVKGVLMGVARILRCQPLVKGGFDPV 63

Query: 123 PDDLPPKKNN 132
           P     ++N 
Sbjct: 64  PAHFSLRRNP 73


>gi|300313621|ref|YP_003777713.1| hypothetical protein Hsero_4337 [Herbaspirillum seropedicae SmR1]
 gi|300076406|gb|ADJ65805.1| conserved hypothetical protein [Herbaspirillum seropedicae SmR1]
          Length = 120

 Score = 94.2 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 26/60 (43%), Positives = 34/60 (56%)

Query: 64  RIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVP 123
           R Y+L  S   G +CR+ P+CS+Y  EA+  +G   GS L   RL KC+P    G D VP
Sbjct: 10  RAYKLGVSPFLGQNCRFYPSCSDYAAEAVRVHGALKGSLLAGKRLCKCHPWHPGGLDLVP 69


>gi|310830140|ref|YP_003962497.1| hypothetical protein ELI_4600 [Eubacterium limosum KIST612]
 gi|308741874|gb|ADO39534.1| hypothetical protein ELI_4600 [Eubacterium limosum KIST612]
          Length = 70

 Score = 94.2 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 46/70 (65%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + +   + +IR YQ   S    +SCR+LPTCSEY Y+A+ +YG++ G +L   R++KC+P
Sbjct: 1   MIKRFILKLIRGYQRYISPCLPHSCRFLPTCSEYCYQAVLKYGIFKGLFLGTKRILKCHP 60

Query: 114 LGSDGFDPVP 123
               G+DP+P
Sbjct: 61  FHPGGYDPLP 70


>gi|227549434|ref|ZP_03979483.1| possible alpha-hemolysin [Corynebacterium lipophiloflavum DSM
           44291]
 gi|227078511|gb|EEI16474.1| possible alpha-hemolysin [Corynebacterium lipophiloflavum DSM
           44291]
          Length = 98

 Score = 94.2 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 26/75 (34%), Positives = 43/75 (57%), Gaps = 1/75 (1%)

Query: 53  TLGRLIGIGIIRIYQLIFSNV-FGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           +    + + ++R+YQ   S +  G +CR++P CS Y  EA++R+G   GS +   R+ KC
Sbjct: 16  SAPAKVLVKVVRLYQKYVSPLKMGGTCRFVPVCSAYALEAVSRHGAAKGSLMAGARVCKC 75

Query: 112 NPLGSDGFDPVPDDL 126
            P    G+DPVP  +
Sbjct: 76  GPWHPGGYDPVPGSV 90


>gi|329121492|ref|ZP_08250116.1| alpha-hemolysin like protein [Dialister micraerophilus DSM 19965]
 gi|327469407|gb|EGF14877.1| alpha-hemolysin like protein [Dialister micraerophilus DSM 19965]
          Length = 62

 Score = 94.2 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 42/62 (67%)

Query: 62  IIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDP 121
           +I+ Y+   S + G  CR++PTCSEY +EA+ +YG   GS+L + R+ KC+P    G+DP
Sbjct: 1   MIKGYRFFVSPLKGPCCRFVPTCSEYAFEAVKKYGALKGSYLAVKRICKCHPFHRGGYDP 60

Query: 122 VP 123
           VP
Sbjct: 61  VP 62


>gi|154245596|ref|YP_001416554.1| hypothetical protein Xaut_1652 [Xanthobacter autotrophicus Py2]
 gi|154159681|gb|ABS66897.1| protein of unknown function DUF37 [Xanthobacter autotrophicus Py2]
          Length = 123

 Score = 94.2 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 34/74 (45%), Positives = 42/74 (56%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           L R      I  Y+   S+  G  CRYLPTCSEY  EA+ R+G   GS +   R+ +CNP
Sbjct: 27  LPRHALRLPILFYRYTLSSFMGRQCRYLPTCSEYAEEAVMRHGALAGSVMATARICRCNP 86

Query: 114 LGSDGFDPVPDDLP 127
            G  G+DPVP  LP
Sbjct: 87  WGGHGYDPVPRCLP 100


>gi|314970900|gb|EFT14998.1| conserved hypothetical protein YidD [Propionibacterium acnes
           HL037PA3]
          Length = 166

 Score = 94.2 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 23/89 (25%), Positives = 48/89 (53%), Gaps = 3/89 (3%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
               + I  ++ ++   S ++G  C+Y P+CS YG  A+  +G++  + + + R+++CNP
Sbjct: 35  PLTWLAIEFVKGWRAFISPLYGEVCKYQPSCSAYGLRALQAHGIFRATPMIIWRILRCNP 94

Query: 114 LGSDGFDPV---PDDLPPKKNNPKLLSKK 139
               G+DPV   P+    ++ +P+    K
Sbjct: 95  WSYGGYDPVSGTPEARQWRELHPETARSK 123


>gi|225020859|ref|ZP_03710051.1| hypothetical protein CORMATOL_00867 [Corynebacterium matruchotii
           ATCC 33806]
 gi|224946341|gb|EEG27550.1| hypothetical protein CORMATOL_00867 [Corynebacterium matruchotii
           ATCC 33806]
          Length = 86

 Score = 94.2 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 36/74 (48%), Gaps = 1/74 (1%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFG-NSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           +    + I     YQ   S + G  SCR+ PTCS Y   A+  +G   G  L L+RL KC
Sbjct: 6   SPAARLLIAAGHFYQHYLSGLKGGPSCRFEPTCSSYAITAVRVHGALKGIVLALVRLSKC 65

Query: 112 NPLGSDGFDPVPDD 125
            P    GFDPVP  
Sbjct: 66  GPWHPGGFDPVPQT 79


>gi|114568078|ref|YP_755232.1| hypothetical protein Swol_2575 [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
 gi|122317081|sp|Q0ATU3|Y2575_SYNWW RecName: Full=UPF0161 protein Swol_2575
 gi|114339013|gb|ABI69861.1| conserved hypothetical protein [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
          Length = 68

 Score = 94.2 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 42/69 (60%), Gaps = 1/69 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I +I+IYQ         SCR+ P+CS Y  EA+ +YG+  G WLT+ RL +C+P 
Sbjct: 1   MQEMLIKLIKIYQKATF-FKPASCRFYPSCSNYSIEALRKYGIVKGGWLTVKRLARCHPY 59

Query: 115 GSDGFDPVP 123
              G+DPVP
Sbjct: 60  NPGGYDPVP 68


>gi|126701306|ref|YP_001090203.1| hypothetical protein CD3678A [Clostridium difficile 630]
 gi|115252743|emb|CAJ70588.1| conserved hypothetical protein [Clostridium difficile]
          Length = 61

 Score = 94.2 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 38/59 (64%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDP 121
           +R YQ   S + G +CR+ PTCS+Y  EA  +YG   G +LT+ R++KC+P    G+DP
Sbjct: 1   MRFYQKYISPLKGPTCRFYPTCSQYSIEAFKKYGFVKGMYLTIRRILKCHPFHPGGYDP 59


>gi|282881776|ref|ZP_06290434.1| conserved hypothetical protein [Peptoniphilus lacrimalis 315-B]
 gi|300814764|ref|ZP_07095012.1| conserved hypothetical protein YidD [Peptoniphilus sp. oral taxon
           836 str. F0141]
 gi|281298386|gb|EFA90824.1| conserved hypothetical protein [Peptoniphilus lacrimalis 315-B]
 gi|300511151|gb|EFK38403.1| conserved hypothetical protein YidD [Peptoniphilus sp. oral taxon
           836 str. F0141]
          Length = 71

 Score = 94.2 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 44/69 (63%), Gaps = 2/69 (2%)

Query: 55  GRLIGIGIIRIYQLIFSNVF--GNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
            + I + +I+ YQ + S     G+ CR+ PTCS+Y  EA  +YG + G++LTL+RL KC+
Sbjct: 1   MKNICVLLIKFYQRVISRYLLPGSHCRFTPTCSQYSIEAYEKYGFFKGTYLTLIRLSKCH 60

Query: 113 PLGSDGFDP 121
           P    G+DP
Sbjct: 61  PFHKGGYDP 69


>gi|297618525|ref|YP_003703684.1| hypothetical protein Slip_2383 [Syntrophothermus lipocalidus DSM
           12680]
 gi|297146362|gb|ADI03119.1| protein of unknown function DUF37 [Syntrophothermus lipocalidus DSM
           12680]
          Length = 68

 Score = 94.2 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 42/69 (60%), Gaps = 1/69 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            +   +G+IR+YQ++        CR++P+CSEY   AI RYG   G WL + R+ KC+P 
Sbjct: 1   MKRALVGLIRLYQVLSKGKI-PCCRFVPSCSEYMIRAIERYGALKGVWLGVKRIAKCHPF 59

Query: 115 GSDGFDPVP 123
              GFDPVP
Sbjct: 60  HPGGFDPVP 68


>gi|325291450|ref|YP_004267631.1| UPF0161 protein yidD [Syntrophobotulus glycolicus DSM 8271]
 gi|324966851|gb|ADY57630.1| UPF0161 protein yidD [Syntrophobotulus glycolicus DSM 8271]
          Length = 74

 Score = 94.2 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 32/66 (48%), Positives = 44/66 (66%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
            I +G+I IYQ + S +   SCR+ PTCSEY  +AI +YG+  G   + LR++KCNP  S
Sbjct: 9   KILVGMIMIYQRVLSPIKPRSCRFYPTCSEYAIQAITKYGILKGLGKSFLRILKCNPFHS 68

Query: 117 DGFDPV 122
            G+DPV
Sbjct: 69  GGYDPV 74


>gi|297171724|gb|ADI22716.1| uncharacterized conserved protein [uncultured verrucomicrobium
           HF0500_27H16]
          Length = 71

 Score = 94.2 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 41/68 (60%), Gaps = 6/68 (8%)

Query: 62  IIRIYQLIFSNVF------GNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLG 115
           ++RIYQ   S +          CR+ PTCS+Y  EA+  +G + G WL L R+++C+P G
Sbjct: 1   MVRIYQHTLSPLKKWLFFRAGCCRFNPTCSQYAIEALQGHGAFRGGWLALRRILRCHPWG 60

Query: 116 SDGFDPVP 123
             G+DPVP
Sbjct: 61  HSGYDPVP 68


>gi|149175831|ref|ZP_01854449.1| hypothetical protein PM8797T_24471 [Planctomyces maris DSM 8797]
 gi|148845278|gb|EDL59623.1| hypothetical protein PM8797T_24471 [Planctomyces maris DSM 8797]
          Length = 83

 Score = 93.8 bits (232), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 30/74 (40%), Positives = 45/74 (60%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
           G+    L     IG++RIYQ+  S++ G  CR+ PTCSEY  +A+ +YG   GS   +LR
Sbjct: 9   GRMLYQLPARTLIGLVRIYQMTLSHLIGRQCRFHPTCSEYFIQAVKKYGAIRGSCKGVLR 68

Query: 108 LIKCNPLGSDGFDP 121
           + +C+P    G+DP
Sbjct: 69  ICRCHPFHPGGYDP 82


>gi|260685221|ref|YP_003216506.1| hypothetical protein CD196_3493 [Clostridium difficile CD196]
 gi|260688880|ref|YP_003220014.1| hypothetical protein CDR20291_3539 [Clostridium difficile R20291]
 gi|260211384|emb|CBA67042.1| conserved hypothetical protein [Clostridium difficile CD196]
 gi|260214897|emb|CBE07705.1| conserved hypothetical protein [Clostridium difficile R20291]
          Length = 61

 Score = 93.8 bits (232), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 38/59 (64%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDP 121
           +R YQ   S + G +CR+ PTCS+Y  EA  +YG   G +LT+ RL+KC+P    G+DP
Sbjct: 1   MRFYQKYISPLKGPTCRFYPTCSQYSIEAFKKYGFVKGMYLTIRRLLKCHPFHPGGYDP 59


>gi|328952576|ref|YP_004369910.1| UPF0161 protein yidD [Desulfobacca acetoxidans DSM 11109]
 gi|328452900|gb|AEB08729.1| UPF0161 protein yidD [Desulfobacca acetoxidans DSM 11109]
          Length = 72

 Score = 93.8 bits (232), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 41/65 (63%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            I ++R YQL  S    +SCR+ P+CSEY  +A+ +YG   G  L+  R++KC+PL   G
Sbjct: 8   LIWLLRGYQLFISPFLPHSCRFYPSCSEYACQALEKYGFGKGILLSCRRVLKCHPLHPGG 67

Query: 119 FDPVP 123
            DP+P
Sbjct: 68  LDPLP 72


>gi|172041702|ref|YP_001801416.1| hypothetical protein cur_2025 [Corynebacterium urealyticum DSM
           7109]
 gi|171853006|emb|CAQ05982.1| hypothetical protein cu2025 [Corynebacterium urealyticum DSM 7109]
          Length = 167

 Score = 93.8 bits (232), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 34/109 (31%), Positives = 50/109 (45%), Gaps = 9/109 (8%)

Query: 24  ALPIQKKGSPLL-LKNNTPKSRNWN-GKFPKTLGRLI------GIGIIRIYQLIFSNV-F 74
           A P +    P      N     ++  G   +T  R +          +  YQ   S +  
Sbjct: 57  AQPAEHSSQPGTESHRNPGSQADFKPGADSRTARRRVTGRAAMARRAVLAYQEFLSPLKM 116

Query: 75  GNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVP 123
           G SCR+ PTCS Y   A+ R+GL+ G  L++ RL++C P    G+DPVP
Sbjct: 117 GPSCRFEPTCSNYALTALERHGLFKGLLLSIGRLLRCAPWHPGGWDPVP 165


>gi|54295840|ref|YP_128255.1| hypothetical protein lpl2931 [Legionella pneumophila str. Lens]
 gi|81367522|sp|Q5WSE8|Y2931_LEGPL RecName: Full=UPF0161 protein lpl2931
 gi|53755672|emb|CAH17175.1| hypothetical protein lpl2931 [Legionella pneumophila str. Lens]
          Length = 81

 Score = 93.8 bits (232), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 41/78 (52%), Gaps = 3/78 (3%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + R I    I++YQ   S +    CRY P+CSEY   AI  YG+  G  + L RL +C+P
Sbjct: 7   MLRQIVCLPIKMYQYFISPLITPCCRYYPSCSEYADSAIKHYGVIKGLLMALNRLSRCHP 66

Query: 114 LGSDGFDPVPDDLPPKKN 131
               G+DP+    P  KN
Sbjct: 67  WSKGGYDPL---FPNDKN 81


>gi|284991487|ref|YP_003410041.1| hypothetical protein Gobs_3060 [Geodermatophilus obscurus DSM
           43160]
 gi|284064732|gb|ADB75670.1| protein of unknown function DUF37 [Geodermatophilus obscurus DSM
           43160]
          Length = 165

 Score = 93.8 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 34/91 (37%), Positives = 47/91 (51%), Gaps = 1/91 (1%)

Query: 34  LLLKNNTPKSRNWNGKFPK-TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAI 92
           L L   T +  +  G   + T  R   +  +R+YQ   S      CR+ PTCS Y  +A+
Sbjct: 72  LFLVPTTVRHVHATGTGRRGTRVRDRLVAAVRVYQREVSPRRPPCCRFEPTCSAYAVQAL 131

Query: 93  ARYGLWIGSWLTLLRLIKCNPLGSDGFDPVP 123
            R+G   G WLTL RL++C P  + G DPVP
Sbjct: 132 ERHGAGRGCWLTLRRLVRCRPGAAGGPDPVP 162


>gi|90424608|ref|YP_532978.1| hypothetical protein RPC_3117 [Rhodopseudomonas palustris BisB18]
 gi|116256221|sp|Q212M7|Y3117_RHOPB RecName: Full=UPF0161 protein RPC_3117
 gi|90106622|gb|ABD88659.1| protein of unknown function DUF37 [Rhodopseudomonas palustris
           BisB18]
          Length = 109

 Score = 93.8 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 38/74 (51%), Positives = 47/74 (63%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           L R  G G I +Y+   S + G  CR+LPTCS YG EAI R+GLW G W+TL RL++C P
Sbjct: 17  LPRRAGRGAIWLYRHSLSPLVGYHCRHLPTCSSYGDEAIERFGLWAGGWMTLARLLRCQP 76

Query: 114 LGSDGFDPVPDDLP 127
            G+ G D VP   P
Sbjct: 77  WGTHGIDNVPLTAP 90


>gi|241667554|ref|ZP_04755132.1| hypothetical protein FphipA2_02210 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254876099|ref|ZP_05248809.1| conserved hypothetical protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254842120|gb|EET20534.1| conserved hypothetical protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 94

 Score = 93.8 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 32/85 (37%), Positives = 44/85 (51%), Gaps = 1/85 (1%)

Query: 49  KFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRL 108
           KF K +     I II +Y+   S      CRY PTCSEY  EA+  +G+  G +L+  RL
Sbjct: 9   KFFKRITLAPFIAIINLYRYCISPFIPARCRYYPTCSEYALEALKTHGILKGLYLSTRRL 68

Query: 109 IKCNPLGS-DGFDPVPDDLPPKKNN 132
           ++C+P    D +DPVP       N 
Sbjct: 69  LRCHPFAKRDYYDPVPCKNKKVNNK 93


>gi|167629168|ref|YP_001679667.1| hypothetical protein HM1_0909 [Heliobacterium modesticaldum Ice1]
 gi|167591908|gb|ABZ83656.1| conserved hypothetical protein [Heliobacterium modesticaldum Ice1]
          Length = 70

 Score = 93.8 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 25/64 (39%), Positives = 38/64 (59%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
           + I  IR Y+   S + G +CR+ PTCS Y   A+ +YG+  G W  + RL++C+P    
Sbjct: 6   VFIVPIRWYRRYLSPLRGPTCRFAPTCSAYAILALEKYGVLRGLWKAVGRLLRCHPFHPG 65

Query: 118 GFDP 121
           G+DP
Sbjct: 66  GYDP 69


>gi|71066699|ref|YP_265426.1| hypothetical protein Psyc_2145 [Psychrobacter arcticus 273-4]
 gi|116256152|sp|Q4FPR6|Y2145_PSYA2 RecName: Full=UPF0161 protein Psyc_2145
 gi|71039684|gb|AAZ19992.1| conserved hypothetical protein [Psychrobacter arcticus 273-4]
          Length = 124

 Score = 93.8 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 35/77 (45%), Positives = 45/77 (58%), Gaps = 3/77 (3%)

Query: 50  FPKTLGR---LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLL 106
           F KT+ +    +    I  YQ I S +    CRY PTCS YG +A+A YG+W GS L L 
Sbjct: 4   FIKTINKYLYKLIYSFIVFYQKIISPILPARCRYYPTCSNYGKQALAWYGVWNGSLLLLK 63

Query: 107 RLIKCNPLGSDGFDPVP 123
           R+ +C+PLG  G D VP
Sbjct: 64  RIGRCHPLGGHGIDFVP 80


>gi|242072097|ref|XP_002451325.1| hypothetical protein SORBIDRAFT_05g027840 [Sorghum bicolor]
 gi|241937168|gb|EES10313.1| hypothetical protein SORBIDRAFT_05g027840 [Sorghum bicolor]
          Length = 136

 Score = 93.8 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 31/70 (44%), Positives = 44/70 (62%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
             LG    + +++ Y+   S +  +SCRY+PTCSEY  +A  RYG+  G+ LT  RL +C
Sbjct: 55  NDLGVSAALSMLKFYKREISPLLPSSCRYVPTCSEYSMQAYKRYGVVKGTILTAWRLCRC 114

Query: 112 NPLGSDGFDP 121
           NPLG  G+DP
Sbjct: 115 NPLGGYGYDP 124


>gi|299135299|ref|ZP_07028490.1| protein of unknown function DUF37 [Afipia sp. 1NLS2]
 gi|298590276|gb|EFI50480.1| protein of unknown function DUF37 [Afipia sp. 1NLS2]
          Length = 113

 Score = 93.8 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 37/77 (48%), Positives = 49/77 (63%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            K   R  G G+I +Y+   S + G +CR++PTCS YG EAI R+GLW G W+TL RL++
Sbjct: 15  AKNAPRNAGRGMIWLYRSTLSPLIGFNCRHVPTCSAYGDEAIGRFGLWAGGWMTLARLLR 74

Query: 111 CNPLGSDGFDPVPDDLP 127
           C P G+ G D VP   P
Sbjct: 75  CQPWGTSGLDFVPKQKP 91


>gi|257464450|ref|ZP_05628822.1| hypothetical protein FuD12_11499 [Fusobacterium sp. D12]
 gi|317061939|ref|ZP_07926424.1| conserved hypothetical protein [Fusobacterium sp. D12]
 gi|313687615|gb|EFS24450.1| conserved hypothetical protein [Fusobacterium sp. D12]
          Length = 64

 Score = 93.8 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 29/61 (47%), Positives = 39/61 (63%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           IR YQ   S   G +CR+ PTCS+Y YEAI +YG   G +L + R+ KC+P    G+DP+
Sbjct: 4   IRCYQKYISPSLGKNCRFYPTCSQYTYEAIQKYGCIKGIYLGIKRISKCHPFHPGGYDPL 63

Query: 123 P 123
           P
Sbjct: 64  P 64


>gi|254468792|ref|ZP_05082198.1| conserved hypothetical protein TIGR00278 [beta proteobacterium
           KB13]
 gi|207087602|gb|EDZ64885.1| conserved hypothetical protein TIGR00278 [beta proteobacterium
           KB13]
          Length = 70

 Score = 93.8 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 26/70 (37%), Positives = 43/70 (61%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           +   + I +++IYQ   S  F +SCR+ P+CSEY  EA+ +Y ++   +L   R++KC+P
Sbjct: 1   MLNNLFILLVKIYQRAISPFFISSCRFTPSCSEYTIEALKKYNVFKALFLAAKRILKCHP 60

Query: 114 LGSDGFDPVP 123
               G DP+P
Sbjct: 61  WNRGGPDPLP 70


>gi|305681680|ref|ZP_07404486.1| conserved hypothetical protein YidD [Corynebacterium matruchotii
           ATCC 14266]
 gi|305658840|gb|EFM48341.1| conserved hypothetical protein YidD [Corynebacterium matruchotii
           ATCC 14266]
          Length = 95

 Score = 93.8 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 36/74 (48%), Gaps = 1/74 (1%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFG-NSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           +    + I     YQ   S + G  SCR+ PTCS Y   A+  +G   G  L L+RL KC
Sbjct: 15  SPAARLLIAAGHFYQHYLSGLKGGPSCRFEPTCSSYAITAVRVHGALKGIVLALVRLSKC 74

Query: 112 NPLGSDGFDPVPDD 125
            P    GFDPVP  
Sbjct: 75  GPWHPGGFDPVPQT 88


>gi|75675518|ref|YP_317939.1| hypothetical protein Nwi_1326 [Nitrobacter winogradskyi Nb-255]
 gi|116256133|sp|Q3ST04|Y1326_NITWN RecName: Full=UPF0161 protein Nwi_1326
 gi|74420388|gb|ABA04587.1| Protein of unknown function DUF37 [Nitrobacter winogradskyi Nb-255]
          Length = 117

 Score = 93.8 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 43/102 (42%), Positives = 58/102 (56%), Gaps = 9/102 (8%)

Query: 26  PIQKKGSPLLLKNNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCS 85
           P + + S L      P   N   + P+  GR     +I IY+   S + G +CR+LPTCS
Sbjct: 5   PSEVRCSRLC-----PACTNAALRLPRNAGR----ALIWIYRHTLSPLVGFNCRHLPTCS 55

Query: 86  EYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVPDDLP 127
            YG EAIAR+GLW G W+TL R+++C P G+ G D VP   P
Sbjct: 56  AYGDEAIARFGLWGGGWMTLARILRCRPWGTSGIDNVPVAKP 97


>gi|123965707|ref|YP_001010788.1| hypothetical protein P9515_04721 [Prochlorococcus marinus str. MIT
           9515]
 gi|123200073|gb|ABM71681.1| Uncharacterized conserved protein [Prochlorococcus marinus str. MIT
           9515]
          Length = 63

 Score = 93.8 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 44/63 (69%)

Query: 62  IIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDP 121
           +I  YQ  FS  FG  CR++P+CS YGYEAI R+G W G WLTL RL KC+PL   G DP
Sbjct: 1   MISFYQKWFSPFFGPRCRFIPSCSSYGYEAITRHGPWRGGWLTLRRLSKCHPLTPCGCDP 60

Query: 122 VPD 124
           VPD
Sbjct: 61  VPD 63


>gi|52843196|ref|YP_096995.1| hypothetical protein lpg3003 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|54299008|ref|YP_125377.1| hypothetical protein lpp3075 [Legionella pneumophila str. Paris]
 gi|81369555|sp|Q5X0M1|Y3075_LEGPA RecName: Full=UPF0161 protein lpp3075
 gi|81376514|sp|Q5ZR80|Y3003_LEGPH RecName: Full=UPF0161 protein lpg3003
 gi|52630307|gb|AAU29048.1| conserved hypothetical protein TIGR00278 [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
 gi|53752793|emb|CAH14228.1| hypothetical protein lpp3075 [Legionella pneumophila str. Paris]
          Length = 81

 Score = 93.8 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 41/78 (52%), Gaps = 3/78 (3%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + R I    I++YQ   S +    CRY P+CSEY   AI  YG+  G  + L RL +C+P
Sbjct: 7   MLRQIVCLPIKMYQYFISPLITPCCRYYPSCSEYADSAIKHYGVIKGLLMALNRLSRCHP 66

Query: 114 LGSDGFDPVPDDLPPKKN 131
               G+DP+    P  KN
Sbjct: 67  WSKGGYDPL---FPNDKN 81


>gi|168183724|ref|ZP_02618388.1| conserved hypothetical protein TIGR00278 [Clostridium botulinum Bf]
 gi|237797103|ref|YP_002864655.1| hypothetical protein CLJ_B3985 [Clostridium botulinum Ba4 str. 657]
 gi|259647136|sp|C3KWJ8|Y3985_CLOB6 RecName: Full=UPF0161 protein CLJ_B3985
 gi|182673167|gb|EDT85128.1| conserved hypothetical protein TIGR00278 [Clostridium botulinum Bf]
 gi|229262463|gb|ACQ53496.1| conserved hypothetical protein TIGR00278 [Clostridium botulinum Ba4
           str. 657]
          Length = 69

 Score = 93.8 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 27/69 (39%), Positives = 45/69 (65%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I II++Y+   S++   SCR+ PTCS+Y  EAI +YG   G+ +++ R++KC+P 
Sbjct: 1   MKNLLICIIKMYRKYISSLKRPSCRFYPTCSQYSIEAIEKYGALKGTLISIKRILKCHPF 60

Query: 115 GSDGFDPVP 123
              G+DPV 
Sbjct: 61  NEGGYDPVK 69


>gi|303240054|ref|ZP_07326575.1| protein of unknown function DUF37 [Acetivibrio cellulolyticus CD2]
 gi|302592323|gb|EFL62050.1| protein of unknown function DUF37 [Acetivibrio cellulolyticus CD2]
          Length = 71

 Score = 93.4 bits (231), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 1/68 (1%)

Query: 57  LIGIGIIRIYQLIFSNVFG-NSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLG 115
            + I +IR YQ   S     +SCR+ PTCS+Y  +AI++YG+  GS  +L RL+KC+P  
Sbjct: 4   KLVILLIRFYQKFISPFKSVSSCRFYPTCSQYAIDAISKYGIIRGSVKSLKRLLKCHPFH 63

Query: 116 SDGFDPVP 123
             G+DPV 
Sbjct: 64  PGGYDPVK 71


>gi|295687965|ref|YP_003591658.1| hypothetical protein Cseg_0528 [Caulobacter segnis ATCC 21756]
 gi|295429868|gb|ADG09040.1| protein of unknown function DUF37 [Caulobacter segnis ATCC 21756]
          Length = 84

 Score = 93.4 bits (231), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 32/75 (42%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 56  RLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLG 115
           R + +G+ R Y+L  S + G  CR+ P+CSEY   A+  +G   GSWL L R+ +CNP G
Sbjct: 6   RTVDLGL-RAYKLTLSPLIGRQCRFTPSCSEYTAAALKEHGPLKGSWLGLRRICRCNPFG 64

Query: 116 SDGFDPVPDDLPPKK 130
             G+DP P    P+K
Sbjct: 65  GSGYDPPPPRHQPRK 79


>gi|299143466|ref|ZP_07036546.1| alpha-hemolysin [Peptoniphilus sp. oral taxon 386 str. F0131]
 gi|298517951|gb|EFI41690.1| alpha-hemolysin [Peptoniphilus sp. oral taxon 386 str. F0131]
          Length = 71

 Score = 93.4 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 26/71 (36%), Positives = 44/71 (61%), Gaps = 2/71 (2%)

Query: 55  GRLIGIGIIRIYQLIFSN--VFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
            + + +  I+ YQ + S     G  CR+ PTCS+Y Y A  +YG + G++L++ R++KC+
Sbjct: 1   MKYVMMLFIKFYQKVISKYVFVGAHCRFYPTCSQYSYMAYEKYGFFKGTYLSIRRILKCH 60

Query: 113 PLGSDGFDPVP 123
           P    G+DP+P
Sbjct: 61  PFHKGGYDPLP 71


>gi|91202020|emb|CAJ75080.1| Hypothetical UPF0161 protein [Candidatus Kuenenia stuttgartiensis]
          Length = 66

 Score = 93.4 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 43/66 (65%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
           + I ++++YQ   S +F ++CR+ PTCS+Y   A+ + GL  G  L + R+++CNP G  
Sbjct: 1   MIIKLLQLYQYAISPLFHHACRFEPTCSQYMINAVKKKGLLRGVCLGMWRILRCNPFGGS 60

Query: 118 GFDPVP 123
           G+DPV 
Sbjct: 61  GYDPVK 66


>gi|296444409|ref|ZP_06886374.1| protein of unknown function DUF37 [Methylosinus trichosporium OB3b]
 gi|296258056|gb|EFH05118.1| protein of unknown function DUF37 [Methylosinus trichosporium OB3b]
          Length = 133

 Score = 93.4 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 35/73 (47%), Positives = 45/73 (61%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           ++L       +I  Y+L  S   G  CRYLPTCS+Y  EAI R+GLW G W+   R+ +C
Sbjct: 3   RSLPARCARVLIFAYRLTLSAFIGRECRYLPTCSDYADEAIRRHGLWAGGWMGFARICRC 62

Query: 112 NPLGSDGFDPVPD 124
            P G DG+DPVPD
Sbjct: 63  RPGGGDGYDPVPD 75


>gi|315498772|ref|YP_004087576.1| hypothetical protein Astex_1759 [Asticcacaulis excentricus CB 48]
 gi|315416784|gb|ADU13425.1| protein of unknown function DUF37 [Asticcacaulis excentricus CB 48]
          Length = 79

 Score = 93.4 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 28/61 (45%), Positives = 38/61 (62%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           +R Y+L  S + G  CR+ PTCSE+  EA+  +G   GSWL   R+ +C P G  G+DPV
Sbjct: 13  LRAYKLSLSPLIGQGCRFAPTCSEFTAEALIVHGPIKGSWLGFKRICRCRPGGGHGYDPV 72

Query: 123 P 123
           P
Sbjct: 73  P 73


>gi|197302265|ref|ZP_03167324.1| hypothetical protein RUMLAC_00992 [Ruminococcus lactaris ATCC
           29176]
 gi|197298696|gb|EDY33237.1| hypothetical protein RUMLAC_00992 [Ruminococcus lactaris ATCC
           29176]
          Length = 70

 Score = 93.4 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 43/70 (61%), Gaps = 1/70 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFG-NSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
            + I + +IR Y+   S +   N+C+Y PTCS+Y  EAI +YG   G  L + R+++CNP
Sbjct: 1   MKRILLWMIRFYRKYLSKMKRYNTCKYYPTCSQYALEAIEKYGALKGGVLAIWRVLRCNP 60

Query: 114 LGSDGFDPVP 123
               G+DPVP
Sbjct: 61  FSKGGYDPVP 70


>gi|108802370|ref|YP_642567.1| hypothetical protein Mmcs_5411 [Mycobacterium sp. MCS]
 gi|119866063|ref|YP_936015.1| hypothetical protein Mkms_0006 [Mycobacterium sp. KMS]
 gi|126438350|ref|YP_001074041.1| hypothetical protein Mjls_5787 [Mycobacterium sp. JLS]
 gi|108772789|gb|ABG11511.1| protein of unknown function DUF37 [Mycobacterium sp. MCS]
 gi|119692152|gb|ABL89225.1| protein of unknown function DUF37 [Mycobacterium sp. KMS]
 gi|126238150|gb|ABO01551.1| protein of unknown function DUF37 [Mycobacterium sp. JLS]
          Length = 108

 Score = 93.4 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 29/65 (44%), Positives = 44/65 (67%)

Query: 60  IGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGF 119
           I +I++Y+ + S +   SCR+ PTCS+Y  +A+  YGL  G WL+L+RL KC P    G+
Sbjct: 16  IYVIQLYRHMISPLRYPSCRFTPTCSQYAVDALTEYGLVRGGWLSLVRLAKCGPWHRGGW 75

Query: 120 DPVPD 124
           DP+P+
Sbjct: 76  DPIPE 80


>gi|302341715|ref|YP_003806244.1| hypothetical protein Deba_0274 [Desulfarculus baarsii DSM 2075]
 gi|301638328|gb|ADK83650.1| protein of unknown function DUF37 [Desulfarculus baarsii DSM 2075]
          Length = 71

 Score = 93.4 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/60 (45%), Positives = 38/60 (63%)

Query: 62  IIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDP 121
           ++R YQL  S + G  CR+LPTCS+Y  +A+ +YG W G     +RL KC+P    G+DP
Sbjct: 11  LVRAYQLTLSPLLGRQCRFLPTCSDYALDALRKYGFWRGCAKAAIRLAKCHPFHPGGYDP 70


>gi|163859333|ref|YP_001633631.1| hypothetical protein Bpet5012 [Bordetella petrii DSM 12804]
 gi|163263061|emb|CAP45364.1| Hypothetical protein in rnpA 3'region [Bordetella petrii]
          Length = 87

 Score = 93.4 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 26/62 (41%), Positives = 35/62 (56%)

Query: 57  LIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGS 116
           ++ I  IR Y+   S   G  CR+ PTCS Y  EAI R+G W G+WL   R+ +C+P   
Sbjct: 1   MLLIAPIRFYRFFLSPWLGRQCRFTPTCSAYAIEAIERHGAWRGTWLAARRIGRCHPWSP 60

Query: 117 DG 118
            G
Sbjct: 61  GG 62


>gi|16124718|ref|NP_419282.1| hypothetical protein CC_0463 [Caulobacter crescentus CB15]
 gi|221233432|ref|YP_002515868.1| hypothetical protein CCNA_00495 [Caulobacter crescentus NA1000]
 gi|25009598|sp|Q9AAX9|Y463_CAUCR RecName: Full=UPF0161 protein CC_0463
 gi|254803975|sp|B8GZS6|Y495_CAUCN RecName: Full=UPF0161 protein CCNA_00495
 gi|13421636|gb|AAK22450.1| conserved hypothetical protein [Caulobacter crescentus CB15]
 gi|220962604|gb|ACL93960.1| hypothetical cytosolic protein [Caulobacter crescentus NA1000]
          Length = 84

 Score = 93.4 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 32/75 (42%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 56  RLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLG 115
           R + +G+ R Y+L  S + G  CR+ P+CSEY   A+  +G   GSWL L R+ +CNP G
Sbjct: 6   RTVDLGL-RAYKLTLSPLIGRQCRFTPSCSEYTAAALKDHGPLKGSWLGLRRICRCNPFG 64

Query: 116 SDGFDPVPDDLPPKK 130
             G+DP P    P+K
Sbjct: 65  GSGYDPPPPRHQPRK 79


>gi|300811324|ref|ZP_07091821.1| conserved hypothetical protein [Lactobacillus delbrueckii subsp.
           bulgaricus PB2003/044-T3-4]
 gi|300497688|gb|EFK32713.1| conserved hypothetical protein [Lactobacillus delbrueckii subsp.
           bulgaricus PB2003/044-T3-4]
 gi|325684418|gb|EGD26586.1| alpha-hemolysin [Lactobacillus delbrueckii subsp. lactis DSM 20072]
          Length = 95

 Score = 93.0 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 44/78 (56%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R I I ++R YQ   S +  +SCR+ PTCS Y   A+ ++G  +G  + L R+++CNP 
Sbjct: 1   MRQIMILLVRFYQRAISPILPDSCRFYPTCSSYMITALEKHGPLLGLLMGLARILRCNPF 60

Query: 115 GSDGFDPVPDDLPPKKNN 132
              G DPVPD     +N 
Sbjct: 61  NRGGVDPVPDKFTLLRNP 78


>gi|302390794|ref|YP_003826615.1| protein of unknown function DUF37 [Thermosediminibacter oceani DSM
           16646]
 gi|302201422|gb|ADL08992.1| protein of unknown function DUF37 [Thermosediminibacter oceani DSM
           16646]
          Length = 71

 Score = 93.0 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 26/69 (37%), Positives = 41/69 (59%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           L + + I  I  YQ + S +   +CR+ P+CSEY   +I +YG + G    + R++KC+P
Sbjct: 2   LIKKLLITSIIFYQKVISPLKPRTCRFYPSCSEYARLSIEKYGAFRGGIKAIKRILKCHP 61

Query: 114 LGSDGFDPV 122
           L   G+DPV
Sbjct: 62  LHPGGYDPV 70


>gi|150392476|ref|YP_001322525.1| hypothetical protein Amet_4800 [Alkaliphilus metalliredigens QYMF]
 gi|167012981|sp|A6TXE8|Y4800_ALKMQ RecName: Full=UPF0161 protein Amet_4800
 gi|149952338|gb|ABR50866.1| protein of unknown function DUF37 [Alkaliphilus metalliredigens
           QYMF]
          Length = 69

 Score = 93.0 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 28/67 (41%), Positives = 39/67 (58%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
                I +I +YQ   S + G +CR+ PTCS Y   A   YG + G++LT+ RL+KC+P 
Sbjct: 1   MSKFLIKLITLYQKWISPLKGQTCRFYPTCSSYSISAYNTYGFFRGTYLTIRRLLKCHPF 60

Query: 115 GSDGFDP 121
              GFDP
Sbjct: 61  HPGGFDP 67


>gi|262278044|ref|ZP_06055831.1| conserved domain protein [alpha proteobacterium HIMB114]
 gi|262223791|gb|EEY74256.1| conserved domain protein [alpha proteobacterium HIMB114]
          Length = 85

 Score = 93.0 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 31/82 (37%), Positives = 52/82 (63%), Gaps = 4/82 (4%)

Query: 48  GKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLR 107
            K+       + I II++Y+ I S + G++CR+LPTCSEY  EA+ + G ++G++  + R
Sbjct: 1   MKYLSDFLSFLLIIIIKVYKFIISPLLGHNCRFLPTCSEYFIEALEKKGFFLGAYSGMKR 60

Query: 108 LIKCNPL----GSDGFDPVPDD 125
           ++KC+P+    G  G+DPV D 
Sbjct: 61  ILKCHPIKLLGGDAGYDPVEDK 82


>gi|115524352|ref|YP_781263.1| hypothetical protein RPE_2343 [Rhodopseudomonas palustris BisA53]
 gi|122296351|sp|Q07P51|Y2343_RHOP5 RecName: Full=UPF0161 protein RPE_2343
 gi|115518299|gb|ABJ06283.1| protein of unknown function DUF37 [Rhodopseudomonas palustris
           BisA53]
          Length = 109

 Score = 93.0 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 38/74 (51%), Positives = 48/74 (64%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           L R  G G I +Y+   S + G  CR+LPTCS YG EAI R+GLW G W+TL RL++C P
Sbjct: 17  LPRQAGRGAIWLYRHTLSPLVGYHCRHLPTCSVYGDEAIGRFGLWAGGWMTLARLLRCQP 76

Query: 114 LGSDGFDPVPDDLP 127
            G+ G D VP + P
Sbjct: 77  WGTSGIDNVPAEPP 90


>gi|317489240|ref|ZP_07947757.1| hypothetical protein HMPREF1023_01456 [Eggerthella sp. 1_3_56FAA]
 gi|325832222|ref|ZP_08165221.1| YidD family protein [Eggerthella sp. HGA1]
 gi|316911641|gb|EFV33233.1| hypothetical protein HMPREF1023_01456 [Eggerthella sp. 1_3_56FAA]
 gi|325486058|gb|EGC88512.1| YidD family protein [Eggerthella sp. HGA1]
          Length = 77

 Score = 93.0 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 45/74 (60%)

Query: 50  FPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLI 109
           F K +   + + +I  Y+   S +F + CR+ PTCSEYG  A  RYG   G  LT+ R++
Sbjct: 4   FLKQVPCKVAVFLITFYRAAISPLFPSCCRFTPTCSEYGLIAFQRYGFCRGFKLTVKRVL 63

Query: 110 KCNPLGSDGFDPVP 123
           +C P GS G+DPVP
Sbjct: 64  RCRPGGSHGYDPVP 77


>gi|255075883|ref|XP_002501616.1| predicted protein [Micromonas sp. RCC299]
 gi|226516880|gb|ACO62874.1| predicted protein [Micromonas sp. RCC299]
          Length = 64

 Score = 93.0 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 25/64 (39%), Positives = 38/64 (59%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
           + + +IR Y+   S +   +CR++PTCS+Y  +A   +G   GS LT  RL +C P G  
Sbjct: 1   LALALIRFYRTQISPLTPPACRFVPTCSQYAMDAFRTFGAGKGSLLTFWRLARCTPFGGK 60

Query: 118 GFDP 121
           G+DP
Sbjct: 61  GYDP 64


>gi|39998556|ref|NP_954507.1| hypothetical protein GSU3467 [Geobacter sulfurreducens PCA]
 gi|47606239|sp|P61469|Y3467_GEOSL RecName: Full=UPF0161 protein GSU3467
 gi|39985503|gb|AAR36857.1| conserved hypothetical protein TIGR00278 [Geobacter sulfurreducens
           PCA]
 gi|298507498|gb|ADI86221.1| protein of unknown function DUF37 [Geobacter sulfurreducens KN400]
          Length = 69

 Score = 93.0 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 30/64 (46%), Positives = 42/64 (65%)

Query: 60  IGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGF 119
           + II IYQ   S + G +CR+ P+CS Y +E++ RYGL  G WLT +R++KC+P    G 
Sbjct: 6   LYIIGIYQRYLSPLKGPTCRFYPSCSRYAHESLTRYGLVKGLWLTTIRILKCHPFHPGGV 65

Query: 120 DPVP 123
           DPV 
Sbjct: 66  DPVK 69


>gi|317057909|ref|YP_004106376.1| hypothetical protein Rumal_3279 [Ruminococcus albus 7]
 gi|315450178|gb|ADU23742.1| protein of unknown function DUF37 [Ruminococcus albus 7]
          Length = 87

 Score = 93.0 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 24/74 (32%), Positives = 40/74 (54%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           +    +    I++Y+   S +    C+Y P+CS Y  +A  ++G   G+ LT+ RL++CN
Sbjct: 2   SPFAWLARLPIKVYKRFISPMLPAQCKYYPSCSSYALKAYEKHGFLKGTVLTVWRLLRCN 61

Query: 113 PLGSDGFDPVPDDL 126
           P    G D VPD +
Sbjct: 62  PWSLGGIDEVPDRI 75


>gi|160902081|ref|YP_001567662.1| hypothetical protein Pmob_0605 [Petrotoga mobilis SJ95]
 gi|189040563|sp|A9BJC5|Y605_PETMO RecName: Full=UPF0161 protein Pmob_0605
 gi|160359725|gb|ABX31339.1| protein of unknown function DUF37 [Petrotoga mobilis SJ95]
          Length = 89

 Score = 93.0 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + +  I  Y+   S      C YLPTCS Y YEA+ ++G++ G +L   R I+CNPL
Sbjct: 1   MKKLVLKSIDFYRKHISPATPPKCIYLPTCSSYTYEAVEKFGVFKGLYLGFRRFIRCNPL 60

Query: 115 GSDGFDPVPDDLP 127
              G+DPVP+   
Sbjct: 61  HKGGYDPVPEKFS 73


>gi|300725385|ref|YP_003714724.1| hypothetical protein XNC1_4644 [Xenorhabdus nematophila ATCC 19061]
 gi|297631941|emb|CBJ92666.1| conserved hypothetical protein [Xenorhabdus nematophila ATCC 19061]
          Length = 64

 Score = 92.7 bits (229), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 29/64 (45%), Positives = 41/64 (64%)

Query: 69  IFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVPDDLPP 128
           + S + G  CR+ PTCS YG EA+ R+G+  GSWLT+ R++KC+PL   G DPVP     
Sbjct: 1   MISPLLGPRCRFNPTCSHYGIEALRRFGMIKGSWLTVKRILKCHPLHKGGDDPVPPKNDD 60

Query: 129 KKNN 132
            + +
Sbjct: 61  NREH 64


>gi|15896968|ref|NP_350317.1| hypothetical protein CA_C3737 [Clostridium acetobutylicum ATCC 824]
 gi|25009585|sp|Q97CV9|Y3737_CLOAB RecName: Full=UPF0161 protein CA_C3737
 gi|15026844|gb|AAK81657.1|AE007868_13 Uncharacterized conserved protein, YidD family [Clostridium
           acetobutylicum ATCC 824]
 gi|325511145|gb|ADZ22781.1| Conserved hypothetical protein [Clostridium acetobutylicum EA 2018]
          Length = 71

 Score = 92.7 bits (229), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 26/71 (36%), Positives = 46/71 (64%), Gaps = 1/71 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSC-RYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           + R I +  I+ Y++  S +  N+C +++PTCS+Y  +AI +YG   GS++ + R+++CN
Sbjct: 1   MMRRILLKSIKFYRIYLSPLKRNACCKFIPTCSQYAIDAIEKYGALKGSFMAVKRILRCN 60

Query: 113 PLGSDGFDPVP 123
           P    G+DPV 
Sbjct: 61  PFSKGGYDPVK 71


>gi|323138343|ref|ZP_08073414.1| protein of unknown function DUF37 [Methylocystis sp. ATCC 49242]
 gi|322396426|gb|EFX98956.1| protein of unknown function DUF37 [Methylocystis sp. ATCC 49242]
          Length = 109

 Score = 92.7 bits (229), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 36/76 (47%), Positives = 48/76 (63%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            K L       +I +Y++ FS   G +CRY PTCSEY  EAIAR+GLW G W+   R+ +
Sbjct: 5   MKDLPARAARALILVYRVTFSAFAGRTCRYAPTCSEYTDEAIARHGLWAGGWMGFARICR 64

Query: 111 CNPLGSDGFDPVPDDL 126
           C P   +GFDPVP++L
Sbjct: 65  CRPGAGEGFDPVPEEL 80


>gi|91977717|ref|YP_570376.1| hypothetical protein RPD_3251 [Rhodopseudomonas palustris BisB5]
 gi|91684173|gb|ABE40475.1| protein of unknown function DUF37 [Rhodopseudomonas palustris
           BisB5]
          Length = 136

 Score = 92.7 bits (229), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 42/90 (46%), Positives = 52/90 (57%)

Query: 39  NTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLW 98
             P S        K   R  G G+I +Y+   S + G  CR+LPTCS YG EAI R+GLW
Sbjct: 8   KLPSSPTELLHVIKRAPRNAGRGLIWLYRHTLSPLVGYHCRHLPTCSVYGDEAIGRFGLW 67

Query: 99  IGSWLTLLRLIKCNPLGSDGFDPVPDDLPP 128
            G W+TL RL++CNP G+ G D VP   PP
Sbjct: 68  AGGWMTLARLLRCNPYGTSGIDNVPAAAPP 97


>gi|227506190|ref|ZP_03936239.1| possible alpha-hemolysin [Corynebacterium striatum ATCC 6940]
 gi|227197214|gb|EEI77262.1| possible alpha-hemolysin [Corynebacterium striatum ATCC 6940]
          Length = 71

 Score = 92.7 bits (229), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 25/66 (37%), Positives = 39/66 (59%), Gaps = 1/66 (1%)

Query: 59  GIGIIRIYQLIFSNV-FGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
            +  +R YQ   S +   ++CR+ PTCS Y  EA++ +G + G+ + + R+ KC P    
Sbjct: 1   MVKAVRFYQKYLSPLKMVSTCRFEPTCSAYALEALSVHGAFKGTGMAIARVCKCGPWHPG 60

Query: 118 GFDPVP 123
           GFDPVP
Sbjct: 61  GFDPVP 66


>gi|218134372|ref|ZP_03463176.1| hypothetical protein BACPEC_02266 [Bacteroides pectinophilus ATCC
           43243]
 gi|217989757|gb|EEC55768.1| hypothetical protein BACPEC_02266 [Bacteroides pectinophilus ATCC
           43243]
          Length = 71

 Score = 92.7 bits (229), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 43/69 (62%), Gaps = 1/69 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNS-CRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           + R I I  I+ YQ   S +  +S C Y+PTCS+Y  +A+ +YG   GS+L + R+++CN
Sbjct: 1   MVRRILIKAIKFYQKYLSPLKKHSYCIYIPTCSQYAVQALEKYGAVKGSFLAVKRILRCN 60

Query: 113 PLGSDGFDP 121
           P    GFDP
Sbjct: 61  PFAKGGFDP 69


>gi|42563869|ref|NP_187542.2| unknown protein [Arabidopsis thaliana]
 gi|209572699|sp|Q9SR32|U161_ARATH RecName: Full=UPF0161 protein At3g09310
 gi|89274167|gb|ABD65604.1| At3g09310 [Arabidopsis thaliana]
 gi|332641228|gb|AEE74749.1| uncharacterized protein [Arabidopsis thaliana]
          Length = 170

 Score = 92.7 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 34/84 (40%), Positives = 50/84 (59%)

Query: 38  NNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGL 97
           +    +   +G+  +++G    + ++R Y+   S V   SCRY+PTCSEY  EA  +YG+
Sbjct: 57  SKPDPASPQDGEELESVGVKAALAMLRFYKREISPVLPRSCRYVPTCSEYSMEAYKKYGV 116

Query: 98  WIGSWLTLLRLIKCNPLGSDGFDP 121
             G+ LT  RL +CNPLG  GFDP
Sbjct: 117 LKGTVLTTWRLCRCNPLGGSGFDP 140


>gi|148266440|ref|YP_001233146.1| hypothetical protein Gura_4430 [Geobacter uraniireducens Rf4]
 gi|189040188|sp|A5G9V5|Y4430_GEOUR RecName: Full=UPF0161 protein Gura_4430
 gi|146399940|gb|ABQ28573.1| protein of unknown function DUF37 [Geobacter uraniireducens Rf4]
          Length = 70

 Score = 92.7 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 24/70 (34%), Positives = 39/70 (55%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           +  +I    I  YQ   S   G+SCR+ P+CS Y  +++ +YG   G   ++ R++KC+P
Sbjct: 1   MLNIIATRSILFYQRYISPFKGSSCRFYPSCSHYSLQSLEKYGFLKGLLYSVRRIMKCHP 60

Query: 114 LGSDGFDPVP 123
               G+DPV 
Sbjct: 61  FHPGGYDPVK 70


>gi|319789452|ref|YP_004151085.1| protein of unknown function DUF37 [Thermovibrio ammonificans HB-1]
 gi|317113954|gb|ADU96444.1| protein of unknown function DUF37 [Thermovibrio ammonificans HB-1]
          Length = 68

 Score = 92.7 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 24/66 (36%), Positives = 36/66 (54%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I +I+ YQ   S +   +CRY PTCS Y   A+ +YGL  G    + R+++CNP 
Sbjct: 1   MKKLVIALIKFYQRYISPLTPGTCRYYPTCSSYAIMAVEKYGLLKGGVKAVWRVLRCNPF 60

Query: 115 GSDGFD 120
              G D
Sbjct: 61  SRGGVD 66


>gi|313887774|ref|ZP_07821456.1| conserved hypothetical protein [Peptoniphilus harei
           ACS-146-V-Sch2b]
 gi|312846383|gb|EFR33762.1| conserved hypothetical protein [Peptoniphilus harei
           ACS-146-V-Sch2b]
          Length = 71

 Score = 92.7 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 42/69 (60%), Gaps = 2/69 (2%)

Query: 55  GRLIGIGIIRIYQLIFSNVF--GNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
              I + +IR YQ   S     G  CR+ PTCS+Y YEA  +YG + G++LT+ R++KCN
Sbjct: 1   MSKICMLLIRFYQRFISTYLLPGRHCRFEPTCSQYSYEAYEKYGFFKGTYLTIRRILKCN 60

Query: 113 PLGSDGFDP 121
           P    G+DP
Sbjct: 61  PFHKGGYDP 69


>gi|312200978|ref|YP_004021039.1| hypothetical protein FraEuI1c_7205 [Frankia sp. EuI1c]
 gi|311232314|gb|ADP85169.1| protein of unknown function DUF37 [Frankia sp. EuI1c]
          Length = 123

 Score = 92.7 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/86 (32%), Positives = 44/86 (51%), Gaps = 1/86 (1%)

Query: 38  NNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGL 97
                +R+ +G   +     +   +IR YQL++S     +CR+ P+CS Y   A+  +G 
Sbjct: 29  RAPRIARDQSGAV-RGPLAWVLAALIRGYQLVWSPRSAGACRFDPSCSVYALSAVRLHGG 87

Query: 98  WIGSWLTLLRLIKCNPLGSDGFDPVP 123
             G  L   RL++C PL   G+DPVP
Sbjct: 88  VRGGLLAGWRLLRCQPLSRGGYDPVP 113


>gi|300869650|ref|YP_003784521.1| hypothetical protein BP951000_0011 [Brachyspira pilosicoli 95/1000]
 gi|300687349|gb|ADK30020.1| conserved hypothetical protein [Brachyspira pilosicoli 95/1000]
          Length = 70

 Score = 92.3 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 31/70 (44%), Positives = 46/70 (65%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + I + +I IYQ   S     SCRY+P+CSEY  EA+ +YG + GS+L + R+++CNP
Sbjct: 1   MLKKILLFLIFIYQKAISPYLRPSCRYIPSCSEYAKEAVIKYGAFKGSFLAVARVLRCNP 60

Query: 114 LGSDGFDPVP 123
           L    +DPVP
Sbjct: 61  LAKKIYDPVP 70


>gi|284993437|ref|YP_003411992.1| hypothetical protein Gobs_5094 [Geodermatophilus obscurus DSM
           43160]
 gi|284066683|gb|ADB77621.1| protein of unknown function DUF37 [Geodermatophilus obscurus DSM
           43160]
          Length = 93

 Score = 92.3 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 36/70 (51%)

Query: 59  GIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDG 118
            + ++  YQ   S      CR+ PTCS Y  EA+A +G   GSWL L RL+KC P    G
Sbjct: 1   MLAVVGFYQRAISPALPPRCRFQPTCSAYAAEALAVHGAGRGSWLALCRLLKCAPWHPGG 60

Query: 119 FDPVPDDLPP 128
            D VP    P
Sbjct: 61  LDLVPPARTP 70


>gi|331092109|ref|ZP_08340940.1| hypothetical protein HMPREF9477_01583 [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330402310|gb|EGG81881.1| hypothetical protein HMPREF9477_01583 [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 70

 Score = 92.3 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 31/70 (44%), Positives = 45/70 (64%), Gaps = 1/70 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNV-FGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
            + + I +I+ Y+   S +     C Y+PTCSEYG EAI +YG + GS LT+ R+++CNP
Sbjct: 1   MKKLLIMLIKFYRKYLSGLKVRTHCIYIPTCSEYGLEAIEKYGAFKGSLLTIWRIMRCNP 60

Query: 114 LGSDGFDPVP 123
               G+DPVP
Sbjct: 61  FSKGGYDPVP 70


>gi|288818680|ref|YP_003433028.1| hypothetical protein HTH_1376 [Hydrogenobacter thermophilus TK-6]
 gi|288788080|dbj|BAI69827.1| hypothetical protein HTH_1376 [Hydrogenobacter thermophilus TK-6]
 gi|308752268|gb|ADO45751.1| protein of unknown function DUF37 [Hydrogenobacter thermophilus
           TK-6]
          Length = 68

 Score = 92.3 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/66 (42%), Positives = 41/66 (62%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            R I + IIR++Q + S ++  SCRY PTCSEY   +I +YG+  G    L R+++C+PL
Sbjct: 1   MRKICVMIIRLWQRLVSPLYPPSCRYYPTCSEYAILSIEKYGVVKGGLKALWRVLRCHPL 60

Query: 115 GSDGFD 120
              G D
Sbjct: 61  SKGGVD 66


>gi|126724915|ref|ZP_01740758.1| hypothetical protein RB2150_13806 [Rhodobacterales bacterium
           HTCC2150]
 gi|126706079|gb|EBA05169.1| hypothetical protein RB2150_13806 [Rhodobacterales bacterium
           HTCC2150]
          Length = 73

 Score = 92.3 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 29/64 (45%), Positives = 40/64 (62%)

Query: 61  GIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFD 120
             +  Y+  FS+  G +CRY PTCS Y  EA+ ++G   G+WLT  R+ +C+PLG  G D
Sbjct: 10  WPVHAYRKTFSSYVGFNCRYQPTCSAYALEALEKHGAVKGAWLTTKRVCRCHPLGGSGID 69

Query: 121 PVPD 124
            VPD
Sbjct: 70  NVPD 73


>gi|95929983|ref|ZP_01312723.1| protein of unknown function DUF37 [Desulfuromonas acetoxidans DSM
           684]
 gi|95133952|gb|EAT15611.1| protein of unknown function DUF37 [Desulfuromonas acetoxidans DSM
           684]
          Length = 74

 Score = 92.3 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 29/71 (40%), Positives = 46/71 (64%)

Query: 53  TLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
                + + +I IYQ I S +   SCR++PTCSEY   +I +YG ++G + ++LR+++CN
Sbjct: 4   NPLVNMSLFLINIYQRIISPLTPPSCRFIPTCSEYAILSIKKYGFFVGVFKSVLRILRCN 63

Query: 113 PLGSDGFDPVP 123
           PL   G+DPV 
Sbjct: 64  PLFKGGYDPVK 74


>gi|170751030|ref|YP_001757290.1| hypothetical protein Mrad2831_4641 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170657552|gb|ACB26607.1| protein of unknown function DUF37 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 110

 Score = 92.3 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 34/74 (45%), Positives = 44/74 (59%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + R      IR YQL  S + G  CR+ P+CSEY   AIAR+GLW G W+   R+ +C P
Sbjct: 1   MVRRAAHWAIRGYQLTLSGLVGRQCRHWPSCSEYTDTAIARHGLWPGGWMGFARICRCGP 60

Query: 114 LGSDGFDPVPDDLP 127
            G+ G D VP+ LP
Sbjct: 61  FGTHGIDLVPERLP 74


>gi|254456047|ref|ZP_05069476.1| conserved hypothetical protein TIGR00278 [Candidatus Pelagibacter
           sp. HTCC7211]
 gi|207083049|gb|EDZ60475.1| conserved hypothetical protein TIGR00278 [Candidatus Pelagibacter
           sp. HTCC7211]
          Length = 83

 Score = 92.3 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 34/71 (47%), Positives = 49/71 (69%), Gaps = 4/71 (5%)

Query: 64  RIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL----GSDGF 119
           + Y+   S +FG+SCRYLPTCSEY  EA+  +GL  G++L+L R++ C+P+    G DGF
Sbjct: 13  KGYKFFISPLFGHSCRYLPTCSEYSIEALKEFGLAKGTFLSLKRILSCHPIKFLGGGDGF 72

Query: 120 DPVPDDLPPKK 130
           DPV  ++  KK
Sbjct: 73  DPVKKNIKVKK 83


>gi|42527899|ref|NP_972997.1| hypothetical protein TDE2398 [Treponema denticola ATCC 35405]
 gi|47606244|sp|P61474|Y2398_TREDE RecName: Full=UPF0161 protein TDE_2398
 gi|41818944|gb|AAS12916.1| conserved hypothetical protein TIGR00278 [Treponema denticola ATCC
           35405]
 gi|325474884|gb|EGC78070.1| hypothetical protein HMPREF9353_00917 [Treponema denticola F0402]
          Length = 73

 Score = 92.3 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 32/73 (43%), Positives = 43/73 (58%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            + L        I  YQ   S  F  SCRY PTCS+Y  E+I +YG + G+ + LLR+++
Sbjct: 1   MRKLLVSFLCACIIFYQKAISPHFPPSCRYEPTCSQYAIESIKKYGPFKGAGMALLRILR 60

Query: 111 CNPLGSDGFDPVP 123
           CNPL   G+DPVP
Sbjct: 61  CNPLCKGGYDPVP 73


>gi|225440388|ref|XP_002268102.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 143

 Score = 91.9 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 36/85 (42%), Positives = 50/85 (58%), Gaps = 5/85 (5%)

Query: 37  KNNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYG 96
            N+TP+    +      +G    + ++R Y+   S +  NSCRY+PTCSEY  EA  +YG
Sbjct: 52  HNSTPQDSEVDN-----IGVKAALSMLRFYKREISPLLPNSCRYVPTCSEYSMEAYKKYG 106

Query: 97  LWIGSWLTLLRLIKCNPLGSDGFDP 121
           +  G+ LT  RL +CNPLG  GFDP
Sbjct: 107 VVKGTVLTTWRLCRCNPLGGSGFDP 131


>gi|257792847|ref|YP_003183453.1| hypothetical protein Elen_3122 [Eggerthella lenta DSM 2243]
 gi|257476744|gb|ACV57064.1| protein of unknown function DUF37 [Eggerthella lenta DSM 2243]
          Length = 77

 Score = 91.9 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 31/74 (41%), Positives = 45/74 (60%)

Query: 50  FPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLI 109
           F K +   + + ++  Y+   S +F + CR+ PTCSEYG  A  RYG   G  LT+ R++
Sbjct: 4   FLKQVPCKVAVFLVTFYRAAISPLFPSCCRFTPTCSEYGLIAFQRYGFCRGLKLTVKRVL 63

Query: 110 KCNPLGSDGFDPVP 123
           +C P GS G+DPVP
Sbjct: 64  RCRPGGSHGYDPVP 77


>gi|307106540|gb|EFN54785.1| hypothetical protein CHLNCDRAFT_23959 [Chlorella variabilis]
          Length = 76

 Score = 91.9 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 26/61 (42%), Positives = 38/61 (62%)

Query: 62  IIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDP 121
           +++ Y+   S +   +CR+ PTCS Y  EA  RYG+  G  LT  RL++C P G+ G+DP
Sbjct: 1   MLKFYKAAISPLLPPACRFQPTCSVYSMEAFQRYGVGKGFVLTAWRLLRCTPWGNSGYDP 60

Query: 122 V 122
           V
Sbjct: 61  V 61


>gi|300780161|ref|ZP_07090017.1| possible alpha-hemolysin [Corynebacterium genitalium ATCC 33030]
 gi|300534271|gb|EFK55330.1| possible alpha-hemolysin [Corynebacterium genitalium ATCC 33030]
          Length = 72

 Score = 91.9 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 1/66 (1%)

Query: 59  GIGIIRIYQLIFSNV-FGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
            +G +R+YQ   S +   ++CR+ PTCS Y  EA++R+G   GS L + R+ KC P    
Sbjct: 5   LVGAVRLYQKWVSPLKMVSTCRFEPTCSAYALEAVSRHGAGRGSLLAVARVCKCGPWHPG 64

Query: 118 GFDPVP 123
           G+DPVP
Sbjct: 65  GYDPVP 70


>gi|62391945|ref|YP_227347.1| hypothetical protein cg3430 [Corynebacterium glutamicum ATCC 13032]
 gi|47606235|sp|P61465|Y3097_CORGL RecName: Full=UPF0161 protein Cgl3097.1/cg3430
 gi|41223092|emb|CAF19037.1| conserved hypothetical protein [Corynebacterium glutamicum ATCC
           13032]
          Length = 99

 Score = 91.9 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 28/76 (36%), Positives = 43/76 (56%), Gaps = 1/76 (1%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNV-FGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLI 109
           PK++        +R YQ   S +  G++CR+ P CS Y  +A++ +G + G+ L+  RL 
Sbjct: 15  PKSIPAKTAASAVRFYQKYLSGLKMGSTCRFDPVCSTYALKAVSVHGAFKGTILSAARLS 74

Query: 110 KCNPLGSDGFDPVPDD 125
           KC P    GFDPVP+ 
Sbjct: 75  KCGPWHPGGFDPVPNH 90


>gi|332666415|ref|YP_004449203.1| hypothetical protein Halhy_4490 [Haliscomenobacter hydrossis DSM
           1100]
 gi|332335229|gb|AEE52330.1| UPF0161 protein yidD [Haliscomenobacter hydrossis DSM 1100]
          Length = 105

 Score = 91.5 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 28/83 (33%), Positives = 45/83 (54%), Gaps = 2/83 (2%)

Query: 42  KSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGS 101
           K+ + +  + + + + I I  IR Y++    V    C Y P+CS Y  +AI ++G   G 
Sbjct: 18  KNMSLSQSWKRAI-KYILILPIRFYKVAIWPVLKPHCAYNPSCSAYMVDAIEQWG-IRGV 75

Query: 102 WLTLLRLIKCNPLGSDGFDPVPD 124
           W+ L R+ +C+P G  G DPVP 
Sbjct: 76  WMGLKRIGRCHPWGGFGPDPVPK 98


>gi|150009642|ref|YP_001304385.1| hypothetical protein BDI_3056 [Parabacteroides distasonis ATCC
           8503]
 gi|259646932|sp|A6LGE9|Y3056_PARD8 RecName: Full=UPF0161 protein BDI_3056
 gi|149938066|gb|ABR44763.1| conserved hypothetical protein [Parabacteroides distasonis ATCC
           8503]
          Length = 73

 Score = 91.5 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 26/73 (35%), Positives = 42/73 (57%)

Query: 51  PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIK 110
            +     + +  +  Y+   S +   SCRY PTCSEY  +A+ +YG   G +L + R+++
Sbjct: 1   MRRFFTTLLLLPVYFYKYCISLMTPASCRYTPTCSEYAVQALKKYGPVKGLYLAVKRILR 60

Query: 111 CNPLGSDGFDPVP 123
           C+P G  G+DPVP
Sbjct: 61  CHPWGGSGYDPVP 73


>gi|50955954|ref|YP_063242.1| alpha-hemolysin [Leifsonia xyli subsp. xyli str. CTCB07]
 gi|71658768|sp|Q6ABV4|Y2527_LEIXX RecName: Full=UPF0161 protein Lxx25275
 gi|50952436|gb|AAT90137.1| alpha-hemolysin [Leifsonia xyli subsp. xyli str. CTCB07]
          Length = 85

 Score = 91.5 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 41/62 (66%)

Query: 62  IIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDP 121
           ++R Y+ +FS  +G+ CRY P+CS Y  +A+  +G+  G +L + R+++C+P  + G D 
Sbjct: 1   MLRGYRAVFSPFYGDVCRYYPSCSAYTLQAVQEHGVIFGGYLGVCRILRCHPWAAGGVDD 60

Query: 122 VP 123
           VP
Sbjct: 61  VP 62


>gi|310659887|ref|YP_003937608.1| hypothetical protein CLOST_2588 [Clostridium sticklandii DSM 519]
 gi|308826665|emb|CBH22703.1| conserved protein of unknown function [Clostridium sticklandii]
          Length = 73

 Score = 91.5 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 27/57 (47%), Positives = 37/57 (64%)

Query: 65  IYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDP 121
            YQ   S + G +CR+ PTCS Y  EAI +YG   GS+L+L R++KC+P    G+DP
Sbjct: 15  FYQKFISPLKGPTCRFYPTCSAYSIEAIKKYGPIKGSYLSLRRILKCHPFHEGGYDP 71


>gi|257070289|ref|YP_003156544.1| hypothetical protein Bfae_31960 [Brachybacterium faecium DSM 4810]
 gi|256561107|gb|ACU86954.1| conserved hypothetical protein TIGR00278 [Brachybacterium faecium
           DSM 4810]
          Length = 95

 Score = 91.5 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 30/76 (39%), Positives = 42/76 (55%), Gaps = 2/76 (2%)

Query: 63  IRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           +R YQ+  S     +CRY P CS+YG +A+  +G   G  LT  R+++CNP    G DPV
Sbjct: 19  VRGYQVGISPYTPPACRYDPVCSQYGMDALRVHGAVKGFLLTTGRILRCNPFTRGGLDPV 78

Query: 123 PDDLPPKKNNPKLLSK 138
           P   P    NP+ L +
Sbjct: 79  P--APGMWRNPRRLRR 92


>gi|297740358|emb|CBI30540.3| unnamed protein product [Vitis vinifera]
          Length = 140

 Score = 91.5 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 36/85 (42%), Positives = 50/85 (58%), Gaps = 5/85 (5%)

Query: 37  KNNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYG 96
            N+TP+    +      +G    + ++R Y+   S +  NSCRY+PTCSEY  EA  +YG
Sbjct: 49  HNSTPQDSEVDN-----IGVKAALSMLRFYKREISPLLPNSCRYVPTCSEYSMEAYKKYG 103

Query: 97  LWIGSWLTLLRLIKCNPLGSDGFDP 121
           +  G+ LT  RL +CNPLG  GFDP
Sbjct: 104 VVKGTVLTTWRLCRCNPLGGSGFDP 128


>gi|167626981|ref|YP_001677481.1| hypothetical protein Fphi_0759 [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|167596982|gb|ABZ86980.1| conserved hypothetical protein [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
          Length = 94

 Score = 91.5 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 31/85 (36%), Positives = 43/85 (50%), Gaps = 1/85 (1%)

Query: 49  KFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRL 108
           KF K +     I II +Y+   S      CRY PTCSEY  EA+  +G+  G +L+  RL
Sbjct: 9   KFFKRITLAPFIAIINLYRYCISPFIPARCRYYPTCSEYALEALKTHGILKGLYLSTRRL 68

Query: 109 IKCNPLGS-DGFDPVPDDLPPKKNN 132
           ++C+P    D +D VP       N 
Sbjct: 69  LRCHPFAKRDYYDLVPCKNKKVNNK 93


>gi|262277964|ref|ZP_06055757.1| conserved hypothetical protein [alpha proteobacterium HIMB114]
 gi|262225067|gb|EEY75526.1| conserved hypothetical protein [alpha proteobacterium HIMB114]
          Length = 85

 Score = 91.5 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 46/72 (63%), Gaps = 4/72 (5%)

Query: 58  IGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL--- 114
           + IGII+ Y+ + S + G +CR+LPTCS+Y  E+I + G   G +  + R++KC+P+   
Sbjct: 11  LLIGIIKTYKYLISPLLGPNCRFLPTCSDYFIESIQKKGFLNGCYSGMKRILKCHPIKFL 70

Query: 115 -GSDGFDPVPDD 125
            G+ GFDPV   
Sbjct: 71  GGNSGFDPVEKK 82


>gi|188996899|ref|YP_001931150.1| protein of unknown function DUF37 [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188931966|gb|ACD66596.1| protein of unknown function DUF37 [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 69

 Score = 91.5 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 27/67 (40%), Positives = 40/67 (59%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + + I +IR YQ   S + G SCR+ PTCSEY   +I +YG+  GS   + R+++CNP
Sbjct: 1   MIKRLFINVIRFYQKYISPIKGQSCRFHPTCSEYAVLSIEKYGIIKGSLKAIWRILRCNP 60

Query: 114 LGSDGFD 120
               G D
Sbjct: 61  FSKGGVD 67


>gi|158321893|ref|YP_001514400.1| hypothetical protein Clos_2875 [Alkaliphilus oremlandii OhILAs]
 gi|166988539|sp|A8MKS2|Y2875_ALKOO RecName: Full=UPF0161 protein Clos_2875
 gi|158142092|gb|ABW20404.1| protein of unknown function DUF37 [Alkaliphilus oremlandii OhILAs]
          Length = 69

 Score = 91.5 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 28/67 (41%), Positives = 41/67 (61%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
              + I +I+IY+   S +   SCR+ PTCS Y   A  RYG + G++LTL R++KC+P 
Sbjct: 1   MSRLCIFLIQIYRKYISPLKRPSCRFHPTCSAYSMAAYERYGFFKGTYLTLKRILKCHPF 60

Query: 115 GSDGFDP 121
              G+DP
Sbjct: 61  HPGGYDP 67


>gi|188587522|ref|YP_001919067.1| protein of unknown function DUF37 [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|179352209|gb|ACB86479.1| protein of unknown function DUF37 [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 70

 Score = 91.5 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 38/59 (64%)

Query: 64  RIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV 122
           R YQ I S V   SCR++PTCSEY  + I +YG++ G  +   R+IKC+P    G+DPV
Sbjct: 11  RAYQRIISPVLPKSCRFIPTCSEYAIQVIDKYGIFKGGTMAFKRIIKCHPFHEGGYDPV 69


>gi|262340810|ref|YP_003283665.1| hypothetical protein BLBBGE_018 [Blattabacterium sp. (Blattella
           germanica) str. Bge]
 gi|262272147|gb|ACY40055.1| hypothetical protein BLBBGE_018 [Blattabacterium sp. (Blattella
           germanica) str. Bge]
          Length = 74

 Score = 91.1 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 42/66 (63%)

Query: 56  RLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLG 115
           ++  I  I+ Y++  S   GN+CRY+PTCS+Y  +++  Y ++    ++  R+IKCNP G
Sbjct: 6   KIFFIKSIQFYKMGISPWIGNNCRYIPTCSDYMIQSLKEYNIFKAISMSFKRIIKCNPWG 65

Query: 116 SDGFDP 121
             GFDP
Sbjct: 66  DSGFDP 71


>gi|118594211|ref|ZP_01551558.1| hypothetical protein MB2181_01045 [Methylophilales bacterium
           HTCC2181]
 gi|118439989|gb|EAV46616.1| hypothetical protein MB2181_01045 [Methylophilales bacterium
           HTCC2181]
          Length = 64

 Score = 91.1 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 27/64 (42%), Positives = 39/64 (60%)

Query: 62  IIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDP 121
           +I+IYQ   S  FG  CR+ P+CS Y  EA+  +G + GSW+ + RL++C P    G DP
Sbjct: 1   MIKIYQYALSPFFGTQCRFTPSCSAYTIEALESFGFFKGSWIAIKRLLRCRPGVPGGLDP 60

Query: 122 VPDD 125
           +P  
Sbjct: 61  LPKK 64


>gi|303286525|ref|XP_003062552.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226456069|gb|EEH53371.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 70

 Score = 91.1 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 40/68 (58%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
               + + +IR Y+   S +   SCR++PTCS Y   A  +YG W G  LT  R+++CNP
Sbjct: 3   PLTRVALALIRFYRTQISPLTPPSCRFVPTCSSYAVSAYKKYGPWRGFALTAWRILRCNP 62

Query: 114 LGSDGFDP 121
           LG  G+DP
Sbjct: 63  LGGRGYDP 70


>gi|158422569|ref|YP_001523861.1| unknown function protein [Azorhizobium caulinodans ORS 571]
 gi|158329458|dbj|BAF86943.1| unknown function protein [Azorhizobium caulinodans ORS 571]
          Length = 130

 Score = 91.1 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 33/63 (52%), Positives = 40/63 (63%)

Query: 65  IYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVPD 124
            Y+   S   G  CRYLPTCS Y  EAI+R+G W G W+ L R+ +C+P G  GFDPVP 
Sbjct: 44  FYRYTLSAFMGRQCRYLPTCSAYAEEAISRHGAWAGGWMGLSRICRCHPWGDAGFDPVPQ 103

Query: 125 DLP 127
            LP
Sbjct: 104 CLP 106


>gi|256545947|ref|ZP_05473302.1| toxin-antitoxin system, toxin component [Anaerococcus vaginalis
           ATCC 51170]
 gi|256398369|gb|EEU11991.1| toxin-antitoxin system, toxin component [Anaerococcus vaginalis
           ATCC 51170]
          Length = 70

 Score = 90.7 bits (224), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 22/69 (31%), Positives = 38/69 (55%), Gaps = 1/69 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGN-SCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           +   + + +IR YQL  S + G+  C+Y PTCS+Y  +   +Y  +   +    R+++CN
Sbjct: 1   MLNKLFLILIRFYQLFISPLLGSGKCKYYPTCSQYAIDCFKKYNFFKAFFKACWRILRCN 60

Query: 113 PLGSDGFDP 121
           P    G+DP
Sbjct: 61  PFSKGGYDP 69


>gi|187251669|ref|YP_001876151.1| hypothetical protein Emin_1264 [Elusimicrobium minutum Pei191]
 gi|186971829|gb|ACC98814.1| hypothetical protein Emin_1264 [Elusimicrobium minutum Pei191]
          Length = 77

 Score = 90.7 bits (224), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 27/71 (38%), Positives = 48/71 (67%), Gaps = 1/71 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNS-CRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           + +   + ++  +++    + G + CR+ P+C++Y  EAI +YGL  GS+LT+ RL+KC+
Sbjct: 7   IAKKTAVFLLDAFKICVRPLLGPAACRFYPSCTQYSKEAILKYGLLKGSYLTVKRLLKCH 66

Query: 113 PLGSDGFDPVP 123
           PL + G+DPVP
Sbjct: 67  PLHAGGYDPVP 77


>gi|298291993|ref|YP_003693932.1| hypothetical protein Snov_2015 [Starkeya novella DSM 506]
 gi|296928504|gb|ADH89313.1| protein of unknown function DUF37 [Starkeya novella DSM 506]
          Length = 101

 Score = 90.7 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 36/83 (43%), Positives = 50/83 (60%), Gaps = 1/83 (1%)

Query: 47  NGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLL 106
            GK  + L RL     I +Y+   S   G  CRYLPTCSE+  EAI+R+G W G W+   
Sbjct: 4   AGKIAR-LPRLALRAPILVYRYSLSAFMGRQCRYLPTCSEFADEAISRHGAWAGGWMAAG 62

Query: 107 RLIKCNPLGSDGFDPVPDDLPPK 129
           R+ +C+P G  GF+ VP ++PP+
Sbjct: 63  RICRCHPWGGSGFEAVPVEVPPR 85


>gi|225848363|ref|YP_002728526.1| hypothetical protein SULAZ_0536 [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|108945893|gb|ABG23483.1| YidD [Sulfurihydrogenibium azorense]
 gi|225644009|gb|ACN99059.1| conserved hypothetical protein [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 69

 Score = 90.7 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 37/67 (55%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           +   + I +I++YQ   S +   SCR+ PTCS Y   AI +YG   GS   + R+++CNP
Sbjct: 1   MLSKLLINLIKLYQKYVSPLKKPSCRFYPTCSNYAILAIEKYGFLKGSLKAVWRVLRCNP 60

Query: 114 LGSDGFD 120
               G D
Sbjct: 61  FSKGGVD 67


>gi|328676142|gb|AEB27012.1| hypothetical protein FNFX1_0064 [Francisella cf. novicida Fx1]
          Length = 90

 Score = 90.7 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 30/80 (37%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 50  FPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLI 109
           F K +  +  + +I +Y+   S      CRY PTCSEY  EA+  +G+  G +LT  RL+
Sbjct: 10  FFKKITLIPFVMLINLYRYCISPFIPARCRYYPTCSEYALEALKTHGILKGLYLTTRRLL 69

Query: 110 KCNPLGS-DGFDPVPDDLPP 128
           +C+PL   D +DPVP     
Sbjct: 70  RCHPLSKRDYYDPVPCKNKK 89


>gi|237756917|ref|ZP_04585389.1| conserved hypothetical protein [Sulfurihydrogenibium yellowstonense
           SS-5]
 gi|237690918|gb|EEP60054.1| conserved hypothetical protein [Sulfurihydrogenibium yellowstonense
           SS-5]
          Length = 69

 Score = 90.7 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 26/67 (38%), Positives = 40/67 (59%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
           + + + I +IR YQ   S + G SCR+ PTCSEY   +I +YG+  G+   + R+++CNP
Sbjct: 1   MIKKLFINVIRFYQKYISPIKGQSCRFHPTCSEYAALSIEKYGIIKGTLKAIWRILRCNP 60

Query: 114 LGSDGFD 120
               G D
Sbjct: 61  FFKGGVD 67


>gi|296118601|ref|ZP_06837179.1| putative toxin-antitoxin system, toxin component [Corynebacterium
           ammoniagenes DSM 20306]
 gi|295968500|gb|EFG81747.1| putative toxin-antitoxin system, toxin component [Corynebacterium
           ammoniagenes DSM 20306]
          Length = 91

 Score = 90.7 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%)

Query: 59  GIGIIRIYQLIFSNVFG-NSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
            +  +R YQ   S +   ++CR+ PTCS Y  EA++ +G   G+ L   RL+KC P    
Sbjct: 24  LVKAVRFYQKHVSPLKTVSTCRFEPTCSAYALEAVSIHGAVRGAGLAAARLVKCGPWHPG 83

Query: 118 GFDPVPDD 125
           GFDPVP  
Sbjct: 84  GFDPVPKK 91


>gi|150019910|ref|YP_001312164.1| hypothetical protein Cbei_5102 [Clostridium beijerinckii NCIMB
           8052]
 gi|189040231|sp|A6M3M8|Y5102_CLOB8 RecName: Full=UPF0161 protein Cbei_5102
 gi|149906375|gb|ABR37208.1| protein of unknown function DUF37 [Clostridium beijerinckii NCIMB
           8052]
          Length = 69

 Score = 90.3 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 43/68 (63%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPL 114
            + + I +I+ Y+   S    + CR++PTCS+Y  +AI +YG + GS L + R+++CNP 
Sbjct: 1   MKKLLIRLIKFYRKYISPGRSSCCRFVPTCSQYAIDAINKYGAFKGSALAVYRILRCNPF 60

Query: 115 GSDGFDPV 122
              G+DPV
Sbjct: 61  CKGGYDPV 68


>gi|311741702|ref|ZP_07715524.1| conserved hypothetical protein [Corynebacterium pseudogenitalium
           ATCC 33035]
 gi|311303223|gb|EFQ79304.1| conserved hypothetical protein [Corynebacterium pseudogenitalium
           ATCC 33035]
          Length = 71

 Score = 90.3 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 25/66 (37%), Positives = 40/66 (60%), Gaps = 1/66 (1%)

Query: 59  GIGIIRIYQLIFSNV-FGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSD 117
            + ++R YQ   S +   ++CR+ PTCS Y  EA++++G   G+ + + R+ KC P    
Sbjct: 1   MVKVVRFYQKHVSGLKMVSTCRFEPTCSAYALEALSQHGAIKGTAMAIARVCKCGPWHPG 60

Query: 118 GFDPVP 123
           GFDPVP
Sbjct: 61  GFDPVP 66


>gi|169829702|ref|YP_001699860.1| hypothetical protein Bsph_4271 [Lysinibacillus sphaericus C3-41]
 gi|168994190|gb|ACA41730.1| UPF0161 protein [Lysinibacillus sphaericus C3-41]
          Length = 59

 Score = 90.3 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 37/59 (62%)

Query: 73  VFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVPDDLPPKKN 131
           +   +CR+ PTCS YG EA  ++G   G  LT+ R+ KC+P    GFDPVP+  P KKN
Sbjct: 1   MTPPTCRFHPTCSSYGLEAFQKHGALKGFILTITRISKCHPFHPGGFDPVPEKWPSKKN 59


>gi|298345819|ref|YP_003718506.1| hypothetical protein HMPREF0573_10693 [Mobiluncus curtisii ATCC
           43063]
 gi|304390477|ref|ZP_07372430.1| YidD family protein [Mobiluncus curtisii subsp. curtisii ATCC
           35241]
 gi|315657686|ref|ZP_07910568.1| YidD family protein [Mobiluncus curtisii subsp. holmesii ATCC
           35242]
 gi|298235880|gb|ADI67012.1| conserved hypothetical protein [Mobiluncus curtisii ATCC 43063]
 gi|304326233|gb|EFL93478.1| YidD family protein [Mobiluncus curtisii subsp. curtisii ATCC
           35241]
 gi|315492158|gb|EFU81767.1| YidD family protein [Mobiluncus curtisii subsp. holmesii ATCC
           35242]
          Length = 132

 Score = 90.3 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 39/75 (52%)

Query: 49  KFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRL 108
           ++   L   +    I IYQ   S  FG  C+Y P+CS Y   A+  +G W GS LTL RL
Sbjct: 9   RWVWNLPATVSRLFIHIYQHTLSKAFGPVCKYYPSCSHYADLALQVHGFWKGSALTLWRL 68

Query: 109 IKCNPLGSDGFDPVP 123
           ++CNP    G D  P
Sbjct: 69  LRCNPYSDGGVDYPP 83


>gi|315654392|ref|ZP_07907300.1| YidD family protein [Mobiluncus curtisii ATCC 51333]
 gi|315491427|gb|EFU81044.1| YidD family protein [Mobiluncus curtisii ATCC 51333]
          Length = 132

 Score = 90.3 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 39/75 (52%)

Query: 49  KFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRL 108
           ++   L   +    I IYQ   S  FG  C+Y P+CS Y   A+  +G W GS LTL RL
Sbjct: 9   RWVWNLPATVSRLFIHIYQHTLSKAFGPVCKYYPSCSHYADLALQVHGFWKGSALTLWRL 68

Query: 109 IKCNPLGSDGFDPVP 123
           ++CNP    G D  P
Sbjct: 69  LRCNPYSDGGVDYPP 83


>gi|258593683|emb|CBE70024.1| conserved protein of unknown function [NC10 bacterium 'Dutch
           sediment']
          Length = 90

 Score = 90.3 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 29/92 (31%), Positives = 45/92 (48%), Gaps = 4/92 (4%)

Query: 32  SPLLLKNNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEA 91
           + +   +  P +       P  + R I +     Y+ + S +   +CR+ PTC++Y  EA
Sbjct: 3   TRVNSHHPAPPNHRLGQVTPARIVRGILVA----YKAMVSPLLPPACRFYPTCADYADEA 58

Query: 92  IARYGLWIGSWLTLLRLIKCNPLGSDGFDPVP 123
           I RYGL  G  L   RL +C+P    G+DPV 
Sbjct: 59  IGRYGLTRGLLLAAYRLARCHPWCEGGYDPVK 90


>gi|212697391|ref|ZP_03305519.1| hypothetical protein ANHYDRO_01961 [Anaerococcus hydrogenalis DSM
           7454]
 gi|212675583|gb|EEB35190.1| hypothetical protein ANHYDRO_01961 [Anaerococcus hydrogenalis DSM
           7454]
          Length = 70

 Score = 90.3 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 23/69 (33%), Positives = 38/69 (55%), Gaps = 1/69 (1%)

Query: 54  LGRLIGIGIIRIYQLIFSNVFGN-SCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCN 112
           +   + + IIR YQL  S + G+  C+Y PTCS+Y  +   +Y  +   +    R+++CN
Sbjct: 1   MLNKLFLIIIRFYQLFISPLLGSGKCKYYPTCSQYAIDCFKKYNFFKAFFKASWRILRCN 60

Query: 113 PLGSDGFDP 121
           P    G+DP
Sbjct: 61  PFSKGGYDP 69


>gi|169825324|ref|YP_001692935.1| hypothetical protein FMG_1627 [Finegoldia magna ATCC 29328]
 gi|303234451|ref|ZP_07321089.1| conserved hypothetical protein [Finegoldia magna BVS033A4]
 gi|226736379|sp|B0S3V5|Y1627_FINM2 RecName: Full=UPF0161 protein FMG_1627
 gi|167832129|dbj|BAG09045.1| conserved hypothetical protein [Finegoldia magna ATCC 29328]
 gi|302494406|gb|EFL54174.1| conserved hypothetical protein [Finegoldia magna BVS033A4]
          Length = 70

 Score = 90.3 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 1/68 (1%)

Query: 55  GRLIGIGIIRIYQLIFSNVFGN-SCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNP 113
              + I +I+ YQ   S   G   C+Y PTCS+Y  EA  +   +    LT+ R+++CNP
Sbjct: 1   MSKVMIFLIKFYQKAI