RPSBLAST alignment for GI: 254780883 and conserved domain: PRK14376

>gnl|CDD|172852 PRK14376, PRK14376, hypothetical protein; Provisional. Length = 176
 Score = 64.2 bits (156), Expect = 1e-11
 Identities = 28/78 (35%), Positives = 44/78 (56%)

Query: 61  GIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFD 120
           G++R+Y+  +S      CR+ P+CS Y   A+ R+G   G  L + RL++C PL + G+D
Sbjct: 47  GLVRLYRAGWSGRNAGCCRFEPSCSAYALTAVRRHGGVRGGLLAVRRLLRCQPLSAGGYD 106

Query: 121 PVPDDLPPKKNNPKLLSK 138
           PVP + P     P  + K
Sbjct: 107 PVPGEAPGTSVGPGTVRK 124