RPSBLAST alignment for GI: 254780883 and conserved domain: PRK14378

>gnl|CDD|172854 PRK14378, PRK14378, hypothetical protein; Provisional. Length = 103
 Score = 69.2 bits (169), Expect = 3e-13
 Identities = 28/68 (41%), Positives = 42/68 (61%)

Query: 56  RLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLG 115
           R   I +IR+Y+ + S  +G+ CRY P+CS YG EA+  +GL  G +L + R+ +C+P  
Sbjct: 13  RNAAIAVIRLYRRVVSPFYGDVCRYYPSCSAYGLEAVQEHGLIFGGYLAVWRVCRCHPWA 72

Query: 116 SDGFDPVP 123
             G D VP
Sbjct: 73  EGGIDDVP 80