RPSBLAST alignment for GI: 254780883 and conserved domain: PRK14383

>gnl|CDD|172859 PRK14383, PRK14383, hypothetical protein; Provisional. Length = 84
 Score = 70.4 bits (172), Expect = 1e-13
 Identities = 32/73 (43%), Positives = 44/73 (60%), Gaps = 1/73 (1%)

Query: 62  IIRIYQLIFS-NVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFD 120
            +R YQ + S      +CR+ PTCS+Y  EAI R+G   G WL L R+++CNPL   GFD
Sbjct: 11  AVRWYQRVLSPRKPAPTCRFSPTCSQYAVEAIERHGALKGGWLALWRVLRCNPLVPGGFD 70

Query: 121 PVPDDLPPKKNNP 133
           PVP+  P ++   
Sbjct: 71  PVPEHFPARRPRH 83