RPSBLAST alignment for GI: 254780883 and conserved domain: PRK14370

>gnl|CDD|184651 PRK14370, PRK14370, hypothetical protein; Provisional. Length = 120
 Score = 72.2 bits (177), Expect = 4e-14
 Identities = 34/72 (47%), Positives = 44/72 (61%), Gaps = 1/72 (1%)

Query: 52  KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKC 111
           K L +L+ +  I  YQ I S +    CRY PTCS YG +AIA +G+  GS L L R+ +C
Sbjct: 7   KYLYKLL-LAFIHFYQRIISPILPARCRYYPTCSNYGKQAIAWHGVGKGSLLLLKRIGRC 65

Query: 112 NPLGSDGFDPVP 123
           +PLG  G D VP
Sbjct: 66  HPLGGHGIDFVP 77