RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780883|ref|YP_003065296.1| hypothetical protein CLIBASIA_03900 [Candidatus Liberibacter asiaticus str. psy62] (139 letters) >1ryp_E 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_D* 1g65_D 2f16_D* 2fak_D* 2fny_D* 2gpl_D* 3d29_D* 3dy3_D* 3dy4_D* 3e47_D* 3gpj_D* 3gpt_D* 3gpw_D* 3hye_D* 2z5c_C 3bdm_D* 1z7q_E 1fnt_E* 2zcy_D* 1g0u_D Length = 242 Score = 26.6 bits (58), Expect = 2.2 Identities = 11/30 (36%), Positives = 15/30 (50%), Gaps = 6/30 (20%) Query: 12 DRYLTTFS------QSSYALPIQKKGSPLL 35 DR ++TFS Q Y+L K GS + Sbjct: 1 DRGVSTFSPEGRLFQVEYSLEAIKLGSTAI 30 >1yar_A Proteasome alpha subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase/hydrolase activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_A 1pma_A 3c91_A 3c92_A 1yau_A 3jrm_A 3jse_A 3jtl_A Length = 233 Score = 26.2 bits (57), Expect = 2.9 Identities = 12/34 (35%), Positives = 14/34 (41%), Gaps = 6/34 (17%) Query: 8 STSSDRYLTTFS------QSSYALPIQKKGSPLL 35 + R +T FS Q YA KKGS L Sbjct: 5 QMAYSRAITVFSPDGRLFQVEYAREAVKKGSTAL 38 >1iru_D 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 Length = 248 Score = 25.7 bits (56), Expect = 3.9 Identities = 12/30 (40%), Positives = 14/30 (46%), Gaps = 6/30 (20%) Query: 12 DRYLTTFS------QSSYALPIQKKGSPLL 35 DR +T FS Q YA KKGS + Sbjct: 4 DRAITVFSPDGHLFQVEYAQEAVKKGSTAV 33 >1s58_A B19 parvovirus capsid; icosahedral capsid, beta-barrel, icosahedral virus; 3.50A {Human parvovirus B19} SCOP: b.121.5.2 Length = 554 Score = 25.3 bits (55), Expect = 5.0 Identities = 10/69 (14%), Positives = 21/69 (30%) Query: 7 DSTSSDRYLTTFSQSSYALPIQKKGSPLLLKNNTPKSRNWNGKFPKTLGRLIGIGIIRIY 66 +T S +T + +P + + N +GK K +G + Sbjct: 28 GATFSANSVTCTFSRQFLIPYDPEHHYKVFSPAASSCHNASGKEAKVCTITPIMGYSTPW 87 Query: 67 QLIFSNVFG 75 + + N Sbjct: 88 RYLDFNALN 96 >3bg1_B Nucleoporin NUP145; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Saccharomyces cerevisiae} PDB: 3bg0_B Length = 442 Score = 25.3 bits (55), Expect = 5.2 Identities = 10/38 (26%), Positives = 16/38 (42%) Query: 52 KTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGY 89 T G I I +IY+L+ + F SE+ + Sbjct: 234 STGGCSIDKNISKIYKLLSGSPFEGLFSLKELESEFSW 271 >3jrt_A Integron cassette protein VPC_CASS2; mobIle metagenome, structural genomics, PSI-2 protein structure initiative; 2.30A {Vibrio paracholerae} Length = 192 Score = 24.2 bits (52), Expect = 9.5 Identities = 7/26 (26%), Positives = 14/26 (53%) Query: 65 IYQLIFSNVFGNSCRYLPTCSEYGYE 90 I++L ++ N +Y+ +YG E Sbjct: 70 IWRLCVYSIVINCRKYVELNQKYGKE 95 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.319 0.140 0.443 Gapped Lambda K H 0.267 0.0545 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 1,306,718 Number of extensions: 58213 Number of successful extensions: 87 Number of sequences better than 10.0: 1 Number of HSP's gapped: 87 Number of HSP's successfully gapped: 8 Length of query: 139 Length of database: 5,693,230 Length adjustment: 83 Effective length of query: 56 Effective length of database: 3,680,978 Effective search space: 206134768 Effective search space used: 206134768 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.2 bits)