RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780885|ref|YP_003065298.1| hypothetical protein CLIBASIA_03910 [Candidatus Liberibacter asiaticus str. psy62] (207 letters) >gnl|CDD|148695 pfam07238, PilZ, PilZ domain. This domain is found in a wide variety of bacterial signalling proteins. Length = 102 Score = 41.7 bits (98), Expect = 1e-04 Identities = 24/101 (23%), Positives = 44/101 (43%), Gaps = 9/101 (8%) Query: 12 DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGER-SIVFV---- 66 +R RV V+L LL G Y+ ++ +IS GG + P +G+ + Sbjct: 1 QRRREPRVPVNLPVTLLLGGGELYSGVIIDISLGGAALRLPEP-LQLGDEVRLRLTLPDD 59 Query: 67 EKVGRIEGKVVNFDSN---RGYAVRIVTSENERRKLADKLI 104 + G+VV + G V+ + + E R+L ++L+ Sbjct: 60 GIKLLVPGRVVRIRPDGDGYGVGVQFLELDEESRRLLERLL 100 Score = 33.2 bits (76), Expect = 0.044 Identities = 21/92 (22%), Positives = 39/92 (42%), Gaps = 16/92 (17%) Query: 130 VDAQLVLNDNTKHSCKVIDISESGVSVS----------VDLQIEMFSKVLFNDILGRVVR 179 + L+L +S +IDIS G ++ V L++ + + + GRVVR Sbjct: 12 LPVTLLLGGGELYSGVIIDISLGGAALRLPEPLQLGDEVRLRLTLPDDGIKLLVPGRVVR 71 Query: 180 IFPG----GIAIEFSSVQESNIAFKSLINHCY 207 I P G+ ++F + E + + L + Sbjct: 72 IRPDGDGYGVGVQFLELDEESR--RLLERLLF 101 >gnl|CDD|180154 PRK05591, rplQ, 50S ribosomal protein L17; Validated. Length = 113 Score = 32.0 bits (74), Expect = 0.12 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 3/29 (10%) Query: 88 RIVTSE---NERRKLADKLIWLANKDDLH 113 RI T+ E R++ +KLI LA K DLH Sbjct: 30 RIETTLPKAKELRRVVEKLITLAKKGDLH 58 >gnl|CDD|183163 PRK11498, bcsA, cellulose synthase catalytic subunit; Provisional. Length = 852 Score = 26.9 bits (60), Expect = 4.2 Identities = 20/75 (26%), Positives = 33/75 (44%), Gaps = 11/75 (14%) Query: 14 RAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLV-----------GERS 62 R RV++ + DG ++C V++ S GGL I + L+ G++ Sbjct: 683 RRSHRVEMTMPAAIAREDGHLFSCTVQDFSDGGLGIKINGQAQLLEGQKVNLLLKRGQQE 742 Query: 63 IVFVEKVGRIEGKVV 77 VF +V R+ G V Sbjct: 743 YVFPTQVTRVMGNEV 757 >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional. Length = 2849 Score = 26.5 bits (58), Expect = 4.7 Identities = 12/54 (22%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Query: 154 VSVSVDLQIEMFSKVL-FNDILGRVVRIFPGGIAIEFSSVQESNIAFKSLI-NH 205 + + +D+Q E+F K F+D + + +P F+ + + + L NH Sbjct: 662 LKLDLDIQYELFKKFFHFHDKNAKYLNGYPSFFIFPFNHIAKKELKKNPLFKNH 715 >gnl|CDD|172365 PRK13838, PRK13838, conjugal transfer pilin processing protease TraF; Provisional. Length = 176 Score = 26.5 bits (59), Expect = 5.5 Identities = 15/35 (42%), Positives = 19/35 (54%) Query: 151 ESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGI 185 E G SVS+D + S V D GR + FPGG+ Sbjct: 101 EIGGSVSIDGRPLPSSSVRRRDGEGRPLTPFPGGV 135 >gnl|CDD|162408 TIGR01538, portal_SPP1, phage portal protein, SPP1 family. This model represents one of several distantly related families of phage portal protein. This protein forms a hole, or portal, that enables DNA passage during packaging and ejection. It also forms the junction between the phage head (capsid) and the tail proteins. It functions as a dodecamer of a single polypeptide of average mol. wt. of 40-90 KDa. Length = 412 Score = 26.4 bits (58), Expect = 6.1 Identities = 20/78 (25%), Positives = 33/78 (42%), Gaps = 15/78 (19%) Query: 76 VVNF-----DSNRGYAVRI-VTSENERRKLADKLIWLANKDDLH------LQDCRAYGRK 123 N+ D GY V V ++ + L D L LAN++D H ++D GR Sbjct: 52 SHNWHKYIVDQKTGYLVGNPVKFTSDDKTLLDYLNELANQNDFHDILNELVKDLSNKGRA 111 Query: 124 ---ITRDREVDAQLVLND 138 + D + + +V+ D Sbjct: 112 YELLYVDEDDETDVVIFD 129 >gnl|CDD|180093 PRK05452, PRK05452, anaerobic nitric oxide reductase flavorubredoxin; Provisional. Length = 479 Score = 26.3 bits (58), Expect = 6.6 Identities = 14/55 (25%), Positives = 23/55 (41%), Gaps = 6/55 (10%) Query: 114 LQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKV 168 L+ CR +GR+I R Q L + + + E+ + + DL M V Sbjct: 382 LELCREHGREIAR------QWALAPLPQSTVNTVVKEETSATTTADLGPRMQCSV 430 >gnl|CDD|163282 TIGR03476, HpnL, putative membrane protein. This family of hydrophobic proteins is observed in two distinct contexts. It is primarily found in the presence of genes for the biosynthesis and elaboration of hopene where we assign the gene symbol HpnL. In a subset of the genomes containing HpnL a second, often plasmid-encoded, homolog is observed in a context implying the biosynthesis of 2-aminoethylphosphonate head-group containing lipids. Length = 318 Score = 25.8 bits (57), Expect = 7.5 Identities = 7/23 (30%), Positives = 14/23 (60%) Query: 148 DISESGVSVSVDLQIEMFSKVLF 170 ++G SV VDL + ++++F Sbjct: 107 PAPDAGASVVVDLTLTALAQLIF 129 >gnl|CDD|185281 PRK15383, PRK15383, type III secretion system protein; Provisional. Length = 335 Score = 25.7 bits (56), Expect = 7.7 Identities = 14/51 (27%), Positives = 22/51 (43%), Gaps = 2/51 (3%) Query: 16 FQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFV 66 F R LKG + ++ C + PGG CI D M L + +++ Sbjct: 192 FYRNLFLLKGSDAFLEAGKHGC--HHLQPGGGCIYLDADMLLTDKLGTLYL 240 >gnl|CDD|184050 PRK13430, PRK13430, F0F1 ATP synthase subunit delta; Provisional. Length = 271 Score = 25.7 bits (57), Expect = 8.1 Identities = 16/58 (27%), Positives = 26/58 (44%), Gaps = 18/58 (31%) Query: 83 RGYAVRIVT-----SENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLV 135 RG +V VT S+ ++++LA L R YGR + + EVD ++ Sbjct: 198 RGRSVATVTTAVPLSDEQKQRLAAAL-------------SRIYGRPVHLNSEVDPSVL 242 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.326 0.142 0.418 Gapped Lambda K H 0.267 0.0716 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,313,470 Number of extensions: 206379 Number of successful extensions: 456 Number of sequences better than 10.0: 1 Number of HSP's gapped: 455 Number of HSP's successfully gapped: 16 Length of query: 207 Length of database: 5,994,473 Length adjustment: 89 Effective length of query: 118 Effective length of database: 4,071,361 Effective search space: 480420598 Effective search space used: 480420598 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 55 (25.0 bits)