RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780886|ref|YP_003065299.1| hypothetical protein CLIBASIA_03915 [Candidatus Liberibacter asiaticus str. psy62] (41 letters) >gnl|CDD|152121 pfam11685, DUF3281, Protein of unknown function (DUF3281). This family of bacterial proteins has no known function. Length = 269 Score = 26.3 bits (58), Expect = 1.9 Identities = 12/21 (57%), Positives = 14/21 (66%) Query: 4 KGLIVASIISSTAIMSSCSYS 24 K LI A IISST ++ SC S Sbjct: 3 KLLIGAVIISSTVLLGSCGKS 23 >gnl|CDD|178409 PLN02813, PLN02813, pfkB-type carbohydrate kinase family protein. Length = 426 Score = 24.0 bits (52), Expect = 9.3 Identities = 11/33 (33%), Positives = 16/33 (48%) Query: 8 VASIISSTAIMSSCSYSWNLKHAIRKIEIAIKE 40 +AS IS + ++ Y W L I I A +E Sbjct: 218 LASAISKSRVLVVEGYLWELPQTIEAIAQACEE 250 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.318 0.125 0.343 Gapped Lambda K H 0.267 0.0844 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 572,069 Number of extensions: 18056 Number of successful extensions: 56 Number of sequences better than 10.0: 1 Number of HSP's gapped: 56 Number of HSP's successfully gapped: 7 Length of query: 41 Length of database: 5,994,473 Length adjustment: 15 Effective length of query: 26 Effective length of database: 5,670,353 Effective search space: 147429178 Effective search space used: 147429178 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (22.8 bits)