RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780887|ref|YP_003065300.1| hypothetical protein CLIBASIA_03920 [Candidatus Liberibacter asiaticus str. psy62] (86 letters) >gnl|CDD|150299 pfam09586, YfhO, Bacterial membrane protein YfhO. This protein is a conserved membrane protein. The yfhO gene is transcribed in Difco sporulation medium and the transcription is affected by the YvrGHb two-component system. Some members of this family have been annotated as glycosyl transferases of the PMT family. Length = 835 Score = 27.2 bits (61), Expect = 0.95 Identities = 9/33 (27%), Positives = 13/33 (39%) Query: 48 TVSFELINNLNYSVSTNDKPFTYPSRGASSSDL 80 V EL N S++ K + Y SR + Sbjct: 433 VVVLELGLNAYLSLNGISKEWQYSSRSLYAEYY 465 >gnl|CDD|149555 pfam08540, HMG_CoA_synt_C, Hydroxymethylglutaryl-coenzyme A synthase C terminal. Length = 282 Score = 25.8 bits (57), Expect = 2.5 Identities = 9/26 (34%), Positives = 14/26 (53%) Query: 23 MGLRHKNHPKKALKPSCNLSTIIPQT 48 M LR + H KK P ++ ++ P T Sbjct: 240 MELREQAHHKKNFTPQGSIDSLFPGT 265 >gnl|CDD|162552 TIGR01833, HMG-CoA-S_euk, 3-hydroxy-3-methylglutaryl-CoA-synthase, eukaryotic clade. Hydroxymethylglutaryl(HMG)-CoA synthase is the first step of isopentenyl pyrophosphate (IPP) biosynthesis via the mevalonate pathway. This pathway is found mainly in eukaryotes, but also in archaea and some bacteria. This model is specific for eukaryotes. Length = 454 Score = 24.7 bits (54), Expect = 5.1 Identities = 10/35 (28%), Positives = 17/35 (48%) Query: 23 MGLRHKNHPKKALKPSCNLSTIIPQTVSFELINNL 57 M LR + H KK P ++ + P T E +++ Sbjct: 412 MELREQAHHKKNFTPQGSIDLLFPGTWYLERVDSK 446 >gnl|CDD|184763 PRK14607, PRK14607, bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional. Length = 534 Score = 24.3 bits (53), Expect = 7.7 Identities = 7/9 (77%), Positives = 8/9 (88%) Query: 23 MGLRHKNHP 31 MG+RHK HP Sbjct: 154 MGIRHKEHP 162 >gnl|CDD|182223 PRK10073, PRK10073, putative glycosyl transferase; Provisional. Length = 328 Score = 24.2 bits (53), Expect = 8.1 Identities = 10/34 (29%), Positives = 17/34 (50%), Gaps = 8/34 (23%) Query: 6 KKILKVGSMGITR--------IRFEMGLRHKNHP 31 ++ V +G+ R I+FE GL H++ P Sbjct: 160 RRWTHVVWLGVYRRDFIVKNNIKFEPGLHHQDIP 193 >gnl|CDD|182064 PRK09762, PRK09762, galactosamine-6-phosphate isomerase; Provisional. Length = 232 Score = 24.0 bits (52), Expect = 8.4 Identities = 8/26 (30%), Positives = 18/26 (69%) Query: 29 NHPKKALKPSCNLSTIIPQTVSFELI 54 N P ++L+P+C++S + +T E++ Sbjct: 141 NEPGESLQPACHISQLDARTQQHEML 166 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.316 0.132 0.374 Gapped Lambda K H 0.267 0.0655 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,280,646 Number of extensions: 61399 Number of successful extensions: 91 Number of sequences better than 10.0: 1 Number of HSP's gapped: 91 Number of HSP's successfully gapped: 9 Length of query: 86 Length of database: 5,994,473 Length adjustment: 55 Effective length of query: 31 Effective length of database: 4,806,033 Effective search space: 148987023 Effective search space used: 148987023 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.2 bits)