HHsearch alignment for GI: 254780889 and conserved domain: TIGR01305

>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase; InterPro: IPR005993 Guanosine monophosphate reductase (1.7.1.7 from EC) catalyzes the irreversible and NADPH-dependent reductive deamination of GMP into IMP. NADPH + guanosine 5-phosphate = NADP+ + inosine 5-phosphate + NH3 It converts nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and maintains intracellular balance of A and G nucleotides. A deep split separates two families of GMP reductase. This family includes both eukaryotic and some proteobacterial sequences. ; GO: 0003920 GMP reductase activity, 0009117 nucleotide metabolic process.
Probab=100.00  E-value=0  Score=462.06  Aligned_cols=324  Identities=38%  Similarity=0.652  Sum_probs=285.2

Q ss_pred             CCCCCHHEEECCCCCCCCCC-CEEEEEEEC----CCCEECCCEEEECCCCCCCHHHHHHHHHCCCEEEECCCCCHHHHHH
Q ss_conf             64460005752764324754-225334303----8816003178337852368889999997798799978989899999
Q gi|254780889|r   12 VALTFDDVLLRPEFSNVLPR-DIDISTRIA----KDFTLNLPIMSAAMDQVTDSRLAIAMAQAGGLGVIHRNFSPSEQVA   86 (493)
Q Consensus        12 ~~lTfDDVllvP~~s~v~~~-~vdl~t~lt----~~i~l~iPivSs~MDTVTe~~MAiamA~~GGiGvIHrn~sie~qa~   86 (493)
T Consensus         6 ~kl~fkdvl~rPkrs~lksr~~v~l~r~~~f~~s~~~~~G~P~~~~nmdtvGtf~ma~~l~~~~~~t~~hkhys~~~---   82 (343)
T TIGR01305         6 LKLDFKDVLLRPKRSTLKSRADVELEREFTFRNSKQTYSGVPIIAANMDTVGTFEMAAALASHKILTAIHKHYSVDE---   82 (343)
T ss_pred             CCCCCEEEEECCCCCCCCCCCCCEECCEEEEECCCCEECCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCHHH---
T ss_conf             25562014641661001121100001002331146600354267633542105789998752256646665303688---


Q ss_pred             HHHHHHHHCCCEECCCEEEECCCCHHHHHHHHHHHCCCCEEEECCCCEEEEEEEEHHHHCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99987422388152878994654303456566760504167866886027887235450014344672440026786325
Q gi|254780889|r   87 QVHQVKKFESGMVVNPVTISPYATLADALALMKKYSISGIPVVESDVGKLVGILTNRDVRFASNAQQAVGELMTRNLITV  166 (493)
Q Consensus        87 ~V~kVKr~e~gmI~dPVti~pd~TI~ea~~lm~~~~is~iPVVD~~~gkLiGIVT~rDir~~~~~~~~V~eiMt~~litv  166 (493)
T Consensus        83 ----W~~f~~----------------------------------~~~~------------------~~l~~~--------   98 (343)
T TIGR01305        83 ----WKAFAA----------------------------------SASP------------------DVLKNV--------   98 (343)
T ss_pred             ----HHHHHH----------------------------------CCCH------------------HHHHHH--------
T ss_conf             ----999872----------------------------------1334------------------576543--------


Q ss_pred             CCCCCHHHHHHHHHHCCCCEEEEECCCCCEEEEEEECCCHHCCCCCCCCCCCCCCEEEEEEEECCCHHHHHHHHHHHC--
Q ss_conf             730358999999986553306457479978688980210001017422326568765556651370156789998731--
Q gi|254780889|r  167 KKTVNLENAKALLHQHRIEKLLVVDDDGCCIGLITVKDIERSQLNPNATKDSKGRLRVAAAVSVAKDIADRVGPLFDV--  244 (493)
Q Consensus       167 ~~~~~l~eA~~iM~~~ki~~LPVVDe~g~LvGIIT~~DIlk~~~~p~A~~D~~grL~VgAAIg~~~d~~eRa~~Lvea--  244 (493)
T Consensus        99 ----------------------------------------------------------~~s~G~~~~d~~k~~~~~~~~P  120 (343)
T TIGR01305        99 ----------------------------------------------------------AVSSGSSDNDLEKLKSILEEVP  120 (343)
T ss_pred             ----------------------------------------------------------HHHCCCCHHHHHHHHHHHHHCC
T ss_conf             ----------------------------------------------------------3305885446899999997267


Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHHHCCCCCEECCCCCCHHHHHHHHHCCCCEEEEEECCCCCCCCCHHCCCCCCCCHH
Q ss_conf             36669982484113889999999998579872451464699999999854875899610278766531000157431003
Q gi|254780889|r  245 NVDLVVVDTAHGHSQKVLDAVVQIKKNFPSLLVMAGNIATAEGALALIDAGADIIKVGIGPGSICTTRVVTGVGCPQLSA  324 (493)
Q Consensus       245 GvDviviD~ahGh~~~~~~~i~~~k~~~~~~~ii~GNv~t~~~~~~l~~~Gad~ikvGig~Gs~CtTr~~~g~g~pq~~a  324 (493)
T Consensus       121 ~~~~~C~dvanGyse~fv~f~~~~r~~~P~~ti~aGnvvtGem~eelilsGadi~kvG~GPGsvCttr~k~GvGyPqlsa  200 (343)
T TIGR01305       121 QLKFICLDVANGYSEHFVEFVKKVREAYPKKTIMAGNVVTGEMVEELILSGADIVKVGIGPGSVCTTRKKTGVGYPQLSA  200 (343)
T ss_pred             CCEEEEEEECCCCHHHHHHHHHHHHHHCCCCEEEECCCEEHHHHHHHHHCCCCEEEECCCCCCEECCCCCCCCCCHHHHH
T ss_conf             70379986035621789999999997365330431341004677877734763799635887501122004567513667


Q ss_pred             HHHHHHHHHCCCCEEEEECCCCCHHHHEEEEEECCCEEEECCHHHCCCCCCCCEEEECCEEEEEEECCCCHHHHHH--CC
Q ss_conf             7889998622698199726543777621336714878993230101216776448736805888733200688752--21
Q gi|254780889|r  325 IMSVVEVAERAGVAIVADGGIRFSGDIAKAIAAGSACVMIGSLLAGTDESPGDIFLYQGRSFKSYRGMGSVAAMER--GS  402 (493)
Q Consensus       325 v~~~~~~~~~~~~~iiadGGi~~~gdi~kAla~GA~~VM~G~~~agt~Espg~~~~~~g~~~K~yrGm~S~~A~~~--~~  402 (493)
T Consensus       201 v~eCad~ahGl~G~~~sdGGC~~PGdvakaf~~gadfvm~GG~~~Gh~~~~G~~~e~nG~k~~lfyGmss~~am~~h~G~  280 (343)
T TIGR01305       201 VIECADAAHGLKGHIVSDGGCTTPGDVAKAFGAGADFVMLGGLLAGHEESGGEVVEENGKKFKLFYGMSSDTAMKKHAGG  280 (343)
T ss_pred             HHHHHHHCCCCCCEEEECCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCHHHHCCCCEEEEEECCCHHHHHHHCCCC
T ss_conf             65432101575524872688898126788773477767652201153210114522068658887515526777531575


Q ss_pred             HHHHCCCCCCCCCCEECCCCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHCCEEEEECHH
Q ss_conf             22210123334331004540266210575899899999999985551575877689737599999553
Q gi|254780889|r  403 SARYSQDGVTDVLKLVPEGIEGRVPYKGPIASVLHQMSGGLKSSMGYVGASNIEEFQKKANFIRVSVA  470