>TIGR03520 GldE gliding motility-associated protein GldE. Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldC is a protein linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. GldE was discovered because of its adjacency to GldD in F. johnsonii. Overexpression of GldE partially supresses the effects of a GldB point mutant suggesting that GldB and GldE interact. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Not all Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility and in fact some do not appear to express the gliding phenotype.

Probab=96.96 E-value=0.0008 Score=46.85 Aligned_cols=61 Identities=10% Similarity=0.201 Sum_probs=54.2 Q ss_pred CCCCCCCCCCCCC--CCCCCCCCCCHHHHHHHHHHCCCCEEEEECCC-CCEEEEEEECCCHHCC Q ss_conf 3446724400267--86325730358999999986553306457479-9786889802100010 Q gi|254780889|r 149 SNAQQAVGELMTR--NLITVKKTVNLENAKALLHQHRIEKLLVVDDD-GCCIGLITVKDIERSQ 209 (493) Q Consensus 149 ~~~~~~V~eiMt~--~litv~~~~~l~eA~~iM~~~ki~~LPVVDe~-g~LvGIIT~~DIlk~~ 209 (493) T Consensus 187 ~l~~~~v~eiMtPr~~v~~l~~~~~~~e~~~~~~~~~~SR~PV~~~~~D~iiGiv~~kDll~~~ 250 (408) T TIGR03520 187 SFGNTDTKQVMRPRLDIFALDIETSFSEIIPKIIENGYSRIPVYKETIDNITGVLYIKDLLPHL 250 (408) T ss_pred CCCCCEEHHCCCCHHHEEEEECCCHHHHHHHHHHHCCCCCCEEECCCCCCEEEEEEHHHHHHHH T ss_conf 7599890342354579588406443899999998579872226658987617997798998787

HHsearch alignment for GI: 254780889 and conserved domain: TIGR03520