>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA. OpuCA is the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment but the function of the CBS domains in OpuCA remains unknown. In the related ABC transporter, OpuA, the tandem CBS domains have been shown to function as sensors for ionic strength, whereby they control the transport activity through an electronic switching mechanism. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. They are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzi

Probab=99.83 E-value=4.4e-20 Score=163.48 Aligned_cols=105 Identities=29% Similarity=0.462 Sum_probs=98.3 Q ss_pred CCCEEEECCCCHHHHHHHHHHHCCCCEEEECCCCEEEEEEEEHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHH Q ss_conf 28789946543034565667605041678668860278872354500143446724400267863257303589999999 Q gi|254780889|r 100 VNPVTISPYATLADALALMKKYSISGIPVVESDVGKLVGILTNRDVRFASNAQQAVGELMTRNLITVKKTVNLENAKALL 179 (493) Q Consensus 100 ~dPVti~pd~TI~ea~~lm~~~~is~iPVVD~~~gkLiGIVT~rDir~~~~~~~~V~eiMt~~litv~~~~~l~eA~~iM 179 (493) T Consensus 1 t~pvtv~pd~~l~eA~~lm~~~~~~~l~VVd~~-g~l~Givt~~Dl~~~--~~~~v~d~m~~~~~tv~~d~~l~~a~~~M 77 (106) T cd04582 1 TEPITVRPDDPLSDALGLMDDSDLRALTVVDAD-GQPLGFVTRREAARA--SGGCCGDHAEPFKVTVSVDDDLRIVLSRM 77 (106) T ss_pred CCCEEECCCCCHHHHHHHHHHCCCCEEEEECCC-CCEEEEEEHHHHHHH--CCCCHHHCCCCCCEEECCCCCHHHHHHHH T ss_conf 998389998939999999997399879999799-978999899998763--08953451025766997999999999999 Q ss_pred HHCCCCEEEEECCCCCEEEEEEECCCHH Q ss_conf 8655330645747997868898021000 Q gi|254780889|r 180 HQHRIEKLLVVDDDGCCIGLITVKDIER 207 (493) Q Consensus 180 ~~~ki~~LPVVDe~g~LvGIIT~~DIlk 207 (493) T Consensus 78 ~~~~i~~lPVVD~~grlvGivT~~Di~~ 105 (106) T cd04582 78 FAHDMSWLPCVDEDGRYVGEVTQRSIAD 105 (106) T ss_pred HHCCCCEEEEECCCCEEEEEEEHHHHHC T ss_conf 9729876258989990999998688425

HHsearch alignment for GI: 254780889 and conserved domain: cd04582