>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain. Members of CAP_ED, include CAP which binds cAMP, FNR (fumarate and nitrate reductase) which uses an iron-sulfur cluster to sense oxygen, and CooA a heme containing CO sensor. In all cases binding of the effector leads to conformational changes and the ability to activate transcription. DUF294 is a putative nucleotidyltransferase with a conserved DxD motif. The PB1 domain adopts a beta-grasp fold, similar to that found in ubiquitin and Ras-binding domains. A motif, variously termed OPR, PC and AID, represents the most conserved region of the majority of PB1 domains, and is necessary for PB1 domain function. This function is the formation of PB1 domain heterodimers, although not all PB1 domain pai

Probab=99.83 E-value=2.1e-20 Score=165.75 Aligned_cols=107 Identities=30% Similarity=0.488 Sum_probs=98.3 Q ss_pred CCCEEEECCCCHHHHHHHHHHHCCCCEEEECCCCEEEEEEEEHHHHCC------CCCCCCCCCCCCCCCCCCCCCCCCHH Q ss_conf 287899465430345656676050416786688602788723545001------43446724400267863257303589 Q gi|254780889|r 100 VNPVTISPYATLADALALMKKYSISGIPVVESDVGKLVGILTNRDVRF------ASNAQQAVGELMTRNLITVKKTVNLE 173 (493) Q Consensus 100 ~dPVti~pd~TI~ea~~lm~~~~is~iPVVD~~~gkLiGIVT~rDir~------~~~~~~~V~eiMt~~litv~~~~~l~ 173 (493) T Consensus 1 t~Pitv~p~~ti~ea~~~M~~~~i~~~~V~d~--~~l~GivT~~Dl~~~~~~~~~~~~~~~v~~iMt~~~~tv~~~~~l~ 78 (113) T cd04587 1 TKPATVSPTTTVQEAAKLMREKRVSCVLVMDG--NKLVGIFTSKDIALRVVAQGLDPESTLVERVMTPNPVCATSDTPVL 78 (113) T ss_pred CCCEEECCCCCHHHHHHHHHHCCCCEEEEEEC--CEEEEEEEEHHHHHHHHHCCCCHHHCEEEEEECCCCEEEECCCCHH T ss_conf 98989899499999999999729988999989--9999999845987899873998320898866616846990799999 Q ss_pred HHHHHHHHCCCCEEEEECCCCCEEEEEEECCCHHC Q ss_conf 99999986553306457479978688980210001 Q gi|254780889|r 174 NAKALLHQHRIEKLLVVDDDGCCIGLITVKDIERS 208 (493) Q Consensus 174 eA~~iM~~~ki~~LPVVDe~g~LvGIIT~~DIlk~ 208 (493) T Consensus 79 ~a~~~m~~~~i~~lpVvd~~~~~vGiit~~Dil~A 113 (113) T cd04587 79 EALHLMVQGKFRHLPVVDKSGQVVGLLDVTKLTHA 113 (113) T ss_pred HHHHHHHHCCCEEEEEEECCCEEEEEEEHHHHHCC T ss_conf 99999987794199999269989999984885278

HHsearch alignment for GI: 254780889 and conserved domain: cd04587