HHsearch alignment for GI: 254780889 and conserved domain: cd04623

>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=98.29  E-value=9.2e-07  Score=67.92  Aligned_cols=49  Identities=33%  Similarity=0.584  Sum_probs=36.6

Q ss_pred             CCCCCCCCCCCHHHHHHHHHHCCCCEEEEECCCCCEEEEEEECCCHHCC
Q ss_conf             7863257303589999999865533064574799786889802100010
Q gi|254780889|r  161 RNLITVKKTVNLENAKALLHQHRIEKLLVVDDDGCCIGLITVKDIERSQ  209 (493)
Q Consensus       161 ~~litv~~~~~l~eA~~iM~~~ki~~LPVVDe~g~LvGIIT~~DIlk~~  209 (493)
T Consensus         1 r~vvti~~~~tl~ea~~~m~~~~~~~l~Vvd~~~~l~Giit~~Di~~~~   49 (113)
T cd04623           1 RDVITVRPDATVAEAAKLMAEKNIGAVVVVDDGGRLVGIFSERDIVRKV   49 (113)
T ss_pred             CCCEEECCCCCHHHHHHHHHHCCCCEEEEECCCCCEEEEEEHHHHHHHH
T ss_conf             9976968939799999999973998899990898299999768999999